(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE67

PENCW_10.PE67        Location/Qualifiers
FT   CDS_pept        join(168263..168304,168493..168861)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948704"
FT                   /orf_name="Pc13g00670"
FT                   /product="Putative uncharacterized protein Pc13g00670 "
FT                   /protein_id="CAP91136.1"
FT                   /db_xref="UniParc:UPI0001830F65"
FT                   /db_xref="UniProtKB/TrEMBL:B6H144"
FT                   /transl_table=1
FT                   /translation="MFSSRQVAFSSLGAFLTAPKTKRSKPGRSPAPVGTERELLTSHGM
FT                   HSAQSMRHDLLDLPLIYSLRPSRLPALRAVSKRNGDYNIDCANGFGIQPLPSAETSARM
FT                   AMANFDANADPLANADRVIINGWDXSMAGTIL"
     atgttttcat cacgccaagt agccttcagt tccctgggtg ctttcctcac tgcgccaaaa        60
     acaaagcgat cgaaaccggg ccgcagcccg gcccctgtcg gcacggaacg tgagcttctt       120
     acgtcccatg gcatgcatag cgcacagtcc atgcgacatg atcttctgga tctaccactg       180
     atatactcac ttcgaccatc acgccttcca gccttaaggg ctgtgagcaa gagaaacggg       240
     gattataata ttgattgcgc taatggattt ggaattcaac ccctgcctag cgcggaaacc       300
     tcggcacgca tggctatggc taattttgat gctaacgcgg atcctctggc taacgctgat       360
     cgggtaataa taaacggttg ggacgnatca atggcgggga ctattttgta a                411
//

If you have problems or comments...

PBIL Back to PBIL home page