(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE71

PENCW_10.PE71        Location/Qualifiers
FT   CDS_pept        join(complement(174520..174541),complement(173650..174437))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948708"
FT                   /orf_name="Pc13g00710"
FT                   /product="Pc13g00710 protein"
FT                   /protein_id="CAP91140.1"
FT                   /db_xref="UniParc:UPI0001830F69"
FT                   /db_xref="UniProtKB/TrEMBL:B6H148"
FT                   /transl_table=1
FT                   /translation="MSKTRLVASSISTYDDRVLVPGTTERCCTPPEGAQNLPHGAQGSE
FT                   GAQNLPHGAQGNEGAQNLPHGAQGNEGAQNLPHGAQGSEGAQNLPHGAHGSEGAQNLPH
FT                   GAQGNEGAQNLPHGAQGSEGAQNLPHGAHGSEGAQNLPHGAQGNEGAQNLPHGAQGSEG
FT                   AQNLPHGAQGNEGAQNLPHGAQGSEGAQNLPHGAQGNEGAQNLPHGAQGSEGAQNLPHG
FT                   AHGSEGAQNLPHGAHGSEGGQEACSYSPKWARRAFLSVPTTRLDKYH"
     atgtcaaaaa ctcgtcttgt ggcttcctcg atatcgacgt atgatgatcg agtactggtc        60
     cctggcacca cggagaggtg ctgcacgccg ccagagggag cacaaaattt acctcacggg       120
     gctcagggca gtgagggagc acaaaattta cctcacgggg ctcagggcaa tgagggagca       180
     caaaatttac ctcacggggc tcagggcaat gagggagcac aaaatttacc tcacggggct       240
     cagggcagtg agggagcaca aaatttacct cacggggctc atggcagtga gggagcacaa       300
     aatttacctc acggggctca gggcaatgag ggagcacaaa atttacctca cggggctcag       360
     ggcagtgagg gagcacaaaa tttacctcac ggggctcatg gcagtgaggg agcacaaaat       420
     ttacctcacg gggctcaggg caatgaggga gcacaaaatt tacctcacgg ggctcagggc       480
     agtgagggag cacaaaattt acctcacggg gctcagggca atgagggagc acaaaattta       540
     cctcacgggg ctcagggcag tgagggagca caaaatttac ctcacggggc tcagggcaat       600
     gagggagcac aaaatttacc tcacggggct cagggcagtg agggagcaca aaatttacct       660
     cacggggctc atggcagtga gggagcacaa aatttacctc acggggctca tggcagtgag       720
     ggagggcagg aagcctgctc ctactctcca aagtgggcgc gtagggcttt tttatccgtt       780
     cccactacga gactcgataa gtaccattaa                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page