(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE73

PENCW_10.PE73        Location/Qualifiers
FT   CDS_pept        join(complement(182961..182994),complement(182691..182888),
FT                   complement(181507..182633),complement(181317..181367))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200312" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128944"
FT                   /orf_name="Pc13g00730"
FT                   /product="Pc13g00730 protein"
FT                   /protein_id="CAP91142.1"
FT                   /db_xref="UniParc:UPI0001830F6B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H153"
FT                   /transl_table=1
FT                   /translation="MGSRSLSSEFQECERKCQWLEQSRAPSTVHLPSDRWWGLITLHLN
FT                   LLHEHEQFFVMCQHPSVSLDVKNVPEKYEMSDRSLKYMLCFIETVSSILKRLILSNSEL
FT                   GDSLFEQLGDVARYGMFAEKLNREYWNVISRCWYQKAADRNPDSGRIQHHLGDLSQPDP
FT                   LQTLFFLTKALISAQPFPGSRVTVGRFFNDWPNLALQENSMATYFIAAHYVLLRGDSTG
FT                   RFMTFINGFLSLLPSYMEHHGHQGQHTVYVMSCNFASVFGYHNPAFMAVGSSQSQSGHT
FT                   PQTNELGPANQKQACVSNCSINQPAYPTKQALQGVHLTFRTLSVLLQYSNGHNSVPAIH
FT                   ISLAFLWGLTCHHPFMESLEARVPWRAITRFLNSLITPNDDFPKIEDASFPAADDGAAL
FT                   QLPEDFLIRGQTWSQLYYPKGFFNGSGDSISIEVDSEVKIRRYRCLWLGVQLAMTVIAT
FT                   TKHPEAEIKAN"
     atgggttcac gctcgctgtc ttccgaattt caagaatgtg agagaaagtg ccagtggctt        60
     gagcaaagcc gagccccatc cacagtacac ctgcctagtg accgatggtg gggccttatc       120
     accctacact tgaatttgct tcacgagcat gaacaattct tcgtcatgtg ccagcatcca       180
     tccgtcagcc tggatgtcaa gaatgttcct gaaaaatatg agatgtctga tcggtctttg       240
     aagtacatgc tctgcttcat cgaaacggtc tcttcgattc tgaaacggtt gattctgtcg       300
     aattcagagc ttggggactc gttgttcgaa caactgggcg atgtggctcg atatggtatg       360
     tttgcggaga agttgaatag ggaatattgg aacgttatat cgcggtgttg gtaccaaaag       420
     gctgcggacc gaaatcccga tagcggacga atccaacatc atcttgggga cttgtcacaa       480
     cctgatccgc ttcagacact ctttttcctt actaaagctc tcatcagtgc gcagccattt       540
     ccaggcagcc gggtgaccgt tggccgtttc ttcaatgact ggcccaattt ggcacttcaa       600
     gaaaattcca tggccaccta ctttatcgcc gcacattacg tgctacttcg tggcgactcc       660
     actgggcggt ttatgacttt tataaatgga ttcttgtcgc tcttaccatc gtacatggaa       720
     caccatggtc accaaggaca acacacagtg tacgtcatgt cctgcaattt cgcctctgta       780
     ttcggttacc acaatcctgc attcatggct gtgggatctt cccaaagcca gagtggacat       840
     actccccaga caaatgaatt gggtccagcc aaccagaagc aagcatgtgt aagcaattgt       900
     tcgatcaacc aacctgcata tccaactaaa caagccctac agggagtcca tcttactttt       960
     cggacactct cggtccttct tcagtatagt aacggtcaca actcagtccc agcaatccat      1020
     atctctctag cctttctctg gggcctcacc tgtcatcacc ctttcatgga gagtttggag      1080
     gcgagggttc cttggagagc aatcactaga ttcctcaata gtctgatcac acccaacgat      1140
     gattttccga agatcgaaga cgcgtcgttc ccagctgcag acgatggagc agctctacag      1200
     cttccagaag atttcttgat acggggccaa acttggagtc aattatatta cccaaagggg      1260
     tttttcaatg gatcaggcga cagtatttcg attgaagtgg acagtgaggt gaagataaga      1320
     agatacaggt gcctctggct aggtgtgcaa ttagcaatga cagtcatagc tactacaaag      1380
     caccctgaag ctgagataaa ggcaaactaa                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page