(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE9

PENCW_10.PE9         Location/Qualifiers
FT   CDS_pept        complement(23386..23775)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076619" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128673"
FT                   /orf_name="Pc13g00090"
FT                   /product="Putative uncharacterized protein Pc13g00090 "
FT                   /protein_id="CAP91078.1"
FT                   /db_xref="UniParc:UPI0001830CFB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5F8"
FT                   /transl_table=1
FT                   /translation="MTPTTMMNTNFTQPVECYNSRDAVPATMPSNIQYYNQVPLYQTKS
FT                   PNRDMKAVLQSCCSNVVWIYEDPDPCTAVCDSHTAAEAKKTMYCLNAQMVVYGTKTEKG
FT                   SAVARRPMGWLSLMVGGLRLSGMFI"
     atgacaccta ctactatgat gaacactaat ttcacacagc cggtcgagtg ctacaactcg        60
     cgcgacgcgg tgcccgccac catgccctcc aacattcaat attacaatca ggtcccactg       120
     taccagacca aaagtccaaa cagagatatg aaggctgttt tgcagtcttg ttgttcgaat       180
     gtagtatgga tttatgagga tccggatcct tgtacggctg tttgtgattc gcatactgca       240
     gctgaagcga agaagacgat gtactgcttg aatgctcaga tggtcgtata tgggactaaa       300
     actgagaagg gttctgcggt agccaggcgt ccgatgggct ggctgtcttt gatggttggg       360
     ggattgcgtt tgtcggggat gtttatttga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page