(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE92

PENCW_10.PE92        Location/Qualifiers
FT   CDS_pept        complement(223238..226462)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948720"
FT                   /orf_name="Pc13g00920"
FT                   /product="Pc13g00920 protein"
FT                   /protein_id="CAP91161.1"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniParc:UPI000183042F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H198"
FT                   /transl_table=1
FT                   /translation="MARIDLHTVDTLQLYAPRASTVDRKTVKGKILSGEAFSDFSRTER
FT                   ATIWKNLRSQAACDGIIPSLHTFFRDINYLELCANAVKRLVVLNKQRPTVRSALVHGFR
FT                   SRRADHGCLIQTSDTTFRRQPGSSDEGLTSGYRQIWMYAMRHYPEMAKDVQGGPKANPT
FT                   RAKARAKADESVIHAMAALAKKLGFRTPPVKTIIRQSPDHQIARAALLKARKPDHYHYD
FT                   SGAFESLIEQIAGCFALAIPNEAAPVAHITSRVIKLKDRCGIPQEQTQQLDSPHIFLDT
FT                   LHSATVLQRNLSSLEVRRSVYYAFFGKSSATTSQSVPLGQSSSNDPLSPLFVPTDVPRL
FT                   QSESAHDHMSRSSFDEGSSNGRRDRSEIPEEQHRRQERQHAVEHGPLLVQEPSIQSSIG
FT                   ETSTISEVMDMYWDSSGAEDQPRPENVEQQPAASRGMDSDSEERECTEIDEEDLLRRAA
FT                   DGGPVLEDAAAVNHLTLGAPRDTDMSSILDEGAGGVDMDEDMNSSAQNQSVQDRLGMPT
FT                   TLSRQSSTTPPASRKKSRDTTWKPYDATQKGNRKATTKPLAAQGQSIAEGGMTNSEPSA
FT                   EQRSGLGPLQPIAEHAEQEITRPVNEPEYPEHISGGPLPAEAQEGIAGEQMVDGTELIA
FT                   EAGEEVHQGDRVARERADALTQLQTSGAREDHAPRPVTELPADLPSLITRLREEGSQLG
FT                   DEGVIPDNIGMQELPELKPATVDNLDGVGGGTAVGVVKPGLSQQETERHRADLPNPEQA
FT                   QRQAIERQEGEDLLFDVPVLEEPTDQAVEEDPGRPTLEVPDPLRPGSMPAGLSSDVPPE
FT                   RRVTVTFYVYERQAWKKMDMVTVSPTQLADAQIIAERYARDPSQYARFYDGRLRKVAVN
FT                   ECIRAAIDDGSFTVLMSFGKDLMVTRHLVASVAEIFKSTGSEWHNPYHPEKRLKANTGA
FT                   PSAGPVQTRKDASSRKTERRGRKITPRIADGPPQDVRPSRARSEADSQPVTIVFRVRDE
FT                   NGRWRVAYEVRVDDRSNPSQVEQLARKEARDRQATFYDKNLRKLTPTQCFEAAIEDDTN
FT                   TIFMNFGGELRMDEDTIRSIAREVEL"
     atggcccgta ttgacctaca tacggtggac acgctgcagc tgtacgcccc tcgggcatcc        60
     acagttgatc ggaagacagt gaaggggaaa atcctcagcg gtgaggcttt ttccgacttc       120
     agtcggaccg aacgtgccac catctggaaa aacctacggt cgcaagcagc gtgtgacggc       180
     atcataccat cccttcacac cttcttccga gatattaact atctggaact ctgcgccaat       240
     gccgtgaaac ggttggttgt tctcaataag caacgcccca cggttcgtag tgcactggtc       300
     cacggttttc gatcccgccg tgccgatcat ggctgtctga tccagacatc tgacactact       360
     ttccgtcgcc aacctggatc cagtgacgag ggtctaacgt ctggatatcg tcaaatctgg       420
     atgtacgcca tgcgacatta cccggagatg gccaaggacg ttcagggcgg cccgaaggct       480
     aaccctacgc gggcaaaggc gcgagcgaag gctgacgaga gcgttatcca tgctatggcc       540
     gcgcttgcca agaagctagg atttcgtact ccaccagtca agaccatcat aagacaatca       600
     cccgaccacc agattgcccg ggctgccctg ctcaaagcac ggaagccgga tcactaccac       660
     tatgacagcg gagccttcga gtctcttatc gagcagattg ctggttgttt tgcgcttgct       720
     atcccgaacg aggccgcgcc agtggcacat atcactagtc gagtaattaa gctaaaggat       780
     cgctgtggaa tacctcagga gcaaacccag caactagaca gcccgcatat cttcttggac       840
     acactacact cggcgacagt gttgcaaaga aacctctcat ccctggaggt gagacgaagc       900
     gtttactacg cctttttcgg caagtcctcc gcaacaacct cccaaagtgt tccactgggg       960
     caatcatcat ccaacgaccc tctttcaccc ttgtttgtcc caaccgatgt gccgagatta      1020
     caatcggaat cggcccacga ccacatgtcg agaagcagct ttgatgaagg gtcatccaat      1080
     ggccggcggg atcggtcgga aattcccgaa gaacaacatc ggaggcaaga aagacaacac      1140
     gcagtagagc acggcccact tctcgtccaa gagccttcca ttcaaagttc aataggagag      1200
     acatctacta tctctgaggt gatggatatg tattgggata gctctggcgc ggaagatcaa      1260
     ccccgaccgg agaatgtcga acaacagcca gcagcaagta gaggaatgga ttctgacagt      1320
     gaggaacgtg aatgtacaga gatcgatgaa gaagacctac ttcgccgagc agcggatggg      1380
     ggccctgtgt tggaggacgc ggctgctgtg aatcatttga ccttaggggc accgcgcgat      1440
     acggatatgt caagtatact ggatgaggga gcaggtgggg tggacatgga cgaggacatg      1500
     aactcatcgg cgcagaacca atcagtgcaa gatcgccttg gaatgccaac tacattatcc      1560
     cgccagtcaa gcactacgcc gccagcctcg cgaaaaaaga gtagggatac aacatggaaa      1620
     ccgtatgatg ctacacagaa aggcaaccgc aaagcgacta caaaaccact tgccgctcaa      1680
     ggccaatcga ttgccgaggg cggcatgaca aactcggagc caagcgctga gcaacggtct      1740
     ggtctgggtc cgttgcaacc gattgcagag cacgcggagc aggaaataac ccgtccagtc      1800
     aacgagccgg agtaccccga acatatttct ggaggaccat taccagctga ggctcaggaa      1860
     ggaatagcag gagagcaaat ggtggatgga actgagctca tcgcggaagc gggtgaagaa      1920
     gtccaccaag gagatcgagt ggctcgggag cgcgcagatg ctcttactca gctacaaaca      1980
     tctggggcca gggaggatca tgccccccgg cctgtgactg agctccccgc tgacttgccg      2040
     agcctgatta caagattacg ggaagaggga agccagctgg gtgatgaagg tgtgattccc      2100
     gacaatattg gaatgcagga acttcctgaa ttgaagccgg ccactgttga taatctggac      2160
     ggtgttgggg gtgggaccgc ggtgggtgtt gttaaaccgg ggctttctca acaggagacc      2220
     gaacgacaca gagcggatct acccaatcca gaacaggctc agcgccaggc aattgaaagg      2280
     caggaggggg aggatctact atttgatgtt cctgtgctgg aagaaccgac agaccaggca      2340
     gtggaagagg atccgggaag accaacccta gaagttcccg atcctcttcg ccccggaagc      2400
     atgcctgcgg gtctttccag tgatgtgcca ccggagcgga gggtcacagt cacattctat      2460
     gtctacgagc gacaggcatg gaaaaagatg gatatggtca ctgtgagccc tactcaactc      2520
     gctgatgcgc agatcatcgc cgaacgatat gctcgagatc ccagccaata tgcgcgcttt      2580
     tacgatggtc gactacgcaa agttgccgtt aatgagtgca ttcgcgccgc aattgacgac      2640
     ggtagtttta ctgtccttat gagttttgga aaggatctaa tggtgactcg gcatcttgtc      2700
     gcgtctgtcg cagagatatt taagtctact gggagcgaat ggcacaatcc ttatcatcct      2760
     gagaaacggt taaaagcaaa caccggagcc ccgtcggctg gtcccgtaca aacgcgaaag      2820
     gatgcaagtt caagaaagac agagcgacgt ggaagaaaaa taacaccacg gatagccgac      2880
     ggaccgccgc aggatgtgcg gcccagtcgg gcacgctcag aggcagattc tcaacctgtt      2940
     actattgtgt tccgggtccg agatgagaac ggacgttgga gggtggctta tgaggtccgc      3000
     gttgatgatc ggtccaaccc gtcgcaggtg gaacaactgg caaggaagga ggcgagagac      3060
     cggcaggcca cattctatga taagaacctg cggaaactta ctccgacaca gtgtttcgag      3120
     gcggcaattg aagatgacac gaatacaatc tttatgaatt tcgggggaga gcttaggatg      3180
     gatgaagaca caataaggtc gatcgcacgc gaagtggaat tgtga                      3225
//

If you have problems or comments...

PBIL Back to PBIL home page