(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE88

PENCW_10.PE88        Location/Qualifiers
FT   CDS_pept        join(215509..215645,215698..215854,215915..216125,
FT                   216182..216579,216627..216710,216765..216902)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000031471" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824601"
FT                   /orf_name="Pc13g00880"
FT                   /product="Pc13g00880 protein"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91157.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI0001831041"
FT                   /db_xref="UniProtKB/TrEMBL:B6H195"
FT                   /transl_table=1
FT                   /translation="MLFPVPWGLAVSTFFMLQFTFSAALNGTIRTYYVGAVEEDWDYMP
FT                   TGIDLINGVEIDQSPQAAAVAAHNGQRIGHVYTKAMFREFTDDTFAVQARRPQWLGMLG
FT                   PVIRAEVGDTVEVIFKNMASNNHSMHPHGLRYSKPNEGVAMAGQEFSGNSVPPGETWTY
FT                   TWEVPERAGPGPLDPPSLAWTYHSDVSGAQDIYSGLVGAIIIYRPGELAKHTLDVPAPR
FT                   GSDLTEEVLTLFMIVDENLSFYIDGNTLNRTNIPRGELQVNRLDPGFQESNLKHAINGR
FT                   LFGNLEGLTLTVGRKARWHVQSLGNVQNAHTPHWHGNTLTWAGQRLDVLSVLPAQTRSL
FT                   TMTVDNPGVWVHHCQVLNHRSKGMIVKYHAVDQD"
     atgttatttc cagttccttg ggggcttgct gtcagcacct tcttcatgct gcagtttact        60
     ttctccgccg ccctcaatgg tacaattcga acgtactacg tcggggcagt ggaggaggat       120
     tgggattata tgcctaccgg tatcgacctc atcaatggag tcgagataga ccagtctcca       180
     caagcagcag ccgtagccgc acacaacggt cagcgcattg gacatgtgta caccaaagct       240
     atgtttcggg agttcacaga tgacactttt gctgtgcagg caaggcgacc acagtggcta       300
     ggcatgctcg ggcccgttat tcgggctgag gtcggcgaca cagtcgaagt catcttcaaa       360
     aacatggctt caaacaatca ttctatgcat ccacatggac tccgttacag taagcccaac       420
     gaaggggtag cgatggcagg gcaagaattc agtggcaact cagtcccacc aggtgaaacg       480
     tggacataca catgggaggt cccagaacgc gctggcccgg ggcctttaga tccgccatcc       540
     ttggcctgga catatcactc cgacgtctcc ggtgcacagg atatttatag tggtttggtc       600
     ggagctataa taatctacag gcccggagag cttgccaagc atactctgga cgttccagcg       660
     cccagaggtt cggacctgac tgaggaggtc ctaactctct ttatgatagt ggatgagaat       720
     ctgtcattct acattgatgg gaataccttg aacagaacta atataccgcg gggcgagctt       780
     caggtgaatc gcttggaccc tggctttcaa gaaagcaatt tgaagcatgc gatcaatggt       840
     cgattattcg gaaatcttga aggattaact cttactgttg gtcgaaaggc ccgttggcat       900
     gtgcaatcat tgggaaacgt ccaaaatgcc catacaccgc actggcatgg caacaccctt       960
     acatgggcag ggcagaggct tgatgtttta tctgttttgc cagcacagac aagatcctta      1020
     acaatgactg ttgataaccc aggagtgtgg gtccaccatt gtcaagtgct caatcatcgt      1080
     agtaagggaa tgattgtgaa atatcatgcc gttgaccagg attga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page