(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE79

PENCW_10.PE79        Location/Qualifiers
FT   CDS_pept        join(complement(192437..192469),complement(192100..192387))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076566" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948713"
FT                   /orf_name="Pc13g00790"
FT                   /product="Putative uncharacterized protein Pc13g00790 "
FT                   /protein_id="CAP91148.1"
FT                   /db_xref="UniParc:UPI0001831038"
FT                   /db_xref="UniProtKB/TrEMBL:B6H160"
FT                   /transl_table=1
FT                   /translation="MISAEELDELAKQQSSSNFNVGNLRIRILGQLVDSRSTNVYHMQR
FT                   EIRKTEEIPGTKDIMQELWFEHYWASQTELIKSSIGRDLLQDDASKGVSEPLPEDHAFD
FT                   YS"
     atgatttctg cagaagaact tgacgagctt gcaaaacaac agtctagttc gaacttcaat        60
     gtcggtaatc tgcgcatacg catacttgga caactggtag atagcagaag taccaatgtt       120
     taccatatgc agcgcgaaat caggaaaacg gaggagatcc cgggcacaaa ggatattatg       180
     caggagttgt ggtttgagca ctactgggcc tcgcagacag agctgattaa atcttcgatt       240
     ggacgtgatc tcctgcaaga cgatgcctcc aaaggagtta gcgagccctt gcctgaagat       300
     cacgctttcg attattcctg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page