(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE98

PENCW_10.PE98        Location/Qualifiers
FT   CDS_pept        join(234510..234512,234567..234625,234676..234922,
FT                   234975..235034,235086..235138,235188..235386,
FT                   235433..235552,235681..235785)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948724"
FT                   /orf_name="Pc13g00980"
FT                   /product="Pc13g00980 protein"
FT                   /protein_id="CAP91167.1"
FT                   /db_xref="UniParc:UPI0001830435"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A4"
FT                   /transl_table=1
FT                   /translation="MSLRQIYPPFGENPSGQATIDIIAVHGLDFIDMSGRCSVSSWREP
FT                   LDESGEFWPVAFIRAHGLRARLLLYEFDSVMTFGAAPESVSREADGLLHQISTIRPTDH
FT                   PDAPIIFLSHGLGGILVKQALVNASQGDRYCGINNATRGLAFFGTPHQAPSHRSPGVIE
FT                   TVFSLVSPRIPIRSPYSPELPIVQGFRDQVEDYQFISFYGDSDEAVPFSSAVMNLAGNR
FT                   ETQVRLSSNHEDLCRFYQGSDNYRKIANFSDLWTASPANFASTGEYSPDQSVSVLPNRL
FT                   "
     atgtctctac gtcagattta ccctcccttc ggtgagaatc cgagcggcca ggccactata        60
     gatattatcg ctgttcacgg actcgatttt atcgatatga gcggcagatg ctcggtatct       120
     tcttggcgcg agccgttaga tgagtctgga gaattttggc ccgttgcctt tattcgggcg       180
     cacggcttga gagcacggct gctgctgtac gagttcgact cagtcatgac tttcggtgct       240
     gctccagaga gtgtctcgcg agaggcagat ggcttgctac accagattag cactatccga       300
     ccaaccgatc atccggatgc accaatcata tttttgagcc atggcttagg gggtatcctc       360
     gtgaaacagg ccttggtgaa tgcgtctcaa ggcgatcgat attgcggaat caataatgca       420
     acacgaggtc ttgcattctt tgggacacct caccaagcgc catctcatag atcacctggt       480
     gttattgaaa ctgtattctc tttggtttca ccacgtatac cgatacgatc gccgtatagc       540
     ccggagcttc cgatagtcca aggatttcgt gaccaagttg aggattacca atttatttct       600
     ttctatggcg actcggatga ggcggtccca ttttcttctg ctgtcatgaa cctagcaggc       660
     aatagggaga cgcaggtgcg cctgagctca aatcatgaag acctatgccg tttttaccaa       720
     ggctcggata actacagaaa gattgcaaac ttcagcgacc tctggactgc ttccccggca       780
     aattttgcta gcacaggaga atattctcct gaccaatctg tctcggtgct tccgaaccga       840
     ctctaa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page