(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE97

PENCW_10.PE97        Location/Qualifiers
FT   CDS_pept        233495..233746
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076567" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948723"
FT                   /orf_name="Pc13g00970"
FT                   /product="Pc13g00970 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91166.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI0001830434"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A3"
FT                   /transl_table=1
FT                   /translation="MSKTEQKSSWVKKRRSESSRAKSQQRQRRKSGLFKKAAEFSLECE
FT                   SDVVVAIRIRRTGQTYIFDSSSQEEWLEALPRLVLYPP"
     atgtctaaga cagaacagaa atcttcctgg gtcaagaagc gtcgttcaga gagtagccga        60
     gcaaagtcac aacaacgtca gcgacgtaag agtgggcttt tcaagaaagc ggcagaattc       120
     agcctggagt gtgaatccga cgtggttgtt gcaattcgga tccggagaac tggtcagaca       180
     tatatcttcg attcatcgtc gcaggaggag tggttagagg cacttcctag attggtactg       240
     tacccaccgt ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page