(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE74

PENCW_10.PE74        Location/Qualifiers
FT   CDS_pept        join(complement(184521..184918),complement(184001..184451))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076564" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948709"
FT                   /orf_name="Pc13g00740"
FT                   /product="Putative uncharacterized protein Pc13g00740 "
FT                   /protein_id="CAP91143.1"
FT                   /db_xref="UniParc:UPI0001830F6C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H155"
FT                   /transl_table=1
FT                   /translation="MSTRDLFSFEHMSYTSSPQYPSGSPVGMVDSFETGSENNVVDGGP
FT                   PPAPVALSTYSTPPLPPKYRTIKPRFSDGGLMPKPPDDTLGVKPRRHRSSGTRRNRQRQ
FT                   PQEKIGEPNPVQPEADSSMVSFTRPRSESFVPVTQYTDSDLFSRSQGPSLAPFLFSYSN
FT                   DLTSPAEIRSPLFPNIASAALAVDRPAYHHDVPSSLDSSDIQVSRPNPFFELSQDRDSM
FT                   RAASLQFSEHLEKTQVLQSLSILQDYMAKYPSVFEKQAPEMVQKWMLDIEGVKPPGSLS
FT                   E"
     atgagcactc gagatctgtt ctcttttgag catatgagtt acaccagctc gccgcaatat        60
     ccttcggggt ctcctgtggg aatggtcgac agttttgaga ctggatctga aaacaacgtc       120
     gtcgacggag gacctcctcc agcaccagtt gcgctctcta cgtattccac acctccgctt       180
     cctcccaaat accgcacgat caagcctcga ttcagtgatg gcggcttaat gcccaaaccc       240
     cccgatgaca cgttgggagt taagcctcgg agacatcgaa gcagtggaac gcgccggaat       300
     cgccaacggc agccacaaga gaaaattgga gagcctaatc cagtccaacc cgaggcggat       360
     tccagcatgg tctcttttac tagacccagg agcgagagtt tcgtacccgt cacccaatat       420
     acggattccg acctgttctc gaggagtcaa ggaccttctc tcgcaccttt tttattctca       480
     tattcgaacg atcttacaag cccggcggaa attcgatcgc ctttattccc taatattgct       540
     tccgcagctc ttgccgtcga ccgtccagcc tatcaccatg atgtgcccag ctcccttgat       600
     tcgtcggaca ttcaggtttc aaggccgaat cccttctttg agctaagcca ggatcgagat       660
     tctatgagag cagcttctct tcaattctcg gagcatcttg aaaagaccca agttctgcaa       720
     tcgttgagca ttttacagga ttatatggcg aagtatcctt cggtctttga aaaacaagcc       780
     cctgagatgg tccagaaatg gatgttggac attgaaggcg ttaaaccacc agggtctttg       840
     tccgaatga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page