(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE93

PENCW_10.PE93        Location/Qualifiers
FT   CDS_pept        join(complement(226959..227338),complement(226532..226871))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128946"
FT                   /orf_name="Pc13g00930"
FT                   /product="Pc13g00930 protein"
FT                   /protein_id="CAP91162.1"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniParc:UPI0001830430"
FT                   /db_xref="UniProtKB/TrEMBL:B6H199"
FT                   /transl_table=1
FT                   /translation="MDLLTDTERQLTAERLFKYQGTAKIDLDQISLQPLMSREIDQKNV
FT                   ERLHNIFAKDGCQRFDIRNHVTAVVSRRHLERACRGAGLTPEELKTYQREYPHLSFRGH
FT                   QVQCLHGQHRLTAAEETLAPSDRPDLRTALVDEYANEKAPTDGEVYRKIRQYQHESNAL
FT                   FQNRWWCRLSPNKAKRLRQLTSKDNTYLCAAFDALLAIPGLWNGLSLGSLNTVMALKCD
FT                   EVGSTPRSLKAIPDSSS"
     atggacttgt taacggatac cgaacggcaa ctaaccgcag aacgactatt caagtaccaa        60
     ggtactgcca agattgacct tgaccaaatc tctctccagc cattgatgag ccgtgagatt       120
     gaccagaaaa atgtggaacg attacataat atatttgcca aggatggttg ccaaagattc       180
     gacatccgaa atcacgtgac tgctgtcgtt tccaggcggc accttgaaag agcatgccgt       240
     ggcgcaggac tgacccctga agaactcaaa acttatcaac gggaataccc ccacctttct       300
     tttcgtgggc accaagtgca atgcctccat gggcaacata gactcacagc tgctgaggaa       360
     accttagccc catctgaccg cccggattta cggaccgctc tcgtcgatga atatgcgaac       420
     gaaaaagcac caactgatgg ggaggtgtac cggaaaatcc gtcagtatca gcatgagagc       480
     aatgcgctct ttcaaaaccg ttggtggtgc cgactgtcgc cgaataaagc caagcggtta       540
     aggcagctca cttccaaaga taacacgtat ctttgtgcag cgtttgacgc tttacttgca       600
     atccctgggc tctggaatgg gttgagtctt gggtcattga acacagtcat ggcattaaag       660
     tgtgatgaag ttggttccac tcctcgctct ctgaaggcta tccctgactc atcgtcctag       720
//

If you have problems or comments...

PBIL Back to PBIL home page