(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE91

PENCW_10.PE91        Location/Qualifiers
FT   CDS_pept        join(complement(221746..222025),complement(220889..221697))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948719"
FT                   /orf_name="Pc13g00910"
FT                   /product="Pc13g00910 protein"
FT                   /protein_id="CAP91160.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0001831044"
FT                   /db_xref="UniProtKB/TrEMBL:B6H197"
FT                   /transl_table=1
FT                   /translation="MSAGGIMDGRIPDLQALPTEILHLILTSLESWEIKAFSLVNRRLR
FT                   DVCLPYLFYRVRFNFSEAGLDGLQQLRHSVVRLHVKSLNYTVPELIKPDILSFETFKSE
FT                   MLTPKSYVEEAKELYDCGYPADECPPYMVIYETLRTICENQQEILENHKNIDVLSSVLA
FT                   ALPRLRELELDFCPSIDEPQWVDSYLSLGMTAKEVSNTYHIQAVTKALQRRPECIAPLV
FT                   TIELSSLDLPHYSSWELPKFPSLSGALELLLEHCTTLRITGDSAPLELLSRSTVKLRKL
FT                   ILGHVNISYTAWREFLETNRQTIISIGFYDTHLIRGLAEIQELSPKLLPAVLPGFAFST
FT                   KKSTDYWKMPYWETGWIIQLGS"
     atgagtgctg gtggtataat ggacggacga attccagacc ttcaggccct gcctacggaa        60
     atcctacatc taatcttaac aagtcttgaa tcctgggaaa ttaaggcttt ctcgctcgtg       120
     aataggaggc tgcgagatgt ttgcctacct tacctctttt acagggtgag gttcaacttc       180
     tcagaagctg ggcttgatgg actccaacag ctcagacact cagtagtacg cctgcacgtc       240
     aaatctttga attatacggt tccggagtta atcaaaccgg atattctaag ctttgaaacc       300
     ttcaagtcgg aaatgcttac tccaaaaagc tacgtggagg aagcgaaaga gctatatgat       360
     tgcggctacc ccgcggatga atgccctcca tatatggtta tttatgaaac gctccgaacc       420
     atttgcgaga atcaacaaga aattctggag aaccataaga acatagatgt cttgtcatcc       480
     gttcttgcgg ctttgcctcg actcagggaa ttagaactag atttctgtcc gtcaatcgat       540
     gaaccccaat gggtcgactc atacctttca cttggcatga ccgcgaaaga ggtgtcaaat       600
     acatatcaca tacaggctgt tacaaaggct ctgcaaagga gaccagagtg cattgctccc       660
     ctggtaacaa tagaactgtc ctctctggac cttccgcact actcttcttg ggagctgccg       720
     aagtttccta gcctgtctgg tgcattggaa ctcttgctcg agcattgtac gactttgcga       780
     ataactgggg atagcgcgcc tctagagtta ctgtctcgat ctaccgtgaa gcttcgaaag       840
     ctgattctag ggcacgtaaa tatctcatat acagcgtggc gagagttcct ggaaactaac       900
     cggcaaacga tcatctcgat tggattttat gacacgcacc tgatcagggg tttggccgag       960
     atccaggaac tttcccctaa actgcttccc gctgtgctcc ctggctttgc attctcgaca      1020
     aaaaagtcga cggattactg gaagatgcca tattgggaaa caggttggat aattcagcta      1080
     ggatcctga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page