(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE80

PENCW_10.PE80        Location/Qualifiers
FT   CDS_pept        join(complement(195666..195726),complement(195482..195616),
FT                   complement(194220..195308),complement(193886..194151))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948714"
FT                   /orf_name="Pc13g00800"
FT                   /product="Pc13g00800 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAP91149.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniParc:UPI0001831039"
FT                   /db_xref="UniProtKB/TrEMBL:B6H161"
FT                   /transl_table=1
FT                   /translation="MWARLPTLVPLGICSGCRPLDAAVSTSESEESSRTCWSDDGAQPE
FT                   AARAGTRRPLVTGDPAGDDEVWSQHRQQFQDINQAIRREPRFILRVHRVHRVHRVHRVH
FT                   RVHRVHRVHRVHSVHSVHRVHRVHRVHRVHRVHRVHRVHRVHRVHRVHSVHKLIAANMN
FT                   KFAPIYQKHKDIGAEQTIPEADISLFEERLVIVCTVDETQNHRRVRIPNRVKLIRSRER
FT                   KAQRLYLKILEKFPGIFLAFILSVSPRASIDFDLSAFCEQHIEQPIVLCDNAESLLWRS
FT                   AIRHGIEKSKAFGKLMSLLFTLPRPATEAEGEEICSLSLSRLSVIRIAFGDIICEAVEC
FT                   SPTHLPMNADSDYAEITQCVRTTVFYSHQDTIIHIEVGCAVKLADMLFPSASGRINSAL
FT                   SQSNASIQARNPEAALPPGTQSESLVQDYDFAYFTLRGASVAGIRSVFSASICEAIEES
FT                   ELRRWEKHHLLTEVTDCITMQLWRAESQRGLIKLRVGHYTGVNLANNLYAEPRSCIAS"
     atgtgggcga gattgcccac tttggttccc ttggggattt gttcggggtg cagaccgttg        60
     gatgcggcgg tgtctacttc agaatcagaa gaatcctctc ggacatgctg gtcggatgat       120
     ggcgcgcagc cagaggccgc tcgtgcgggc actcgacgac ctttggtgac aggagacccc       180
     gcaggagacg atgaagtttg gtctcagcac aggcagcaat ttcaggacat aaatcaagcg       240
     atacgccgag aaccacgttt catcctccgt gtccatcgtg tccatcgtgt ccatcgtgtc       300
     catcgtgtcc atcgtgtcca tcgtgtccat cgtgtccatc gtgtccacag tgtccacagt       360
     gtccatcgtg tccatcgtgt ccatcgtgtc catcgtgtcc atcgtgtcca tcgtgtccat       420
     cgtgtccatc gtgtccatcg tgtccatcgt gtccacagtg tccacaaact catcgcggca       480
     aatatgaaca aattcgctcc aatataccaa aaacacaaag atattggtgc agaacaaacc       540
     attcccgaag ctgacatctc actatttgaa gaacgtttgg tcatagtttg cacagtcgac       600
     gagacacaaa accacaggcg tgtgagaata ccaaaccgtg tgaaactcat ccgatctcga       660
     gagcggaagg ctcaaaggct ttatctgaaa attctcgaga agttccctgg catttttctc       720
     gctttcatcc tctcagtctc cccgagagcc tctatagatt ttgacctttc ggccttttgt       780
     gagcaacaca ttgaacaacc tattgttctc tgcgacaatg ctgaatcgct tctttggcga       840
     agtgccatca gacacggtat tgagaagtct aaagctttcg gaaagttgat gagtctactt       900
     ttcaccttgc ctcgcccagc gacagaagcc gaaggggaag aaatttgttc gttatctctg       960
     agccgtcttt ctgtgatccg gatcgctttt ggtgatataa tatgtgaggc tgttgaatgt      1020
     tctcccactc atcttccaat gaatgcggac agcgattatg cagaaataac acagtgtgtc      1080
     aggacgacag tattctatag ccaccaggac accatcatcc atattgaggt gggctgcgcg      1140
     gtcaagctcg ctgacatgct cttcccttcc gcaagcggaa gaatcaattc tgctctctcc      1200
     cagtccaatg ccagcattca ggcgcggaac ccagaggctg ccttgccccc agggacgcaa      1260
     tcagagtcac tggttcaaga ttacgatttc gcatacttca cgttgcgtgg tgcgtctgtt      1320
     gctggtataa gatcggtgtt cagtgcctcc atctgtgaag ctatagagga gagtgaattg      1380
     agaagatggg aaaagcacca tctgcttact gaagttacag actgtatcac gatgcagcta      1440
     tggagagcag aatcacaacg tggtctcatt aaattgcgag ttggacacta tacaggagtc      1500
     aatttggcaa acaaccttta tgcagaaccc cgttcatgca tcgcttcttg a               1551
//

If you have problems or comments...

PBIL Back to PBIL home page