(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE66

PENCW_10.PE66        Location/Qualifiers
FT   CDS_pept        join(164634..164989,165051..165276,165453..165743,
FT                   165800..166028,166086..166495)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076559" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128943"
FT                   /orf_name="Pc13g00660"
FT                   /product="Pc13g00660 protein"
FT                   /protein_id="CAP91135.1"
FT                   /db_xref="UniParc:UPI0001830F64"
FT                   /db_xref="UniProtKB/TrEMBL:B6H143"
FT                   /transl_table=1
FT                   /translation="MASQRKSHVLRVTGLSRELTDGDLTTALQEAINDNFTDDEKSHSK
FT                   VDISIVPSCYEDNTQRVALVQFRGGVPQFLDELRVDPLGEWQVEIGDTDINFDCHFFGF
FT                   TQLYTLDENKPVDADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPRCRTMIYGY
FT                   NSKLSSHGVDTILDYGRELMEEIKKIRNTKECLVRAIQTMEEDHPAITSLHRATYGMIL
FT                   FAIPHKGLVMDDIQQMLAGDKSHPREQLLRQISSKSDVLIHQVADFRNLIRDRKVVSLY
FT                   EMKQTRRLVLDSESGRWKRTGDFMTTVGADSALLQLPDHAEDKVPLHADHSIIVKFDKR
FT                   DAPGYRTALDRLRQFSKDAPSVVAARFNASNAPAALLQGSAVRKRNIIDNDSETPKAKR
FT                   ARLYDSASSPNSEESDTTHYEDDNIFDDISQEKVYNMGEPWEESHKSFSGSLTARDATS
FT                   EIGSPFRYGSSSREGSSSEYELADESDILEPDELSMSEESISSAC"
     atggctagtc agagaaagtc gcacgtgttg cgggtgactg gcctgtcgag ggaactgact        60
     gatggggatc tcacaaccgc gttgcaagag gcaatcaacg acaacttcac tgatgacgaa       120
     aagtcgcata gcaaggttga catttctatt gtcccttcat gctatgagga taatacacag       180
     agggtggcac tggtgcagtt tcgcggtggg gtgcctcagt tcctcgatga actgagagtc       240
     gacccgcttg gagagtggca ggttgagata ggagatactg acattaactt tgactgccac       300
     ttcttcggat ttacccagct ctatacgctg gacgaaaata agcctgtgga tgcagatatc       360
     attgcgatcg ccggactgga tggacatgcg tatggatcgt ggcagggcag aggaaatctc       420
     ggtcggatgt ggctccggga cttcctctcg aaagacctgc cgcggtgccg caccatgatc       480
     tacgggtaca actcgaagct gtcgagccac ggagtcgata cgatccttga ctacgggcgg       540
     gagttgatgg aggagatcaa gaaaattcgg aacacaaaag agtgcttggt gagggccatt       600
     cagaccatgg aagaagacca cccggcgatt acgtccctgc atcgagccac gtacggcatg       660
     atcctctttg ccatcccaca taaaggatta gtgatggacg acatccagca gatgctagca       720
     ggggataaga gtcatccgcg agagcaacta ttaagacaga tttccagcaa atcagatgtc       780
     ttaatccatc aagtagccga ctttagaaat ctgatccggg accgtaaggt ggtcagcttg       840
     tatgagatga agcagacaag gcggttggta ctggactcag agagcggacg atggaaacgc       900
     actggggatt ttatgacgac ggttggcgca gactcggctc ttcttcagct tcccgaccat       960
     gccgaggaca aagtgccact gcatgcagat cactcgataa tcgtcaaatt cgacaagcgc      1020
     gatgcgccgg gatatcgaac ggcgctggat agactgcggc agttctcaaa ggacgcgcca      1080
     tcggtggtgg cggctcggtt taacgcctca aacgccccag ctgcgctctt gcagggatca      1140
     gcagtgagga aacggaacat cattgacaat gattcagaaa cccctaaggc gaaaagggct      1200
     cgtctgtatg actctgcaag ttctccaaac tctgaagaaa gtgacacgac ccactacgaa      1260
     gacgacaaca tattcgatga tatcagccaa gagaaagtct acaatatggg tgaaccttgg      1320
     gaagagagcc ataaaagttt ctcgggaagt ctcacagcta gagatgcaac aagtgaaatt      1380
     ggctcacctt ttcgttatgg atcctcttcg cgggaaggtt catcctctga atatgaactc      1440
     gctgatgaat ctgatattct ggaaccagac gagttgtcta tgtcggagga aagcattagc      1500
     tcagcatgct ag                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page