(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE78

PENCW_10.PE78        Location/Qualifiers
FT   CDS_pept        join(190282..190458,190506..191009)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977827"
FT                   /orf_name="Pc13g00780"
FT                   /product="Putative uncharacterized protein Pc13g00780 "
FT                   /protein_id="CAP91147.1"
FT                   /db_xref="UniParc:UPI0001831037"
FT                   /db_xref="UniProtKB/TrEMBL:B6H159"
FT                   /transl_table=1
FT                   /translation="MSHPGNNLSLFVRNLDQGTREHLGHNTNTGPAHLTPEPCSSIPTE
FT                   SQAPAIMSLVEDFYFPFPRTSFRAAETTLIVQQAWFLGSKYLKRAIKRQHKLNDRTTFL
FT                   ISSCQALRKYRYLPWGKRRALAKNRRLRNYAHRMAGELADCDLAMLSLLAWHFSSKMVP
FT                   LPQGLLQFFANFDEQFDTVCRSIHLSYTKMCEPDTLANFKERLRGLLRLXERHVIIGDG
FT                   VLYT"
     atgtcgcatc caggaaataa cctctcctta ttcgtccgga atctggatca agggacccgg        60
     gagcatctcg ggcataacac aaatactgga ccagcccatc ttacaccgga accatgctcc       120
     agtattccaa cagaatccca ggcacctgct atcatgtcgc tagttgaaga cttctatttt       180
     cctttcccaa gaaccagttt ccgagccgcc gaaacgactt taattgttca acaagcgtgg       240
     tttctgggct cgaaatacct caagcgcgca atcaaacgac agcacaagct caatgacagg       300
     accacattct tgatatcctc ctgccaggca ctcagaaagt atcgctactt gccctgggga       360
     aaacgcagag ccttggccaa gaacagacgg ctgaggaact atgcccaccg tatggcaggt       420
     gaactcgctg attgtgattt ggctatgctt tctcttctcg cctggcattt tagctcgaaa       480
     atggtgcctc taccccaggg gctccttcaa ttcttcgcca actttgacga gcaatttgac       540
     acagtgtgcc gatccatcca cctcagctac acgaaaatgt gtgaaccgga cacgttggca       600
     aacttcaagg aaagattgag gggactatta cggctantag aacgacacgt gatcataggc       660
     gacggggtct tgtataccta g                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page