(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE84

PENCW_10.PE84        Location/Qualifiers
FT   CDS_pept        join(203152..203246,203302..203626)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076568" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824599"
FT                   /orf_name="Pc13g00840"
FT                   /product="Pc13g00840 protein"
FT                   /biological_process="fruiting body development "
FT                   /biological_process="hemolysis by symbiont of host
FT                   erythrocytes"
FT                   /protein_id="CAP91153.1"
FT                   /db_xref="GO:0019836"
FT                   /db_xref="GO:0030582"
FT                   /db_xref="InterPro:IPR009413"
FT                   /db_xref="UniParc:UPI000183103D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H164"
FT                   /transl_table=1
FT                   /translation="MDDHITQRLSIIIKNNLHQSGAIAVRNTLVTRGAPYNRCRKPTLM
FT                   APEDVNKLVICHGEEGTASFCGSAVYGLGVEGSLDLYHGDARIASLHWNGPWARTGNQF
FT                   EATNVNSAKYLVNISGIPSHGILGDVSVIVTEVAC"
     atggatgacc atatcacaca acgtctatcg atcattatca aaaataatct acaccaaagc        60
     ggtgctatcg cggttagaaa cactttagta acacgtggtg caccgtacaa cagatgccgg       120
     aagccaaccc tgatggcgcc tgaagatgtg aataagttag tgatatgtca tggcgaggaa       180
     gggacggcat cattctgtgg aagtgcagtc tacggcttgg gagtcgaggg cagcttggat       240
     ttataccatg gagacgctcg aatagcatca ctgcactgga atggtccctg ggcccggact       300
     ggaaatcagt ttgaggcgac aaacgttaac agtgcaaagt atctagtcaa tatttctggt       360
     atccctagcc acgggattct aggagacgtc tccgttattg taacagaggt tgcttgttag       420
//

If you have problems or comments...

PBIL Back to PBIL home page