(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE81

PENCW_10.PE81        Location/Qualifiers
FT   CDS_pept        join(196199..196377,196430..196543,196731..197117,
FT                   197178..197536,197631..197675,198036..198874)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948715"
FT                   /orf_name="Pc13g00810"
FT                   /product="Pc13g00810 protein"
FT                   /protein_id="CAP91150.1"
FT                   /db_xref="InterPro:IPR021842"
FT                   /db_xref="UniParc:UPI000183103A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H154"
FT                   /transl_table=1
FT                   /translation="MAPPPWPPAQPGEHQFWTDPILCEETRARLEHFRSLGWLPPNFKP
FT                   KTLEGLAVVERYWRKYCIQLNEDYVEYLLLEDQAIYMNFFDWMSKTSRKKLLQRTKNKN
FT                   TLDVDVFCVTYRHHWVYSKHFRHGSMIIQFATIQLWSAITGTRPGVLLPQKASLAGMPL
FT                   GKRKGDKAFQSDLPKYVSTDDLPASVCYRDIELFYLKDPDSKRDVLCAIIEFRNLKGRP
FT                   EGADGTKYFMHGDYQLAYCPINQIVSLAFRDGAFLNTALTPELIWRLRVPKRSQSLPLR
FT                   WKPEKLDTPLLRRLERTTYGYELHKSLSMTYDSSRQALQELGRDARFEDDIGHYNYRRW
FT                   TANEVNRNFTSQERQRVLGQSARKEYFHTAPVLEVDRQIKQLLGQSDVDQSDAGSSEDE
FT                   DWELPAPDYVFPERVRLVENFYGPEAENFDEERLLARRIQVTKDMVALSQLCEPNRRGN
FT                   RINWDVEDDEIEKSEEPLPAEEESLECPTDICIICCGQSRLSSSNPPPHKFPAKRQDSV
FT                   RRHLIDSHLAHAHDGISCTWPACHGIAKFTKVTEFLAHAVTVHAYDINIKLHHLPIKPC
FT                   LTCSDTSSVDSTVESVESGGRSGTDTPASSVGPEMANIDPRLLEPDKPQVTDPLLRRSK
FT                   RLRLR"
     atggcacctc ctccttggcc ccccgctcaa cccggcgaac accaattctg gaccgatcca        60
     attctctgcg aggagactcg tgctagactg gaacatttcc gcagccttgg atggctcccc       120
     ccaaacttca agcccaagac cctggaaggt cttgctgttg tcgaacgata ttggcggaag       180
     tattgcatcc aattaaacga ggactacgtc gagtacctgc tcttggagga tcaagccatc       240
     tatatgaact tcttcgattg gatgtccaag acttcgcgga agaagctcct tcaacgaaca       300
     aagaacaaga atacactgga cgtggatgtc ttctgtgtca cctaccgcca tcattgggta       360
     tattcgaagc atttccgcca cgggagtatg atcattcaat ttgccacgat ccagctctgg       420
     tccgccatta ccggaactcg accaggcgtg cttctcccgc agaaagcgtc tctagcaggc       480
     atgccgctgg gcaaacgcaa aggagacaag gctttccaga gcgacctccc taaatatgta       540
     tcgacagatg accttccagc atcagtctgc taccgcgata tcgagctctt ttatctcaag       600
     gacccagata gtaagcgcga tgttctgtgt gccatcatcg agttccgcaa tctcaaaggt       660
     cggccagaag gcgctgatgg aacaaaatac ttcatgcacg gcgattacca actagcatac       720
     tgcccaatca accagatcgt ctcattagcc ttccgcgatg gggcttttct caatacggca       780
     ctaaccccag agctcatctg gcgcctccgg gttccaaagc gcagtcaatc tcttcccctc       840
     cgatggaagc cggagaagct ggacactccc cttcttcggc gtcttgagcg cacgacatat       900
     ggctacgaac ttcataagtc tttatcaatg acatacgatt ccagtcgaca agcactccaa       960
     gagctgggcc gggatgcaag gttcgaggat gatattggcc attataacta ccgtaggtgg      1020
     actgcaaatg aagttaaccg gaactttacc agccaggagc ggcagagggt tctaggccaa      1080
     tccgctcgaa aggaatattt ccacaccgca cctgtgcttg aagtcgacag gcagattaag      1140
     caactgctcg gccagtctga cgttgaccaa tctgatgccg gcagctccga ggacgaggat      1200
     tgggagctcc cagccccgga ttacgtgttt cccgagcggg tgcgactcgt ggagaatttc      1260
     tacgggccag aagcagagaa ctttgacgag gaaaggctac ttgcacggcg tattcaggtt      1320
     accaaggaca tggtcgccct ctcgcagctt tgcgagccaa accggcgagg caaccgaatc      1380
     aactgggatg tcgaggacga tgaaattgag aagtcggaag aacccttgcc tgctgaagag      1440
     gaatcattgg aatgtcctac ggatatttgc attatctgtt gcggtcaatc tcgactttca      1500
     tcgtctaatc ctcctccaca caaattcccc gccaagcggc aagattcagt ccgtcgtcat      1560
     ctcattgatt ctcatctcgc ccatgcgcat gacggaatta gctgcacgtg gccagcgtgc      1620
     catggcatcg ctaagttcac taaagtcact gaatttttag cgcatgctgt gactgtgcat      1680
     gcgtatgaca tcaacattaa gctgcatcat ctcccaataa aaccatgcct tacttgcagc      1740
     gatacttcat ccgtggacag tacagtggaa tctgtagaat ctggtggtcg ttcgggcact      1800
     gatactcccg cttcttccgt gggtcccgag atggcgaaca tcgacccgcg cttgttggag      1860
     cccgacaaac cccaagttac agaccctcta ctgcgtcgct caaagagatt gcggcttcga      1920
     tga                                                                    1923
//

If you have problems or comments...

PBIL Back to PBIL home page