(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE60

PENCW_10.PE60        Location/Qualifiers
FT   CDS_pept        join(complement(142177..142532),complement(141890..142115),
FT                   complement(141771..141830),complement(141426..141716),
FT                   complement(141141..141369),complement(140929..141088),
FT                   complement(138607..140872))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076558" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824596"
FT                   /orf_name="Pc13g00600"
FT                   /product="Pc13g00600 protein"
FT                   /function="binding"
FT                   /protein_id="CAP91129.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001830F60"
FT                   /db_xref="UniProtKB/TrEMBL:B6H141"
FT                   /transl_table=1
FT                   /translation="MASQKKWYVFRVTGLSRERPDGDLETTLQEAIDDNFADDETSHIK
FT                   PEIKIVPSCYESDTERAALVQFRGGVPQFLAELRVNPLGDWQIEMGDDDISFDCHFFGF
FT                   TQLYMPDGNKPVIADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPQCRTMIYGY
FT                   NSKLSSHGVDTILDYGRELIEEIKKIRNTKELQQRPLIFIAHSFGGIIVAHCLVKAIQT
FT                   MEGDHPAITSLYQATYGMILFAIPHKGLMMDDIQQMLAGDQSHPRERLLQQISSKSDLL
FT                   IHQLADFKNLIRDRKVVSFYETEQTRQLVLDSESGRWKRTGDFVTTVGADSALLQLPDH
FT                   VEDKVPLHADHSMVVKFNTRNAAGYRTAVDKLRQFLKDAPSMVAARFTQTRPKPQPCST
FT                   VPFKKDPMFVGREVVISAINERYRAIGQRHERVGLVGLAGVGKTQTAIEYSYRVRESTP
FT                   DTWVFWIHASNTARLEQGYQQIATVAEIPGRDDPKINILQLVYQWLCDARNGRWLVVLD
FT                   NADDDGIFFSDNTFNERGPLVSFLPQAAHGSMLITSRNGLAARNLVGSESHVIRVQPMN
FT                   EAESLSLLRARIPAPQSGESGESGGNERALVQALECIPLAITQAAAYIANRLPLVTVTE
FT                   YLRLFHESESKRTRLLQNEDSADLRRDPSIRYAVITTWQLSFEQIRQERPTATDLLALM
FT                   SMFDRQGIPEDLVRDHNQDILDFHDALAPLLSYSLIRLEINERLFDMHRLVQLSVRAWL
FT                   DMHQQLYGWQAKSRQIMARVFPGGEYESWSQCRSLLAHANSVLQSICDVDDEDRLNAAT
FT                   LLSNCGWFLHLQGVYEEAELMHRRALEARENALGREHPDTLTSVSDLGLVLSSQGKYDE
FT                   AEAMHRRALEARENALGREHPDTLTSVSNLGDVLSSQGVYEEAEAMHRRALEARENVLG
FT                   REHPDTLTSVSDLGNVLSSQGVYEEAEAMHRRALEARENALGREHPDTLTSVSNLGDVL
FT                   SSQGVYEEAEAMHRRALEARENVLGREHPDTLTSVSDLGNVLSSQGKYDEAEAMHRRAL
FT                   EARENVLGREHPSTLTSVNNLGLVLSSQGKYDEAEAIYLHDMEGSEKVLGCEHPNTVTS
FT                   INNLGLVLSSQGNYDEGEAMHRRALEAREKVLRREHPDTLTSVSTLGNVLSSQGKYDEA
FT                   EAIYLHDMEGSENVLGCEHPGILASLNIR"
     atggctagtc agaaaaagtg gtacgttttt cgtgtgacgg gcctgtcgag agaacggccc        60
     gatggggatc tcgagaccac gttgcaagag gcaatcgacg acaacttcgc cgatgacgag       120
     acatcgcaca tcaaaccgga gatcaaaatc gttccttcat gctatgaaag tgacacagag       180
     agggcggcgc tggtgcagtt tcgcggtggg gtgcctcagt tcctcgctga gctgagagtc       240
     aacccgctcg gagactggca gatcgagatg ggagatgatg acatcagctt tgactgccac       300
     ttctttggat ttacccagct ctacatgcca gacggaaata agcctgtgat tgccgacatc       360
     attgccattg ccggactaga tggacatgcg tatggatcgt ggcaaggaag aggaaatctt       420
     ggtcgtatgt ggctccgtga cttcctgtcg aaggatcttc cgcagtgccg caccatgata       480
     tacgggtaca attccaagct gtcgagccat ggagtcgata cgatcctcga ctatgggcgg       540
     gagctgatag aagagatcaa gaaaatccgg aatacgaagg agctccaaca gagacctctg       600
     atattcatcg cacacagctt tggaggcatt atcgtggctc attgcctagt gaaggctatc       660
     cagacaatgg agggagacca cccggcgatc acgtcactgt atcaagccac ttacggcatg       720
     atccttttcg ctatcccaca taaaggattg atgatggacg atatccagca gatgctagca       780
     ggggaccaga gccatccgcg agagcgacta ctacagcaga tctccagtaa atcggacctg       840
     ttgatccacc agctggcgga tttcaaaaat ctaatacggg accgcaaggt ggtgagcttc       900
     tatgagacgg agcagacgag gcagttagta ttggattcag aaagcggacg gtggaaacgc       960
     accggggatt ttgtgacgac ggttggcgca gactcggctc ttctccagct ccccgaccat      1020
     gtagaggaca aggtgccgct gcatgcagat cactcgatgg tggtcaaatt caacacgcgc      1080
     aacgcggccg ggtatcgcac ggcggtcgat aaattgcggc agttcttaaa agacgcgcca      1140
     tcgatggtgg cggctcggtt cacgcagacg cgtccgaagc cccagccgtg ctccacggtc      1200
     ccttttaaga aggacccgat gtttgtgggc cgcgaagttg tgatcagtgc gatcaatgaa      1260
     agatataggg cgatcggcca gcgtcacgag cgggtgggat tggtggggtt ggccggcgtt      1320
     ggaaaaaccc agacagccat cgagtattcc tatcgtgtgc gagaatctac accggacacg      1380
     tgggtgtttt ggatccacgc cagcaatacg gcgcggctgg aacagggcta ccagcagatt      1440
     gccacagttg cggagattcc gggacgagac gatccgaaga tcaacattct ccagcttgtg      1500
     tatcagtggt tgtgtgatgc acgcaatggg cgctggctgg tggtgctaga taatgcggat      1560
     gacgatggga tctttttcag tgacaataca ttcaacgaac gagggccgtt ggtgagcttc      1620
     ctgccccagg ccgcccatgg atcgatgctg atcacatcgc ggaatggtct tgcggcacgg      1680
     aatctggtgg ggagcgagag tcatgtgatc agggttcagc caatgaatga ggcagagtcc      1740
     ctgtcgcttt tacgggcaag gattccagcc ccccaatcag gagagtctgg agagtctgga      1800
     gggaacgaga gggcactggt ccaggcatta gagtgtatcc cattggctat cactcaggct      1860
     gcggcgtata ttgccaaccg gttgcccctt gttaccgtca cggaatacct tcggcttttc      1920
     catgaaagcg agtcgaagcg gacgcggctt ctccagaatg aggattctgc ggatctccgg      1980
     agggatccca gcattcggta tgccgtgatc acaacgtggc agttatcgtt tgagcagatc      2040
     cgtcaggagc ggcctacggc gaccgatctc ctggcgttga tgagtatgtt cgatcggcag      2100
     ggaatccccg aagatctggt gcgcgaccac aaccaagata tcctggactt ccacgatgca      2160
     ttggcgccgc tgctcagcta ttctctgatc cgactagaaa taaacgaacg gctgttcgat      2220
     atgcaccgcc tcgtgcagtt atcggtccgg gcgtggctgg acatgcacca gcagctttac      2280
     ggctggcagg ccaaatcacg ccagattatg gcacgggtat ttccaggtgg cgagtacgag      2340
     agctggtcac aatgccggtc gctccttgcg catgccaaca gtgtgctgca gtctatatgt      2400
     gacgtagatg atgaagatcg attgaatgct gccaccctct tatctaattg tgggtggttt      2460
     ctacatcttc aaggagttta tgaagaggca gaattgatgc atcgacgggc gttggaagca      2520
     cgagagaatg cgcttggacg tgagcatcct gacacgctca ccagtgtcag tgaccttggc      2580
     ttagttctct ccagccaagg gaaatatgac gaggcggaag cgatgcatcg acgggcgttg      2640
     gaagcacgag agaatgcgct tggacgtgag catcctgaca cgctcaccag tgtcagtaac      2700
     cttggcgatg ttctctccag ccaaggagtt tatgaagagg cggaagcgat gcaccgacgg      2760
     gcgttggaag cacgagagaa tgtgcttgga cgtgagcatc ctgacacgct caccagtgtc      2820
     agtgaccttg gcaatgttct ctccagccaa ggagtttatg aagaggcgga agcgatgcat      2880
     cgacgggcgt tggaagcacg agagaatgcg cttggacgtg agcatcctga cacgctcacc      2940
     agtgtcagta accttggcga tgttctctcc agccaaggag tttatgaaga ggcggaagcg      3000
     atgcaccgac gggcgttgga agcacgagag aatgtgcttg gacgtgagca tcctgacacg      3060
     ctcaccagtg tcagtgacct tggcaatgtt ctctccagcc aagggaaata tgacgaggcg      3120
     gaagcgatgc atcgacgggc gttggaagca cgagagaatg tgcttggacg tgagcatcct      3180
     agcacgctca ctagtgtcaa taaccttggc ttagttctct ccagccaagg gaaatatgac      3240
     gaggcggaag cgatatacct acatgacatg gaaggtagtg agaaggtcct tggatgtgag      3300
     catcctaaca cggtcaccag tatcaataac cttggcttag ttctctccag ccaaggaaac      3360
     tatgacgagg gggaagcgat gcaccgacgg gcgttggaag cacgagagaa ggtgcttaga      3420
     cgtgagcatc ctgacacgct caccagtgtc agtacccttg gcaatgttct ttccagccaa      3480
     gggaaatatg acgaggcgga agcgatatac ctacatgaca tggaaggtag tgagaacgtc      3540
     cttggatgtg agcatcctgg aatactggct agtctcaata ttcgttag                   3588
//

If you have problems or comments...

PBIL Back to PBIL home page