(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE94

PENCW_10.PE94        Location/Qualifiers
FT   CDS_pept        join(227642..228199,228352..228600,228648..228758)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217227" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977828"
FT                   /orf_name="Pc13g00940"
FT                   /product="Pc13g00940 protein"
FT                   /protein_id="CAP91163.1"
FT                   /db_xref="UniParc:UPI0001830431"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A0"
FT                   /transl_table=1
FT                   /translation="MDDRHLTQLYAESFKAQRPLSPTPTTVSAHKEFQGQSNHKLTKGR
FT                   KQQEKPEKSKNPLFGPAQDVRQSSSQSERQTAQAPVIRRGSPWHILKDLFTCDLAGPVS
FT                   IAVHKKGPSEVIAVRAFSKEKADVWLQVIQQTQHPNVISATEIFKDLGMTYFIVDDLPL
FT                   TLEHLVACDIFPSELQLASILVQVIPIPLFHLLTNMTAGLEHCIGRQPTQSQAQTLRAL
FT                   TNVTMFLMQKYLKPDGVIGIDGTRWRSDPLEFLSATASVATIQELRKHPLLTKHRWSAG
FT                   TLVGLARLCLITTRTFITKPWVQN"
     atggatgacc ggcatctcac acaactttac gccgagtctt tcaaggccca acgaccactt        60
     tctccaacgc ccactacagt atccgcgcac aaggagtttc aaggccaaag taaccataaa       120
     ctaactaagg ggagaaagca acaggagaag ccagaaaaat ctaaaaatcc cctcttcggc       180
     cccgcacaag atgttcgcca gagtagctcc caaagtgagc gccagacagc tcaagcgccc       240
     gttattcgga gagggtcacc ctggcacata ttgaaagatc tttttacctg tgatcttgca       300
     ggccccgtct ctattgcagt ccataaaaag ggcccttccg aggtaatcgc ggtccgtgca       360
     ttctccaagg aaaaggcaga tgtatggctg caggtcatcc agcagaccca acaccccaac       420
     gtcatctctg cgaccgagat cttcaaggac ctcggcatga catacttcat tgttgacgac       480
     ctgcctctga cgttggaaca cctggtcgcc tgtgatatct tcccgtctga gcttcagctg       540
     gcttctatcc ttgtacaggt cattccgatc ccacttttcc acttgctgac aaacatgaca       600
     gccggtttgg agcactgcat cgggcgccag ccaacccaat ctcaggccca gaccctccga       660
     gccttgacta atgtcacgat gtttctcatg cagaagtatc tgaagccaga cggtgtgatt       720
     gggatcgatg gtactcgttg gcggtcggac cccctggagt tcctgtcagc aaccgcatcg       780
     gtcgcgacca tccaagagtt gagaaagcat ccccttctta ccaagcaccg ctggtctgca       840
     ggcacattgg tcgggcttgc ccgtctctgt ctcatcacca cacgcacatt tataacaaaa       900
     ccatgggtgc agaattga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page