(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE86

PENCW_10.PE86        Location/Qualifiers
FT   CDS_pept        join(complement(210496..210685),complement(209609..210462))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948717"
FT                   /orf_name="Pc13g00860"
FT                   /product="Pc13g00860 protein"
FT                   /function="zinc ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91155.1"
FT                   /db_xref="GO:0005385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniParc:UPI000183103F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H166"
FT                   /transl_table=1
FT                   /translation="MDTELLRSLQRDTGDNTDTCEAGNEYDGRLGLRVSSIFVIMAGSM
FT                   IAAVFPVLVKRSSTVGAKSKYFGSGVIIATAFIHLLAPAEEALRDDCLAGPISEYPWVE
FT                   GIILMTIVAMFLVELMIMRHSYFGTSQQSDMVDDGGRCLGGVDNFGGRNQAKRHLPMDD
FT                   NLSREHKDAEVARGNFAFVDDYAAQLIGVFILEFGIIFHSIFIGLTLAVAGSEFTALYI
FT                   VLTFHQTFEGLGLGSRLAMIPWPTSRRWTPYVLGTVYGLTTPIAIAVGLGVRNTYPPSG
FT                   RTTLIVNGVFDAISAGILIYTGLIELIAREFLFNPFMRRTPLRTVWSAFLLLCLGAGLM
FT                   ALLGRWA"
     atggacacgg aactgttacg ctctctccaa cgggatacag gcgacaatac tgatacctgt        60
     gaagccggaa acgagtatga cggtcggctg ggcctccgcg tttcatccat tttcgtcatc       120
     atggctggct cgatgatagc ggcagttttc cctgtgctag tgaaacgttc aagcacagtc       180
     ggcgctaagt ccaaatattt tggctctggt gtcattattg caaccgcttt tattcatttg       240
     cttgctccag cggaagaggc cctaagggat gactgcttgg ctggtccgat ctcggagtat       300
     ccttgggtgg agggcatcat tctcatgacc atcgttgcta tgttcttggt ggaactgatg       360
     attatgcgcc attcatattt cggcacgagt caacagagcg acatggtcga tgacggaggt       420
     cggtgccttg gtggcgttga taattttggt ggtcggaatc aggctaaacg tcacctgccg       480
     atggacgata atttgagccg ggaacacaaa gacgcagagg tagctcgagg caactttgcg       540
     ttcgtggatg actatgcagc ccagcttatt ggggttttta ttttggaatt tgggattatc       600
     ttccattcca tattcatagg cctgacactc gcagttgcgg gttctgaatt caccgcgctc       660
     tatatcgttc tcaccttcca ccagacattc gagggattag gtctgggatc tcgcctcgcg       720
     atgattccat ggccgacttc caggcgctgg acgccttatg ttctgggtac tgtctatggt       780
     ctgactaccc ctattgccat cgcagttggc ttaggagtgc gcaataccta cccacctagt       840
     ggtcggacga cactgatagt caacggtgtt tttgatgcta tctcggcagg cattcttatt       900
     tacactggcc ttatcgaatt aattgcgcgc gagttcctgt tcaacccatt tatgcgtcgg       960
     actcctcttc gcactgtttg gtcggcattt cttctgctct gccttggtgc aggactcatg      1020
     gcactgctcg gcagatgggc ttaa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page