(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE77

PENCW_10.PE77        Location/Qualifiers
FT   CDS_pept        join(188099..188101,188165..188704)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948712"
FT                   /orf_name="Pc13g00770"
FT                   /product="Pc13g00770 protein"
FT                   /protein_id="CAP91146.1"
FT                   /db_xref="UniParc:UPI0001831036"
FT                   /db_xref="UniProtKB/TrEMBL:B6H158"
FT                   /transl_table=1
FT                   /translation="MISEADLKISAQTSLKALQIWSLGTPDLANAXKWQHDLDPEIASL
FT                   VVACQHLRKNGYRKGRRRLAQNSILNRLVQAMVEDLTDDSLKIFALLTWHFNADFSVPL
FT                   PRQLLLFFDEPSKIFEDVCTDIHRRYTTMAKPGSVKSFKRRFIRLLGLVEHYVFEGKWS
FT                   CIFKSSDYVIIVAAICQ"
     atgatttccg aagccgacct caagatatca gcccaaacat cattaaaagc gttgcaaatc        60
     tggtcgctgg gtaccccgga cctggcaaat gcanttaaat ggcaacacga tctcgatcct       120
     gagattgcat cgctagtggt agcctgccag catctcagga agaatggata caggaaggga       180
     cggagacgtt tagcccagaa cagcattttg aatcggcttg tgcaagccat ggtggaagac       240
     ctcaccgacg actctctgaa aatattcgca cttctcacct ggcatttcaa cgcagatttt       300
     agtgtgcctc ttccccgtca gcttcttcta ttcttcgacg agccttcgaa aatcttcgaa       360
     gatgtttgca ctgatatcca tcgccgatac acgacaatgg ccaaaccggg gtctgtaaag       420
     agcttcaaga gaaggtttat caggctacta gggcttgtgg aacattatgt gtttgagggg       480
     aaatggtctt gtatatttaa atcgtcggat tatgttatca tcgttgcagc aatctgtcaa       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page