(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE72

PENCW_10.PE72        Location/Qualifiers
FT   CDS_pept        join(176999..177032,177089..177328,177465..179262,
FT                   179303..179318,179494..180063)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076563" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824597"
FT                   /orf_name="Pc13g00720"
FT                   /product="Putative uncharacterized protein Pc13g00720 "
FT                   /protein_id="CAP91141.1"
FT                   /db_xref="UniParc:UPI0001830F6A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H149"
FT                   /transl_table=1
FT                   /translation="MASRVNQLASDVIKANNTVLEEILRRDRILRRNPQPSRRSAGSPF
FT                   PLESAEEPANFMQVQIDVDPPDGMAIETQRTDAQASASKRGAGTRNYKVRKNQSQEEIA
FT                   QNFHGTFTQKRTFHAIEAKVYFLTGKSHFRKRNKKTSRKRPVSLTPRSSPPPSQFSGSV
FT                   DSTQQLISRSSIEVHDLRLAPNLLPYLNSEDCEDGDSYGLHGVQPVDPERETSDLHAVP
FT                   EQDTANQMLSCQRAPQEREPQSGTSQNESPVRGSRQAEESPKAHPGFSDLVGESQPRNG
FT                   NPTNVFAAISKMGDACLPRSSPLEPPRISEPIQSPIRHPPEDDITLEWLGQTLSCCAET
FT                   STMHMEQADTAHGNQSLETLSPQSSSRENSLTRGSENEGFNDESHTESVPRSPTPFQVP
FT                   EPSSTGNSTEHHPQNCGMDEPTIDASESAFIDKKLIIRCLHEKSKSQAARSHPNWNHKD
FT                   LNRLLGWHMKRKNLPKERLEVEFLRDFGHYRSSSAIVTACRRKRKADSRHKDVTSAPTP
FT                   GRLTPLAPVLNTKPVSRPPNAIIGSDTPSLHSSHTAAVPSNENTTLKPPPLERSRSRHL
FT                   TQPQILGNIDRFSRDMAPPLHESDETVDQSSPAAVAPESASGQMVCWTPDSAEDTPTLG
FT                   NRRHRVEITPKPPSRFTAINGGNVHPADPNSTAQPETNKRDAVPNGQGGQRASKEKKKG
FT                   SRLTPEHELAGSNNSKRSAGTSEGAENQRSLPIDVSDANIAQLGMRTDLQNTSQSQERD
FT                   VDIPPKNNSQLTYIQNPDPNCPPNSQVANTRPSHFCRPNSQSGASQTSGVSGSAHTGGL
FT                   FTPHTSGPAYPDMRPEAIVPISVSASFLSSPTCLPHYPLHVLQGGGAERYQGPPLPSLA
FT                   QQMYYHRTGEPLHK"
     atggcatcac gggtgaacca acttgcatcg gacgtcatca aagccaataa cactgtgctt        60
     gaagagatac taagaaggga tcgaatcctc cgccgcaatc cgcagccaag tcgaagatcg       120
     gcgggctcgc cctttcctct ggaatcagcc gaagagccag caaactttat gcaagtgcag       180
     attgacgttg atccgccgga tggaatggct atcgagactc aaaggacaga cgcgcaagcc       240
     agtgcttcaa aacgtggtgc tggaacacgg aactacaaag tacggaagaa tcagtcgcag       300
     gaagagattg cacaaaattt tcacggaaca ttcacacaaa aaaggacttt tcatgctatt       360
     gaggcaaaag tgtatttctt aacaggaaaa agtcatttta ggaagcgcaa taaaaagact       420
     tcgcgcaaaa gacctgtgtc tttgacacct cgctcctctc caccgccgtc tcaattctct       480
     ggatcagtgg attccaccca acaattgatc tcgagatcga gcattgaggt tcacgattta       540
     cgtttagccc cgaacctgct tccatatctg aattctgaag actgcgagga tggagattct       600
     tacggccttc atggtgttca accggttgac cctgaaagag aaaccagcga tctacatgca       660
     gtacctgaac aggatactgc gaatcaaatg ttaagttgcc agcgcgcccc tcaggagcgt       720
     gaacctcagt caggtacaag tcaaaatgag tcgccagttc gaggaagccg ccaggcggaa       780
     gaatcgccta aagcccatcc aggtttctca gacctggtgg gcgaaagtca gccaaggaat       840
     ggtaatccaa ccaatgtctt cgccgcaata tcaaagatgg gtgatgcttg cttgccacga       900
     agctctccct tagaaccccc tcggatatca gagcctatcc aatctccaat ccggcatccc       960
     cctgaagacg atatcacact cgaatggcta ggccaaacgc tttcctgttg tgctgagacc      1020
     agtacaatgc acatggagca ggcagacacg gcacatggca accaatcatt agagacgctt      1080
     tctccgcaat cttcatcacg cgaaaattca ttgactagag gttcagaaaa tgagggtttc      1140
     aatgatgaaa gccacacaga aagtgtgccc aggtcaccaa cgcccttcca agttcctgaa      1200
     ccaagctcca ctggtaactc cactgagcat caccctcaaa actgcggaat ggatgagcca      1260
     accattgatg cctctgaaag tgctttcatt gacaaaaaat tgattataag atgtctccat      1320
     gagaagtcta aatcacaggc ggcgcgttct catcccaatt ggaaccataa ggacctgaac      1380
     cgtttactag ggtggcacat gaaacggaaa aacctaccaa aggagagact tgaagttgag      1440
     tttctgagag actttggcca ctatcgatca tcttctgcta tcgttacagc ttgtcgcaga      1500
     aagagaaagg cagattctcg ccataaggat gtaacctcag cccccactcc aggtcgacta      1560
     actccgcttg ctcccgttct caatactaag ccggtatcac gaccacccaa cgccatcatt      1620
     gggtccgaca ctcccagctt gcattcatcg catactgcag cagtaccgag caatgagaat      1680
     actacactca agcctccacc gctggagcga tctagatcgc gacaccttac tcagccacag      1740
     atcctaggca acatagacag attttctcgc gatatggctc caccgttaca tgagagcgac      1800
     gaaacagtgg atcaaagttc accggctgcc gttgcccccg aatccgcttc cggacagatg      1860
     gtatgttgga cacccgacag cgccgaagat acccccacgt tgggcaatcg gcgccaccga      1920
     gttgaaatca cgccaaaacc tccatccagg ttcacagcaa tcaatggcgg gaacgttcat      1980
     cccgctgatc caaattcaac tgctcagccg gagaccaata agcgagacgc tgtacctaat      2040
     gggcaaggag gccagcgagc atcaaaagaa aaaaagaagg gttccagact tacccctgag      2100
     cacgaactgg caggttcaaa taactcaaag cggtcagccg gaacatcaga aggagctgag      2160
     aaccagcggt cactgccaat tgatgtttca gatgccaaca ttgcacaact gggaatgcgt      2220
     acagacttgc agaacacatc gcagtctcaa gagcgggacg tcgatatccc acccaaaaac      2280
     aactcccagc tcacttacat acaaaacccg gacccaaatt gcccgcccaa ctcccaagtt      2340
     gcaaacacca gaccatccca tttctgcagg cccaattccc aatccggggc ttctcaaact      2400
     agcggtgtgt caggaagcgc tcacacaggc ggtttgttca caccccatac tagtggtccc      2460
     gcgtatcctg acatgaggcc cgaagcaatt gttccaatat cagtctcagc atccttcctg      2520
     agcagcccaa cctgtcttcc tcactatccg cttcacgtgt tgcagggagg cggtgccgaa      2580
     cggtaccaag gccctccgct cccatccttg gcgcagcaaa tgtattacca tcgtacgggt      2640
     gagccacttc ataaatag                                                    2658
//

If you have problems or comments...

PBIL Back to PBIL home page