(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE58

PENCW_10.PE58        Location/Qualifiers
FT   CDS_pept        join(134893..135215,135356..135408,135572..135603)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000273093" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824594"
FT                   /orf_name="Pc13g00580"
FT                   /product="Pc13g00580 protein"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="CAP91127.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="UniParc:UPI0001830E9F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H139"
FT                   /transl_table=1
FT                   /translation="MAKPSVLFVCVHNAGRSQMAAGYLMHLAGDTIEVRSAGSAPADSI
FT                   NPVVVEAMREEGIDLSNQKPKILTADAVQDSDVVITMGCGDVCPFFAGKRYLDWQLNDP
FT                   AGQGVLGEQPLCGGWPLVALLTSVCPYKDAG"
     atggctaagc ctagtgtatt gttcgtctgc gttcacaacg ctggtcgctc ccaaatggcc        60
     gccggctatc tcatgcatct ggctggtgac accattgaag tccgctctgc cggatcggcc       120
     ccagccgact ccatcaatcc agtcgttgtc gaggctatgc gcgaagaggg catcgacctc       180
     agcaaccaaa aacctaagat tctcactgcc gatgcagtcc aagacagcga tgtggtcatt       240
     accatgggct gtggcgatgt ctgccccttc ttcgctggca aacgctacct cgattggcaa       300
     ctcaatgacc ccgccgggca aggggtgctt ggcgaacagc cgttgtgcgg gggatggccg       360
     ttggttgctt tacttacttc ggtctgtcca tacaaggatg caggttga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page