(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE87

PENCW_10.PE87        Location/Qualifiers
FT   CDS_pept        join(<211811..211844,211897..211949,212006..212358,
FT                   212590..212884,212938..213081,213137..213481,
FT                   213538..213707,213768..213957)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076634" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948718"
FT                   /orf_name="Pc13g00870"
FT                   /product="Pc13g00870 protein"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91156.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI0001831040"
FT                   /db_xref="UniProtKB/TrEMBL:B6H167"
FT                   /transl_table=1
FT                   /translation="ELPVGTTIHWHGILQRGTPDMDGVPGVTQYQIPPGGNFTYRFSVK
FT                   DEYGFYWYHSHFRAYYNDAIRGPLMVRPAPSRRRPFEDMAASTVEREQLLQAERDAVSI
FT                   LLNDWTHDLSDTIFSRYFETGAFPSCVDSILANGLGRVECLPSSDTMGESDTMGESMRL
FT                   GPRGCMPPMMFRPGYDINSLPAETCVNTTSQQLVVNANASQGWLALNLVNSGAVSNLKV
FT                   SLDSHSMHVYAADGLYVTPQEVKVLEIALGQRYSVMIELDQSPGNYYLRFATYPNGDMQ
FT                   QVLEGQAIVSYSTTGNDTQDILVDPMSVWMLTNGSATQDANELVESRLAPFEGNRPPTT
FT                   AADVTRFFNINQTDIVTWVVDQYPYAEPTIPIIYGNMSDGWNANTTLHSPTNSTVDIVM
FT                   NVANGSLDTMGHPMHLHGHKFWVLGSGSGSFPYQSVAEAPPSLINLDNPPYRDTANLPP
FT                   SGWLAIRYITDNPGAWILHCHIQWHIVVCQLPFFTLAIGGKTLTVGYTVWNGGGLSRGR
FT                   RSARCPNSAR"
     gagttgccag ttggcactac tatccattgg catgggatac tacagcgtgg aacaccggac        60
     atggatgggg tcccaggagt aacgcagtac caaatacccc ccggagggaa ttttacatac       120
     cgattttccg tgaaagacga gtacgggttt tactggtatc attctcattt ccgcgcatac       180
     tacaatgatg ctatacgggg ccccctcatg gtccggccag caccctctcg tcgccgaccg       240
     tttgaagaca tggctgcaag cacggttgag cgtgaacagc tgctacaggc tgagagagat       300
     gcggtatcta tcctcctgaa cgactggaca cacgatctgt cggacacaat ctttagccgg       360
     tacttcgaaa caggtgcctt ccccagctgc gttgacagta ttctagccaa tggtctgggc       420
     agggtagaat gcctgccaag ctcagacacc atgggcgaat cagacaccat gggcgagtca       480
     atgaggttgg gtcctcgagg ctgcatgcca cctatgatgt tcaggcccgg atacgatatc       540
     aactctctac cagcagagac atgtgtgaac acaacatcac aacagttggt agtcaacgca       600
     aatgcatctc aaggatggct tgccctcaac cttgtgaatt ctggagctgt tagcaacctt       660
     aaggtttcgc ttgacagtca ttcaatgcat gtctatgccg cagacggact ctatgtgacc       720
     ccgcaggagg ttaaggttct tgaaatcgcc ctcggccaac gatactctgt gatgatagag       780
     cttgaccagt ctcctggcaa ctactacctt cgattcgcta catatccaaa cggtgacatg       840
     cagcaggtct tggaaggcca ggcaatagtg tcctatagta ctaccggaaa cgatacacag       900
     gacatcttgg ttgatccgat gtctgtttgg atgttgacta acggatccgc tacacaagat       960
     gccaatgaac tggtagaatc acgcctggca ccgtttgagg gtaatagacc tcccactaca      1020
     gctgccgatg tcacccgatt cttcaatatc aatcagaccg acattgtcac ctgggttgtg      1080
     gaccagtatc cgtatgccga accaacgatt ccaataatct acggtaacat gtcagatgga      1140
     tggaatgcga acaccaccct ccattcaccg acgaattcga cagtcgatat cgtgatgaat      1200
     gtggcaaatg gctcgttgga tacaatgggc catccaatgc accttcatgg ccataaattc      1260
     tgggttctag gttctggcag tggctcattc ccttaccagt cggttgcaga agcgccgccg      1320
     tccctgatta acctcgacaa ccctccgtac agggatacgg cgaatttgcc accatcggga      1380
     tggctagcaa ttcgctatat cactgataac ccgggcgcat ggatacttca ttgccatatc      1440
     cagtggcata ttgtggtctg tcaactcccc ttctttactc tcgccattgg cggaaaaacg      1500
     cttacggttg gttatacagt ctggaatggc ggtggtctta gtcgagggcg aagatcagct      1560
     cgatgcccta attcggcaag gtaa                                             1584
//

If you have problems or comments...

PBIL Back to PBIL home page