(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE55

PENCW_10.PE55        Location/Qualifiers
FT   CDS_pept        join(129330..129452,129547..130191)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076497" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824592"
FT                   /orf_name="Pc13g00550"
FT                   /product="Pc13g00550 protein"
FT                   /protein_id="CAP91124.1"
FT                   /db_xref="UniParc:UPI0001830E9C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H193"
FT                   /transl_table=1
FT                   /translation="MTKYRHWVPFQLGRMFRLLYEFNYTPQIRAFITLIPIPRTREYIQ
FT                   QLEQQLRSFQRLGVAATQDVQKAGRKVAAENASLRSLLMIHGVTKIQIEEYLESQRQTA
FT                   SSIQSQYPSVVSLPSTNLHRPTADGQPSVDHHHSLSSQEVNSTSHPPKTLEVRSSPPRS
FT                   DPKISMNISNRQESSAGRAVELGSVTAETVPDSQHFGGVQDTGQFTSCVTAASLIESIR
FT                   NHSDFRDVRSELGCDSEPNCMVKNMSIFDILDR"
     atgactaaat atcgccactg ggttccgttt cagcttggtc gtatgttcag actactctac        60
     gagttcaact acactcccca aatacgtgcg ttcattactc tcatccccat tccaagaaca       120
     agggagtaca tccagcaact tgagcaacaa ttaaggtcat tccaaaggct tggcgtagca       180
     gcgacacagg atgttcaaaa agcaggaaga aaagttgcgg cagaaaatgc ttctctccga       240
     tccctgctga tgatccatgg tgttaccaaa atacaaatcg aggaatactt ggaatctcaa       300
     agacaaacag cgagctctat ccaatctcag tatccatcag ttgtctccct accatcaaca       360
     aacttacacc ggccgacggc cgacggccaa ccttctgtgg atcaccacca ttctctgtct       420
     tctcaagagg tgaacagcac gtcgcatccg cctaaaaccc ttgaggtgag atcttcgccg       480
     cccagatccg acccaaagat cagcatgaat atctccaata gacaagaatc aagtgcaggg       540
     cgagcagtcg agctcggttc cgtcacagct gaaactgtcc ctgattcaca gcactttggc       600
     ggtgttcagg atacaggtca atttacatcg tgcgtgactg cagcaagtct tatcgaatct       660
     atacgaaatc attcagactt tcgtgatgtg cgatccgaac ttggatgtga ttcggaacca       720
     aattgtatgg tgaaaaatat gtcgattttc gacatattgg ataggtga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page