(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE57

PENCW_10.PE57        Location/Qualifiers
FT   CDS_pept        join(complement(133640..133922),complement(133446..133588),
FT                   complement(133311..133397),complement(132590..133246))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112302" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128942"
FT                   /orf_name="Pc13g00570"
FT                   /product="Pc13g00570 protein"
FT                   /function="bile acid:sodium symporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91126.1"
FT                   /db_xref="GO:0008508"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="UniParc:UPI0001830E9E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H138"
FT                   /transl_table=1
FT                   /translation="MAAPTGRHPTKESEYHNSILHSQPPTPTAEDVEKQESEESTAKQS
FT                   AFKGLGWLDRFLALWIFLAMAVGIILGNFVENTGPALQKGKFVGVSIPIAIGLLVMMYP
FT                   ILCKVRYESLHHVFRERGVWIQIGFSIFINWIIAPLLMLALAWAFLPDEPELREGLILV
FT                   GLARCIAMVLIWTGLAGGDNEYCAILVAVNSLLQMVLFAPLAILFIKVIGHSGSQVTLS
FT                   YSTAAKSVAVFLGIPLGAAIITRIVLRKITSPRWYDQVFLKWAGPWSLIGLLFTILVLF
FT                   ASQGRQVVHQIVSVVRVAAPLIVYFIVVFFITLLVTYKLGFGYKLSATQSFTAASNNFE
FT                   LAIAVAVATFGANSNQALAATVGPLIEVPVLLGLVYVAKFIAKRAGWKD"
     atggccgccc caacaggtcg gcacccgacg aaggaatcgg aatatcataa ctcaatactg        60
     catagccagc cgccaactcc tactgctgag gatgtcgaaa agcaagaatc ggaagagtct       120
     acagccaagc aatcagcctt caaaggtctt ggctggttag atcgttttct cgccttgtgg       180
     atcttccttg ccatggccgt tggaattatc ctaggcaact ttgttgaaaa tacgggtcct       240
     gctctccaaa aagggaaatt cgtgggggtt tccatcccaa tcgcaatcgg tctcttggtc       300
     atgatgtatc ctattctttg caaagtacga tacgaatctt tgcaccatgt attccgagag       360
     cgtggggtct ggattcaaat tgggttcagc atcttcatca attggattat tgctccttta       420
     ttgatgcttg cactagcatg ggctttccta ccggacgagc cagaacttcg ggaggggttg       480
     attctcgttg gattagccag atgcatcgct atggttctca tctggaccgg tctcgctggc       540
     ggtgataatg aatattgcgc tattcttgtt gcggtaaatt cactgcttca gatggtgctc       600
     ttcgctccct tggcaatcct cttcattaag gtcattggcc actcgggcag tcaagttaca       660
     ctctcatatt ctaccgctgc caaaagcgtg gcggtgttcc ttggcattcc attaggtgcc       720
     gcaatcatta cccgcattgt acttcgaaag ataactagcc cacgttggta cgaccaggtt       780
     tttctgaagt gggctggccc gtggtccctt attgggcttc tttttacgat ccttgtgttg       840
     ttcgcatctc agggccgcca ggtggttcat cagattgtat cagtcgttcg agttgccgct       900
     ccgctcatcg tttattttat cgtcgtcttc ttcattactc ttcttgtgac ttacaagctc       960
     gggttcggtt acaagttgtc tgctactcaa agtttcactg ctgccagcaa taattttgag      1020
     cttgctattg ctgtcgctgt cgcaacattt ggtgccaaca gcaatcaggc gcttgccgcc      1080
     actgtcgggc cgttgattga ggttccagta ctgcttggcc ttgtctatgt tgccaaattc      1140
     atagccaagc gagctggctg gaaagactga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page