(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE68

PENCW_10.PE68        Location/Qualifiers
FT   CDS_pept        join(complement(170170..170323),complement(169867..170134),
FT                   complement(169794..169811),complement(169552..169744))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076561" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948705"
FT                   /orf_name="Pc13g00680"
FT                   /product="Putative uncharacterized protein Pc13g00680 "
FT                   /protein_id="CAP91137.1"
FT                   /db_xref="UniParc:UPI0001830F66"
FT                   /db_xref="UniProtKB/TrEMBL:B6H145"
FT                   /transl_table=1
FT                   /translation="MFGYGHFSLRIFKGSNSPHFLLPSIPYFTVSPRTPCLTSRQLQWV
FT                   TKEIRSGSPEPNDIWSPRTSIAGSVDDDCHSQQTDVSDEEGKATSMDGCSDEEETQGQW
FT                   AKEHTKERALDGARSVKFLKPEDSTESMVKMIECMAELDGRVQSDAKSLEGQDRWNQGM
FT                   QRKYIDMIGAIDTLSKDVATLRKQVEALSSRDAAKTREVVGSKRQKQ"
     atgtttgggt acggtcactt ttcacttcga atctttaagg gatcaaattc cccccatttc        60
     ttactaccct ccattcctta tttcactgtt tctccccgaa ccccctgctt gacttcaaga       120
     cagttgcaat gggtgaccaa agaaattcgc agcggttcac cggagccaaa cgatatttgg       180
     agcccccgca cgtcaatcgc cggctctgta gacgatgatt gccattccca acagaccgat       240
     gtatccgatg aggaaggcaa ggctacctcc atggatggat gcagtgatga agaggaaact       300
     cagggacaat gggccaagga acataccaag gaacgggcct tggatggagc cagatccgta       360
     aagttcttga aacctgagga ttccacagag tcaatggtga aaatgatcga atgtatggcc       420
     gaattagatg ggcgggtgca atctgatgca aagtcgctcg agggccagga ccggtggaat       480
     cagggaatgc agcgaaagta tatagatatg attggtgcta tagacacgtt gagtaaagat       540
     gttgctacat tgaggaaaca agtggaggct ttgtcgagca gggatgcagc caaaactcga       600
     gaggtcgtgg gttcgaagcg tcaaaagcag tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page