(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE65

PENCW_10.PE65        Location/Qualifiers
FT   CDS_pept        complement(161665..>163221)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948703"
FT                   /orf_name="Pc13g00650"
FT                   /product="Pc13g00650 protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP91134.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="UniParc:UPI0001830F63"
FT                   /db_xref="UniProtKB/TrEMBL:B6H152"
FT                   /transl_table=1
FT                   /translation="HTYAIQSISTGIPASTLWRRANNRPSIADKAANQQYLTPQEEQAL
FT                   VEYVLRLADNGYPLSVKFLRSLALIIVRQRSSNFQITDPSLKVRTPGKNWPQGFYRRHP
FT                   QLKARRLRAIDWKRDGRHIEDKVRHWFDIIGRELANPAILLEVYNMDETGVLLSVLNSL
FT                   KVLVSKDDLRKHRGTTMKRTLVMAIECISADGRFLHPLIIWPAATHRSSWTTHPTPGWH
FT                   FSCSKTGYTNTEISLYWVEHVFDPQTRDRAGGRPRLLICDGFGTHESLEVMKFCFANRI
FT                   ILCRLPSHTSHKLQPCDVGVFSPLKTAYRAQIEQACRAGVSTIGKPHFTYLYDSARKEA
FT                   FTPRNIRSAWSRSGLFPFDPSRVLRECQASSEIQTTTPVEAPTVSSNICHTPNTSDSFA
FT                   LLRSEVEQDTQNLDGVCKRRLQTLSCATERVFAERALLLEENRILFEQNNEKTCRQSSG
FT                   LTVLGHAKVMSYEDIVEAQKKRDMTVTEQATREKRSKLGASCFRNRRRSARRSRRFKHG
FT                   I"
     cacacatacg caattcagtc gatatcaacc gggattcccg cgtccacctt gtggcggcga        60
     gccaataaca ggccatcgat cgctgataaa gccgccaatc agcagtatct caccccgcaa       120
     gaggagcaag ccctggttga atatgtgttg cggttggcag acaacggcta tcctctttca       180
     gttaagtttc tacgatcgct cgccctgatt atcgtgcgcc aacgatcgtc gaatttccag       240
     attaccgacc ctagcctcaa ggtccgaact cccggaaaga attggccgca gggcttttat       300
     cgacgacacc cgcagttgaa agcgcgacgg cttcgagcga ttgattggaa gcgagatggc       360
     cggcacatcg aagacaaagt ccgacactgg tttgacatca ttggccgaga gctggccaat       420
     ccggccattc tcctggaggt gtataacatg gacgagacgg gagttcttct cagtgttctc       480
     aactccctca aggtgctcgt cagcaaagac gatttgagaa agcatcgagg gaccacgatg       540
     aagcggacgc tggtcatggc gattgaatgc atttccgccg atggtcggtt cctgcatcct       600
     ctcattatct ggccagccgc tacccatcgc agttcgtgga ccactcaccc cacccccgga       660
     tggcattttt cctgctccaa aacaggctac acgaacacag aaatcagtct gtactgggtg       720
     gaacatgtgt tcgacccgca gactcgagac cgagcgggcg gtcggccacg actcttaatc       780
     tgcgacggtt tcggcaccca tgagtccctg gaggtcatga aattctgctt tgcgaaccgc       840
     attatcctgt gtcgtctccc ttctcatacg tctcacaaac tgcagccgtg cgatgtgggt       900
     gtttttagtc ctctgaaaac ggcataccgg gcacagattg agcaggcatg tcgagctggg       960
     gtgagtacca ttggcaagcc acacttcacg tatctttatg atagtgcccg aaaagaggca      1020
     tttacacccc gcaatatacg gtcggcctgg tccagaagcg gtctctttcc attcgatccg      1080
     tctcgcgtcc tccgagagtg tcaagcgtcc tcagagatac agaccacgac cccagtggag      1140
     gctccgaccg tgtcctctaa tatctgtcac actccaaaca cctctgatag tttcgccttg      1200
     cttcgcagcg aggtcgagca ggacacccag aatctagacg gtgtgtgtaa acgtcgtctg      1260
     cagacactga gctgcgcgac cgaaagggta tttgcagagc gcgccttgtt gctggaggag      1320
     aaccggatcc tatttgagca gaacaatgaa aagacctgtc gacaatccag cggcttgacg      1380
     gtcttaggac atgcaaaagt gatgagctac gaggatatcg ttgaggcgca gaagaaacgc      1440
     gacatgacgg tgacagaaca agccacgcgg gaaaagaggt cgaagctggg ggcaagctgc      1500
     tttcgaaatc ggaggagaag cgcaaggcgg agcaggagat tcaagcatgg gatatga         1557
//

If you have problems or comments...

PBIL Back to PBIL home page