(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE59

PENCW_10.PE59        Location/Qualifiers
FT   CDS_pept        join(136113..136426,136472..137147)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076557" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824595"
FT                   /orf_name="Pc13g00590"
FT                   /product="Putative uncharacterized protein Pc13g00590 "
FT                   /protein_id="CAP91128.1"
FT                   /db_xref="UniParc:UPI0001830EA0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H140"
FT                   /transl_table=1
FT                   /translation="MPSNSTFPAIIHIRDFVEHVEPDPTRPGKGLSLQLRVSLNLPWKD
FT                   IQSDDVEQDEILTLVRFFNEGNQSDLYKPNTFVYSSGSFLTTSSDDEEFHIVLHAHNLD
FT                   RHPGNEEDIESYFMHCPEAAQPIVTFLGVVIERGGQLNGGPTLLHYRLQTTVYNSSTRT
FT                   NHTFPITAYFKNGQRWANFPPLSMNTHVFLTGRVFGLTKEHRQLAVVTDDIHFLPTPNN
FT                   QLPATPPSTGKRKRVDRWSQRAGPQTPTKSAARPQTESLHITYQSQDPTQMIAPGEDDE
FT                   EDAQITWPDTPEEIKASSRTTTPVPERRSQRPRKTSYADILAQSKYDT"
     atgccttcga attctacttt tcccgctatt atccatattc gggactttgt cgagcatgtc        60
     gaaccggatc ctacacgtcc cggcaaaggg ctttccctgc aactccgtgt ttcgctcaat       120
     ctaccatgga aagatatcca gtcagacgat gttgaacagg atgaaattct caccttggtc       180
     agatttttca atgagggcaa tcagtccgac ctttacaaac caaacacttt cgtctattcc       240
     tccggttcat tcctgactac ttcatctgat gacgaggaat ttcatatcgt cctccacgcc       300
     cacaatctgg accgtcatcc ggggaatgaa gaagatatcg aatcgtattt catgcactgt       360
     cccgaggctg cccagccaat agtgacattt ctcggtgtcg ttattgagcg cggtggccaa       420
     ctaaacggcg ggcccactct tcttcactac cgtctccaga ctactgttta caatagttca       480
     acccgaacca atcacacctt tcccatcacc gcttacttta aaaatggtca gcgttgggcc       540
     aactttccac ccttgagtat gaacacccat gttttcttga ccggtcgtgt tttcggcctc       600
     acaaaagagc atcgccagtt agctgtcgtt acggatgata tacattttct cccaacacca       660
     aataaccagt tgcccgctac tcctccctct actggtaaac ggaagcgcgt ggaccgttgg       720
     tctcaaagag ccggcccaca aacgcccacc aaatcggctg caaggccaca gaccgagtcc       780
     cttcatatca cgtaccagtc ccaggatccc actcaaatga ttgcgcctgg tgaggacgat       840
     gaggaagacg cgcaaattac atggccagac acgcccgaag aaatcaaagc ctcgtcgcgg       900
     actaccaccc cagttccgga aaggcgttcc caacgaccac gtaagacatc atatgccgat       960
     atacttgcac aatcgaaata cgacacctga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page