(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE85

PENCW_10.PE85        Location/Qualifiers
FT   CDS_pept        complement(204013..207624)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000198689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824600"
FT                   /orf_name="Pc13g00850"
FT                   /product="Pc13g00850 protein"
FT                   /function="ATP binding"
FT                   /function="copper-exporting ATPase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91154.1"
FT                   /db_xref="GO:0004008"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000183103E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H165"
FT                   /transl_table=1
FT                   /translation="MASTEQRLLSESRFSTILVNNLHCPSCVSTVNDTLFSLNPPPFSV
FT                   SVSIVLHEIKVAHPIDLSTSQIVHALEDAAFDIDSVVESGDSTNGGPESESLRTWRSTR
FT                   PSVVWRASDPDPHHESEQHIRQCDACSAQLATQSSRTGDDPPVIQKNLSPLVVESDSPR
FT                   DNDLVSVVDDHLTGTRTRITLSISGMSCSSCVGKITNALNDQPWVQSADVNLLTSSAVI
FT                   VLLDRSRVNEVLETITGSGYSAQLIDCEDLLPERQSKPSASTDIWRASYVIGGMTCSSC
FT                   VGTVTDTLNRYEWVTKVDVNLVSGSATVELQGKEHLEEVIAIISELGYAAALGEAERSA
FT                   PSEQRALNRSVTIQVEGMHCPNCPQRILDALSVFSNCLQVTDPLRKGRPRLTIAYTPDS
FT                   PNFTIRHILHAIAQADKAFTVSIYHPPSLEERSQMMQRRHMWRIARRLLLAVLTAIPAF
FT                   IIGIVYMSLVPGDNSGVMYLEQPIWAGRVSRMEWALFIMATPVYFFAADLFHRRMLSEL
FT                   VVLWWPGSKTPILRRFYRFGSMDMLMSLGTTVAYFSSIAILGINATQPADGLRVTHVES
FT                   FFDSVVFLTMFLMIGRLLEAYSKAKAGDAVSLLGKLRPTTAVLVASKEAEPSSPSVTPH
FT                   TVPIDQLELNDVVSVANGASPPYDGIVVEGTSRFDESSLTGESKPVPKSIGDEVFSGTT
FT                   NRANPVLVRITHLSGDSMLDQIISAVREGQVRRAPIERTADLITGYFVPLITLIAVLDW
FT                   IIWLSLGVSGRLPLSWLEGGAGGWEFWSLQFAISVFVVACPCGIGLAGPTALFVGGGLA
FT                   AQYGILVKGGGEAFQEASQLDCIVFDKTGTITEGVQPSVTDHKTTHEENIDEVWGAVLT
FT                   LEQKSSHPIAQAMVSFAGSRRPPALTASAVDEIPGKGMKGSFPLGHRPSSILDVIVGNE
FT                   ALMLDHGITILSANAAILTAWKREAKSVVLVGTRVREGAGDIEKVHWVLSMMLAVADPV
FT                   RPEAKEVLHALRNRGISVWMISGDNPTTAHAVGKIVGISPENIIAGILPEQKAEKIRYL
FT                   QKTVPRPSKRRWFNWGKGSRRTRPLVAMVGDGINDSPALTVADVGIAIGSGSEIAISSA
FT                   EFVLISSGLTSLLTLIDLSRIVFNRVKYNFGWALVYNCIAIPVAAGVFYPIVSNGNHIR
FT                   LDPVWASLAMALSSVSVVCSSLLMRTRLPLVGFRSAK"
     atggcttcta ctgagcagcg tttgctatct gaatcaaggt ttagcaccat cttggtgaac        60
     aacctccatt gtccctcatg tgtttctaca gtgaatgata ccctattttc tctcaatcca       120
     ccccctttct ccgtgtcagt atccatagtc ctgcacgaga tcaaggttgc gcatcccatt       180
     gatctgagta cctcacaaat cgtacatgcc ctagaagatg ccgccttcga tattgacagc       240
     gttgtcgaat ctggtgattc cacaaacggt ggtcctgaga gcgagagtct tcgaacgtgg       300
     cgctcaaccc gtccatcagt cgtctggcgc gcctctgacc cggatcctca tcatgagtca       360
     gaacagcata tccggcaatg tgatgcatgt tctgcacaac tagcgacgca atcatccagg       420
     actggtgacg atccgccagt tattcaaaag aacctcagcc ccctggtcgt cgagtcggac       480
     agccccagag ataatgacct cgtatctgtc gtcgacgacc atctgacggg aacccgcact       540
     cgcatcacat tatcaattag tggaatgtct tgcagttcat gcgtcgggaa gattaccaat       600
     gctttgaacg accaaccatg ggtgcagtcg gccgacgtta atctactgac tagtagcgcg       660
     gtgatcgttc tcctggaccg gtcgcgtgtg aacgaagtgc tagagacaat tacaggctcg       720
     ggctattccg cccagctgat tgattgtgaa gatctcctgc ccgagagaca atcgaaacca       780
     tcagcgtcga ccgacatatg gcgagcctcc tatgttatcg ggggcatgac ctgcagctcc       840
     tgcgttggga cagttacaga cacgctcaac cgttacgaat gggtcacaaa agtggacgtg       900
     aatcttgtgt cagggagtgc gacggtagaa ctgcaaggga aggagcatct ggaagaggtc       960
     atcgccatta tcagcgaatt gggttacgcc gctgcactcg gcgaggccga gaggagcgcc      1020
     ccatccgaac aacgagcctt gaaccggtcc gtcactatcc aggtggaggg gatgcattgc      1080
     ccaaactgcc cccagcggat tctagatgct ctgagcgtgt tttctaattg tctccaggtg      1140
     acggaccctc ttcgaaaagg acgtccacgg ctcactatag cgtatacccc ggacagcccc      1200
     aatttcacca ttcggcatat cttacatgcg atcgcccagg cggataaggc tttcacagta      1260
     tctatttacc atccccccag tctcgaggag cgctcccaaa tgatgcaacg tcgacacatg      1320
     tggcgcatcg cccgccgcct gctattggca gtgttgactg ctatcccagc gtttattatc      1380
     gggatcgtct atatgtcttt ggtacctgga gacaattcag gggtcatgta cctcgagcag      1440
     cctatatggg ccggtcgagt ctcacgcatg gaatgggcgc tgtttattat ggcgaccccg      1500
     gtgtacttct tcgctgcgga tctgtttcac cgccggatgc tcagtgagct tgtggtactg      1560
     tggtggccag gcagcaagac cccaatcctc cgccgattct accgctttgg cagcatggat      1620
     atgctgatgt ctctgggtac tactgttgcg tacttttcct ccatcgctat tttgggtatc      1680
     aatgccactc agcccgccga cggcctcaga gtcacccatg ttgagtcatt cttcgattct      1740
     gttgtttttc taacaatgtt cctcatgatt ggtcggttgc tcgaggctta cagcaaggct      1800
     aaggccggag atgccgtgag cttactaggc aagttgcgtc cgacgacggc ggtcttggtt      1860
     gcgtcaaagg aggcagagcc ctcttcccca tctgttacac cgcacacggt cccgattgat      1920
     cagctggagc tcaatgatgt ggtcagtgtg gccaatggtg cctctccgcc gtacgacggt      1980
     attgttgttg aaggaacatc acggtttgac gagtcgagtt tgacaggcga atcaaagccg      2040
     gtccccaagt ccatcgggga tgaagtcttt tctgggacca ctaaccgagc aaaccccgtt      2100
     cttgtccgca tcacccatct ctccggtgac tcgatgctgg accagatcat cagcgctgtt      2160
     cgcgaaggac aggttcggag agcaccaatc gagcgcacgg cagacttgat cacgggctac      2220
     tttgtcccct taattaccct catcgctgtc ctggactgga ttatttggct gtcattaggt      2280
     gtctctggcc gcttgccgtt gtcctggctg gagggtgggg ccggtggatg ggagttctgg      2340
     tcattgcagt tcgctatttc tgtcttcgtt gttgcttgtc catgtgggat tggactcgct      2400
     ggcccgaccg cactctttgt cggcggcgga cttgctgctc agtatggaat cctagttaaa      2460
     ggaggcggcg aagcttttca agaggctagt cagctggatt gcattgtctt tgacaagaca      2520
     ggcacgatta ccgaaggggt ccagccgtcc gtcaccgacc acaaaacaac ccacgaagaa      2580
     aatattgatg aggtctgggg cgcggtatta acgctcgagc agaaaagcag tcacccgatt      2640
     gctcaggcga tggtgtcctt tgctggctcc aggagacccc cggccctcac agcctccgct      2700
     gttgacgaga tcccagggaa gggtatgaag ggatccttcc ctcttggtca ccggccatcg      2760
     tctatccttg acgttatcgt gggcaacgag gccttaatgc ttgaccacgg gatcaccatc      2820
     ttgtctgcga acgccgccat cctcacagct tggaagcgcg aagctaagtc ggtcgttttg      2880
     gtcggaacta gagtccgaga aggggccgga gatatcgaaa aggtgcattg ggtgctttct      2940
     atgatgctgg ctgtggctga tcctgtacgc ccagaggcca aagaggtcct gcatgctctt      3000
     cgcaacagag gaatttccgt atggatgatt tcgggagaca atccaacgac ggctcatgcg      3060
     gttggtaaaa tagtcggaat atccccggag aatatcatcg ccgggatttt gcctgagcaa      3120
     aaggcagaga agatacgata tctccagaag acagtgccga gaccctctaa gaggagatgg      3180
     ttcaactggg ggaaaggatc aaggcgcacc cgaccacttg ttgctatggt tggcgatgga      3240
     attaatgact cccccgcgct cacagtggcc gacgttggta ttgctatagg gtctggctcc      3300
     gagatcgcaa tctcatcggc agaattcgtc cttatatcct ccggcctgac atcgctcttg      3360
     actcttattg atctcagtcg cattgtgttc aacagagtca agtacaactt cggctgggct      3420
     ctggtataca attgtatcgc tatcccggtg gccgctggtg tcttctatcc catcgtgagc      3480
     aatggtaatc acattcggtt ggaccccgtt tgggctagtt tggcgatggc tttgagtagt      3540
     gtcagcgttg tttgcagcag tctgttgatg aggactcgat tgccattggt cggtttcagg      3600
     tcagctaaat ag                                                          3612
//

If you have problems or comments...

PBIL Back to PBIL home page