(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE75

PENCW_10.PE75        Location/Qualifiers
FT   CDS_pept        join(185578..185720,185803..185849,185902..186137)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948710"
FT                   /orf_name="Pc13g00750"
FT                   /product="Putative uncharacterized protein Pc13g00750 "
FT                   /protein_id="CAP91144.1"
FT                   /db_xref="UniParc:UPI0001830F6D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H156"
FT                   /transl_table=1
FT                   /translation="MTINGMIPSYLELFPKDSCCTFLLINIQGPFQVNPMPISTSRGIL
FT                   RASTKPHLLSGSDELRHLDIIGCREKRKAVDRKPQTTYTFKNCTFSGTSMFLVGSAGPT
FT                   SETVVYRDYGSRRPFLVNGDKGEATFLRDFCGRREYG"
     atgaccatta acggtatgat accctcgtac ttagaactgt ttcctaaaga ctcctgttgc        60
     acttttttgc taatcaatat acaaggccca ttccaggtca accctatgcc aatttcgaca       120
     tcaagaggaa ttttgcgagc cagcacgaaa ccccatctgc tttccggttc cgacgaattg       180
     agacacctag acatcatcgg ctgtcgcgaa aagagaaagg ctgtcgatcg caagccccag       240
     acgacgtata ccttcaaaaa ctgcacattt agcggtacaa gcatgtttct cgtcggaagt       300
     gcaggtccta cgagcgaaac cgtggtctac cgtgattacg gaagccgtcg accatttttg       360
     gtcaatggtg ataagggtga agctacgttc ttgcgagatt tctgtggaag gagagagtat       420
     ggttaa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page