(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE99

PENCW_10.PE99        Location/Qualifiers
FT   CDS_pept        join(complement(236457..236555),complement(236187..236336),
FT                   complement(236000..236089))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671899"
FT                   /orf_name="Pc13g00990"
FT                   /product="Putative uncharacterized protein Pc13g00990 "
FT                   /protein_id="CAP91168.1"
FT                   /db_xref="UniParc:UPI0001830436"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L2"
FT                   /transl_table=1
FT                   /translation="MAETHLESWQNCSAEALKWGTDFERKPISVNLVCPVGTVYPGNTP
FT                   QYERTRGRKACQVLRGWEDGRTRTREANLFENYKRKANYMHPLNLRRYSRTIMTTWMVL
FT                   SGIEREAE"
     atggctgaga ctcatctcga gagctggcaa aactgtagtg cggaagcgct gaagtggggt        60
     actgattttg agcgtaaacc aattagtgtt aacctagtgt gtcctgtggg tacagtatat       120
     cccgggaaca caccacaata cgagcggaca cgaggtcgaa aagcgtgcca ggtgctgaga       180
     ggctgggaag acggacgtac aaggactaga gaagccaact tgtttgagaa ttataaaagg       240
     aaggccaact atatgcaccc tttgaattta cgcagatact cccgaactat catgacgaca       300
     tggatggtac tctctgggat tgagcgagag gctgaatga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page