(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE62

PENCW_10.PE62        Location/Qualifiers
FT   CDS_pept        join(complement(156706..157073),complement(156419..156644),
FT                   complement(155952..156242),complement(155670..155898),
FT                   complement(155446..155605),complement(152801..155387))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076558" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977826"
FT                   /orf_name="Pc13g00620"
FT                   /product="Pc13g00620 protein"
FT                   /function="binding"
FT                   /function="microtubule motor activity"
FT                   /cellular_component="kinesin complex"
FT                   /protein_id="CAP91131.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005871"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001830F61"
FT                   /db_xref="UniProtKB/TrEMBL:B6H150"
FT                   /transl_table=1
FT                   /translation="MANQRKSHVFRVTGLSIKLPDGDLKTDEDFRTALYGTLNDNFIDD
FT                   ENSQIKSDITIVPSCYESDTQRVALVQFRGGMPQFLRDHDPLGDWQVEIGDDDISFDCH
FT                   FFGFTQLYTLDENKPVDADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPQCRTM
FT                   IYGYNSKLSSPGVNTILDYGRELMEEIKKIRNTKECLVRAIQTLEEDHPAITSLHRATY
FT                   GMILFAIPHKGLVMDDIQQMLGGDGHHPREKLLRQISSQSDVLIHQLADFKNLIRDRKV
FT                   VSFYETEQTKRLVLDLESGCWKRTGDFMTTVDADSALLQLPDHIEDKVPLHADHSMIVK
FT                   FDTRNAAGYRTALDKLRQLSKDAPAVVAARFAQTRQKPQPCSTVPFERDPVFVGRKYEI
FT                   NAIEKKHGTIGQRHERVALVGLAGVGKTQTAIEYSYCVRESTPDMWVFWIHASNLERLE
FT                   QGYRQIAAVTEIPGRDDPKINILQLVYQWLCDARNGRWLIVLDNADDDSIFFRENESKE
FT                   RGPLVNFLPQAAHGSMLITSRNGRAARNLVGRNSHVIEVQPMNEEESVALLRRWIPAPQ
FT                   SGDFGESGEDEKALVQALEYIPLAITQAGSYIANRLPLITVTAYLRLFHESESKRTRLL
FT                   KNEDSTDLRRDPSIRYAVITTWQISFEQIRQERPVASDLLALMSMFDRQGIPVDLVRES
FT                   EQDELDFHDALVPLLNYSLIRLEINERLFDMHRLVQLSVRAWLEMHQQLYSWQAKSREI
FT                   MARVFPDGEYESWTQCRSLLAHAKSVLNSIYDVEGEDRLNTATLLSNCGWFLNLQGAYE
FT                   EAELMHRRALEAREKVLGREHPSTLISVNNLGLVLSKQGQYDEAEAMHRRALEAREKVL
FT                   GREHPDTLTSVNNLGLVLSNQGKYEEAGAMHQRALEAREKVLGREHPSTLGSVSNLGNV
FT                   LGRQGKYEEAEAMYRRALKAREKVLGREHPDTLIGVSNLGVVLFKQGQYEEAEAIYRRA
FT                   LKAREKVLGREHPDTLTSVNNLGDVLSKQGKYEEAEAMHRGALEVKEKVLGREHPSTLI
FT                   SVNNLGLVLTKQGQYEEAEAMYRRALEARQKVLGREHPDTLTSVNNLGLVLKSQGKYKE
FT                   AEAMYRRALEARQKVLGQEHPDTLGSVNNFASVLSKQGQYKEAEAMYRRALDGYEKVLG
FT                   REHPDTLMSVNNLGSVLFKQGQYEEAEAMYRRALEARQKVLGREHPDTLTSVNNLGDVL
FT                   SKQGRHEEAEAMHRWAQTVDSSTLMQQGILLKNIFSTPHPLLQLSLRHHRSLEEKHDRD
FT                   VD"
     atggctaatc agagaaagtc gcacgtcttc cgggtgacag gcttatcgat aaaactgccc        60
     gatggcgatc tcaagacaga tgaggatttc aggacagcat tatatgggac actcaacgat       120
     aatttcatcg acgacgagaa ttcgcagatc aagagcgaca ttacaatcgt gccttcatgc       180
     tacgaaagtg acacacagag agtggcgctg gtacagtttc gcggcgggat gcctcagttc       240
     ctccgtgacc acgacccgct cggagactgg caggttgaaa ttggagacga tgatataagc       300
     tttgactgcc acttctttgg gtttacccag ctctatacgc tggacgaaaa taagcctgtg       360
     gatgcagata tcattgcgat cgccggactg gatggacatg cgtacggatc atggcaagga       420
     agaggaaatc tcggtcggat gtggctccgt gacttcctgt cgaaggatct gccgcagtgt       480
     cgcaccatga tctacgggta caactccaag ctgtcgagcc ccggagtcaa tacgatcctc       540
     gactacgggc gggaactgat ggaggagatc aagaaaattc ggaacacgaa ggagtgcctg       600
     gtgagggcca tccaaacact ggaagaagac cacccagcga tcacgtcgct gcatcgagcc       660
     acgtacggca tgatcctctt cgctatcccg cataaagggc tagtgatgga cgatatccaa       720
     cagatgttgg gcggcgatgg acaccatccg cgagagaaac tcctacgcca gatttccagc       780
     caatcggatg tcttgattca tcaattggcc gactttaaaa acctgatccg ggaccgtaag       840
     gtggtcagct tctatgagac agagcagacg aagcggttgg tattagactt ggaaagcgga       900
     tgttggaaac gcactggaga tttcatgaca acggttgacg cagactcggc tcttcttcag       960
     cttcccgacc acatagaaga caaggtgccg ctgcatgcag atcactcaat gatcgtgaaa      1020
     ttcgacacgc gcaatgcggc cggatatcga acagcgctgg acaaactgcg ccagctctca      1080
     aaggatgcgc cagcagtggt ggcggctcgg tttgcgcaga cgcgccagaa gccccagccg      1140
     tgctctacag tgccctttga gagagacccg gtgtttgtgg gccgtaaata tgagatcaat      1200
     gcaatcgaga aaaaacatgg gacgatcggc cagcgtcacg agcgggtggc attggtggga      1260
     cttgccggtg ttgggaaaac ccagacagcc atcgagtatt cttattgcgt gcgagaatca      1320
     acaccagaca tgtgggtttt ttggatccac gccagtaatc tggagcggtt ggaacagggc      1380
     tacaggcaga ttgccgcagt aacggagatt ccgggacgcg atgatccgaa gataaacatc      1440
     ctccaactcg tgtatcagtg gttgtgtgat gcacgaaacg ggcgctggtt gattgtgcta      1500
     gataatgcag atgacgatag tatctttttc agggaaaatg aatccaagga acgagggcca      1560
     ctggtgaact tcctgcccca ggccgcccat ggatcaatgc tgatcacatc gcgaaatggt      1620
     cgtgcggcac ggaatctggt ggggaggaac agtcatgtga tcgaagttca accaatgaac      1680
     gaggaagagt ctgtcgccct tctacggaga tggattccgg ccccccaatc tggagatttt      1740
     ggagagtctg gagaggacga gaaggcactg gtccaagcac ttgaatatat tccgctggca      1800
     atcactcagg cgggatccta tattgccaac cgtcttcctc tcattaccgt caccgcctac      1860
     ctccgacttt tccatgaaag cgagtcgaag cggacgcggc ttctcaagaa tgaggattcc      1920
     acggatctcc ggcgcgatcc cagcattcgg tatgcggtga tcacaacctg gcagatatct      1980
     tttgagcaga ttcgtcagga gcggcccgtg gcgtccgacc tcctggcgtt aatgagtatg      2040
     ttcgatcggc agggaatccc agtggacttg gtgcgcgagt ctgaacaaga tgagctagat      2100
     tttcacgatg cattggtacc gctgcttaat tattctctga tccggctgga aatcaacgaa      2160
     cggttgtttg acatgcaccg cctagtgcag ttatcggtcc gagcgtggct ggagatgcac      2220
     cagcagctct acagctggca ggccaaatca cgagagatta tggcacgggt atttccagat      2280
     ggcgagtacg aaagctggac acaatgtcga tcgctccttg cgcatgccaa aagtgtgctg      2340
     aattctatat atgacgtgga gggtgaagat cgattaaata ccgccaccct cttatctaat      2400
     tgtggatggt ttctaaatct tcaaggagcc tatgaagagg cagaattaat gcatcgacgg      2460
     gcgttagaag cacgagagaa ggtgcttgga cgcgagcatc cctccacact catcagtgtc      2520
     aataaccttg gcttagtgct ctccaagcaa gggcaatatg acgaggcgga agcgatgcat      2580
     cgacgggcgc tagaagcacg agagaaggtg cttggacgcg agcatcccga cacgctcacc      2640
     agtgtcaata accttggctt ggtactttcc aaccaaggga aatatgaaga ggcgggagcg      2700
     atgcatcaac gggcgttgga agcacgagag aaggtgcttg gacgcgagca tccctcgacg      2760
     ctcggtagtg tcagtaacct tggcaatgtg cttggtaggc aagggaaata tgaagaggcg      2820
     gaagcgatgt atcgacgggc attaaaagca cgagagaagg tacttggacg cgagcatcct      2880
     gacacgctca tcggtgtcag taaccttggc gtagtgctct tcaagcaagg gcaatatgaa      2940
     gaggcggaag cgatatatcg acgggcatta aaagcacgag agaaggtact tggacgcgag      3000
     catcccgaca cgctgaccag tgtcaataac cttggcgatg tactctctaa gcaagggaaa      3060
     tatgaagagg cagaagcgat gcatcgaggg gcgctagaag taaaagagaa ggtgcttgga      3120
     cgcgagcatc cctccacact catcagtgtc aataaccttg gcttagtgct caccaagcaa      3180
     gggcaatatg aagaggcgga agcgatgtat cgacgggcat tggaagcacg acagaaggta      3240
     cttggacgag agcatcccga cacgctcacc agtgtcaata accttggctt agtgcttaaa      3300
     agccaaggga aatataaaga ggcggaagca atgtatcgac gggcgttgga agcacgacag      3360
     aaggtacttg gacaagagca tcccgacacg ctcggcagtg tcaataactt tgcctcagtg      3420
     ctctccaagc aagggcaata taaagaggcg gaagcgatgt atcgacgggc actagatgga      3480
     tatgagaagg tacttggacg cgagcatcct gacacgctca tgagtgtcaa taaccttggc      3540
     tcagtgctct tcaagcaagg gcaatatgaa gaggcggaag caatgtatcg acgggcatta      3600
     gaagcacgac agaaggtgct tggacgcgag catcccgaca cgctcaccag tgtcaataac      3660
     cttggcgatg tactctccaa gcaagggaga catgaagagg cggaagcgat gcatcgatgg      3720
     gcacagactg tggattctag taccctcatg cagcaaggaa tcctgcttaa gaacatattc      3780
     tccactcctc atccgttgct tcaattgtcg ttaaggcatc atcgatcact ggaagagaaa      3840
     catgaccgtg acgtcgactg a                                                3861
//

If you have problems or comments...

PBIL Back to PBIL home page