(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_11

ID   PENCW_11; SV 1; linear; genomic DNA; GRV; FUN; 551708 BP.
XX
AC   AM920429_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 19)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c14, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920429.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..551708
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        join(complement(1698..1740),complement(869..1650),
FT                   complement(556..819),complement(338..502),
FT                   complement(202..288),complement(95..151))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226278" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127310"
FT                   /orf_name="Pc14g00010"
FT                   /product="Pc14g00010 protein"
FT                   /function="aminopeptidase activity"
FT                   /function="metalloexopeptidase activity"
FT                   /biological_process="cellular process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP74142.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002468"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018349"
FT                   /db_xref="UniParc:UPI0001831D90"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5L5"
FT                   /transl_table=1
FT                   /translation="MGSKTAENESQGGGNAPPSSTKATATGGEPRGAHWSRDGDGTLGE
FT                   GEGDDDADGDNTSCAPAVPLNPQTAPSTNSKKRKKRPKKKTSALKQSSPPRIPLADLFP
FT                   DHQYPHGEAQVYEPGLENVARTTADEVRHHSRHHIEDDTFLNDYRKAAEVHRQVRRWTQ
FT                   ESVRPGQTLTEIAMGIEDGVRALLDNAGLDTGQGLISGLGFPTGLSLNNCVAHYTPNPG
FT                   QREVVLDSSDVMKVDFGVHINGWIVDSAFTMSFDPTYDNLLAAVKDATNTGIKNAGVDV
FT                   RISDVSAAIQEAMESYEVDINGRTFPVKAVRNITGHNIEQYRIHAGKSIPFVKNNDNTK
FT                   MEEGEIFAIETFGTTGRGYLFDGPGVYGYGKDPSAPKRITSHLASAKSLYQKINENFGS
FT                   LVFCRRYLERLGVESYLAGMNNLVSNGYVEVYQPLMDVRGSYSAQFEHTILLRESCKEV
FT                   ISRGDDY"
FT   CDS_pept        join(2220..2384,2589..3028,3091..3282,3334..3472,
FT                   3614..3972,4028..4583,4640..4749,4804..5203)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076621" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823008"
FT                   /orf_name="Pc14g00020"
FT                   /product="Pc14g00020 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP74143.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831D91"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5L6"
FT                   /transl_table=1
FT                   /translation="MYATFKYLPSYATYISMLTFPAFSAIRNSTCMSRHHINRWAETSK
FT                   VPLNVHYTELVKCDETPDECGNCARLRLVCSGYTTPVRSQTTGGEIDLRHSTRVKRTYR
FT                   SCTACRASKTKCSGERPCQRCRWKCSTECVYAESTQPAWVRRVNMTQTGSPDFSLSRPS
FT                   MSEQSFEETPPRQANPPSLMDTPSTPQAFPGSSSSPLDWLTTDYLPSSPRIVMLVEEYF
FT                   NNIHPLRAFAFIHKPSFLQRLDGDVLENHHNHALLHIICALGAQFYALSYSETTAPLEP
FT                   KFVLLAGTQWAKISQRLILDTIDRVTIESLMALQINLEYNTDILCQNTNNGLPVTAKES
FT                   RRRLMWSCYIMDALVGSGVDQLTLMDERDVKIQLPCNERNFTQQVPCLTETLYPGSWLK
FT                   ILPDDLDTKTLSPNMGIMAYFIRHISIRKRVLRYIKHLGDAMVPWDPASEFALLDADCR
FT                   AWYDSLPASLQFTPDAMYIRKETYQLGALCLLHCAHYQTVCDLYRLGAPALYKLRAAFD
FT                   FPPEQADFLQHLQQVLFDAARALATIIGQAALHGPQTLADSWLPTIAYDSCRIMVYHLT
FT                   QILDPRSENAKALALATIPLLHSNINALKSMGSLNAIASTLSSAAETMLDRSGIESEVV
FT                   RQNIIPDDPYQSTEEEDTSTNLRGSPVQSAPDYVLNPLTIFRMARKSIPERHAPERAST
FT                   TSAPNSVLSENRVSPCELAGSSRTDQPELGVDQSSLEELQTLFMSDLGWAWQPADTAVG
FT                   SGTEGAGLLPWAGGYPVAQTQPWLPVFPFPQQG"
FT   CDS_pept        join(complement(6404..6700),complement(6084..6349),
FT                   complement(5373..6036))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182591" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670262"
FT                   /orf_name="Pc14g00030"
FT                   /product="Pc14g00030 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP74144.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI0001831D92"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5L7"
FT                   /transl_table=1
FT                   /translation="MAPGLVEATGSQTLSRPVKLSVFPDGFKTSGQHPPVYSQVRPYAD
FT                   FPKIHTGPTVWKPEDYRERPELWTHRFNADEVAEISHATDQFIQGGGPLTGISKANFPL
FT                   PNLSGRLEALRQDLINGKGFFLFRGLPVQEWDLQKCATAYMGLGTYLGYFVSQNGRGHV
FT                   LGHVKDLGEDPTKTDRVRIYRTNARQYFHTDGADLVGLLCIAKSLSGGESDIASTHHVF
FT                   NVLQERHPDVVRTLCEPNWYFDRKGETSEGEEEWIRGSILYLENDTSSPSPRVYARFDP
FT                   MNVTSLARFNSGPDACIPPLSDRQKHALEVFENTCAELSLHMILAPGDIQFLSNTHVFH
FT                   ARTAYTDHPPGAVDEDGRPARRRHLMRLWLSAPESEGGWKLPYHDTLEKKRGGIQVNDT
FT                   PPVCPLDAE"
FT   CDS_pept        join(complement(8087..8365),complement(7917..8037),
FT                   complement(7510..7866),complement(7275..7456))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000271394" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942262"
FT                   /orf_name="Pc14g00040"
FT                   /product="Pc14g00040 protein"
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP74145.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="UniParc:UPI0001831D93"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5L8"
FT                   /transl_table=1
FT                   /translation="MTFDALSPREVTEAVSGTGAHKGNMRLDKVFFSAVSAGCLLAFAC
FT                   GTTLSTTATPWFQDNAPGLIRTIGALVFPYGLCMILLTSADLCTGSFMFTTLAVLHRRL
FT                   TWSRMLIHWAVTFIGNLAGSLFIVAIIFGYGNAFSAEPFRSAVISFAIKKQVTPDFHMI
FT                   FLRGIGCNWLVCLACFFGIQGRDLASKIIGIWLPTFAFVSLGFDHVVANMTFIPLGIWL
FT                   GAPQITIGFYIWKGIIPALLGNIIGGGVFCGTFYWYMYLVDLNTLPLYGEERTQSNSLK
FT                   SASCSGRAGTKRPDIETSAAGFDDRNRHMKE"
FT   CDS_pept        join(complement(9284..9449),complement(8845..8936),
FT                   complement(8613..8696))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942263"
FT                   /orf_name="Pc14g00050"
FT                   /product="Putative uncharacterized protein Pc14g00050 "
FT                   /protein_id="CAP74146.1"
FT                   /db_xref="UniParc:UPI0001831D94"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Q1"
FT                   /transl_table=1
FT                   /translation="MGACGARDTCGQCLDHYSRTACGIVLMDPHNASATTLTFHDQYLP
FT                   RYSPQNHPIQDLAGHTWKHKGISGSVYRDNEASMYSGYMYGDLEDNPYLAKTPDSDNSF
FT                   PFNSMISTL"
FT   CDS_pept        join(10597..11216,11272..12217)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823009"
FT                   /orf_name="Pc14g00060"
FT                   /product="Pc14g00060 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP74147.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831D95"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Q2"
FT                   /transl_table=1
FT                   /translation="MSKPDVVHNEAADHQKEDKLVDSSGIVRVPLTEEDSKRICRKTDR
FT                   TILVVLVWVYFLQILDKTVLGYGATFGLQEDTGLTGNEYSLVGSIAPIAQLAWQPFSSY
FT                   LIVKVPHKILMPVLCLGWGIAQTCMAACHNFGTLMAARFFLGLFEAGCLPLFGVITSQW
FT                   YRRAEQPIRIAAWYSTNGLATIVAAALSYGLAQIESHVLDSWQIIFLVVGLITVASAPI
FT                   VYWRLDTDISTARFLSEEEKAQGMERLRANQTGTGNTEFKFGHVLEACLEPKTYLWIGM
FT                   AMLLNIGASVTNVFGPLILSGLGYDKYRTTLLTMPFGALQFVIILLASYLAQSARVKGV
FT                   IIAAFMLPVIAGLAILYAVPRTKSVQGQLLAGYYLLAFLFGGNPLIVTWIIGNTAGTTK
FT                   KSVIMSFFNAATSAGNIVGPLLFNEKDKPAYHPGLRACLGIFCTLAAVVFIQWGNLWFL
FT                   NKQQARRRVQNGKRAEIIDLSMQNNYQDTQNNLEETGHETVQIGDNAFQDLTDRENDEF
FT                   VYIY"
FT   CDS_pept        join(complement(13448..13568),complement(13295..13358),
FT                   complement(13075..13179),complement(12731..12812),
FT                   complement(12409..12612))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976232"
FT                   /orf_name="Pc14g00070"
FT                   /product="Putative uncharacterized protein Pc14g00070 "
FT                   /protein_id="CAP74148.1"
FT                   /db_xref="UniParc:UPI0001831D96"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Q3"
FT                   /transl_table=1
FT                   /translation="MCDFADCNEGSIGVYRVSLLNNRDKIFSAKFILQLAATGTAGSDS
FT                   ETCLQVCDMKPDKSWQSPANLKSESRVRVRKSSPCRICMFETPPRESNVRAGASLEGIR
FT                   SSTGNVRLQATYCSLNGQHAGSGWARGGNISHPGRGEIYPIPSRQEMKISPILPCLGNA
FT                   AEIRIGRVKIKLRRLNLMETERTENAGK"
FT   CDS_pept        join(13614..14583,14638..17722,17776..17996,18047..20261,
FT                   20308..20999,21046..22716,22954..25853)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162255" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823010"
FT                   /orf_name="Pc14g00080"
FT                   /product="Pc14g00080 protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="phosphopantetheine binding"
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAP74149.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0001831E73"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5P9"
FT                   /transl_table=1
FT                   /translation="MTGDLQHTGEPIAIVGSACRFPGDATTPSKLWDLLRAPRDVLREI
FT                   PETRFSTKAFYHPDGLHHGTTNVRHSYLLSDDHRLFDAQFFGTKPVEANSIDPQQRLLL
FT                   ETVYEGLETSGIPMEKLQGSNTGVYVGLMTNDYADMLGRDVQNFPTYFASGTARSILSN
FT                   RVSYFFDWRGPSMTIDTACSSSLIALHQAVQSLRSGETDVAVAAGTNLLLGPEQYIAES
FT                   KLKMLSPTGRSRMWDKGADGYARGDGIAAVILKPLSAALANGDHVECIVRETGANQDGR
FT                   TKGITMPNPVAQADLIRTTYARAGLDLSKPTDRPQYFEAHGTGTPAGDPVEAEAISTAF
FT                   FGQAANYQRDGNQEDPLYVGSIKTVIGHTEGTAGLAAVLKASLALQHAVIPPNLLLNEL
FT                   SSTVLPFYNDLEILQVAKEWSQLPHNTPRRASVNSFGFGGANAHAILEAFDARLLDRAH
FT                   TGPDGSSTAVSPFNFSASSEKSLLANVAAYSTYLRNNPDINMRDLSWTLNCRRSTLPVR
FT                   LSVSASSPVELAARLDEAVASSAVTPSTQTGNIREPKLLGVFTGQGAQWARMGAGLLET
FT                   SPMVSDCIARLDRSLQELPTEHRPVWSLRDELLKDKSYSRIGEAAFSQPLCTAIQIALV
FT                   QLLRAANLRLTAVVGHSSGEIAAAYAAGYLNEQDAIRIAYYRGWSLQYATDQGGQEGAM
FT                   MAAGTSFEDAMELCEMPSLENRICVAASNSSASVTLSGDADAINEAKEILEDEKKFARL
FT                   LKVDKAYHSHHMLSCAAPYIAAIRKCGVTIQRPPSGSATWVSSVHGENIDDVDDSLVDT
FT                   YWSNNMVKPVLFSQAVTYAVGAAGPFDMALEIGPHPSLKGPAMETIQEVSGETVPYAGT
FT                   LNRGRNDSEAFSSALGALWVALGESVVDFAGFGMKATQKQNTRTPKLIKGLPSYSWDHD
FT                   RIYWHESRSSTAMRTEREPFHPLLGVKCPDGTDNELRWRNYLHPREVPWLGHHQVQGQM
FT                   VFPAAGYISAAAESVIQKYGLGSVQLIDFHDVIIGQALVLEEDGGVETIFRLSIDQVQP
FT                   NRVFASFTCHSAANKGSSNMSLHASATLQIVLGDPKHDILPPYSQPRGSFLDLEADRFY
FT                   KSVSGLGFGYTGPFQALSNLRRKMDEASGLIAVPVHPDTERPLIIHPASLDGAIQSIML
FT                   AYSFPGDGRLRTLYLPTRIDRLRLNPTACVALGAPGAHLPFYSAVTDARFADLSGDVDI
FT                   LSADGSHTLLQLEGLHTTPLSPLTSANDVPFFTEVIWDVDRPGQLKKGEGMHDHSMAMD
FT                   LERVAHFYFRKLQNSLQHSDRANASWNHTHLLSYVEHCTKSVANGKHRFAKQEWANDTI
FT                   ADIAPILDRHSDSADIKALCAVGENLAAVIAGDMNLLEILVQDNILAEFYAKTLGIGAY
FT                   LDAVAQAARQISHRYPHVNVLEIGAGAGVTSNRVIRAMGPSFASYTYTDILDSQFDDAR
FT                   ERFSDYQSRMAFKVLDIEKDIGEQGYEEACFDLVVAPLALYATRKLEATLTNVRRLLKP
FT                   GGYLVMLELTDPDVMRFGLVLGGLPGWWLGYEEGRTLSPCVSEDKWEGLMQKAGFSRFE
FT                   ALVSPSRTSPLPFCVMVTQAVDHRVDFLRDPLAANHIPLDVDSLTIIGGKTSLTADMVA
FT                   DIKTAVRPHYSNIYTASSLDDLVSASLPVMGSVISLIELDAPVLKNMSPENLKSFQELF
FT                   KQSKNVLWLGHGAQGENPYGNMFSGVQRTLAMEMTHLHIHFLNLHSLHDADVNIIATKL
FT                   LHLEAAEIWDQSGQLDGILWSNERELLLENGHFKIPRFRLNSARNDRYNSSRRLIIKEV
FT                   EPAGSVVTIHPTEIGYQIEEKDPQSSPSFPDDVHIDVTHSMLRAVRITASDNCFLVVGK
FT                   NRWNDERVIALSHTLDSQIHVPRALAVPCGDSDDLAMRSMFTLYFHFLALSMLEQLRSG
FT                   TTLAVLDPDFSLSPVLTKYASEKGVQLVLLTTREGHCSWPWVRIHPNATRREVLSKLPG
FT                   NISRLVNMSGGVDVTALLKTCLPTDCHFASESTLTARCSQSQYTSDRGQLAVQLQNTWS
FT                   RAQYDLMPVRKFAHLGLEDLIRAQSPLAEQSLIAWGQSQLAVQVRPATKQVGFSKDKTY
FT                   WLVGLTGGLGLSLCQWMIGQGARYIALSSRNPNIDDQWLQRMATNGCTVRVFSNDITNR
FT                   ESVQATYRNISETMPPIAGVAQGAMVLQDTMFIDLDLPRLEKVLRPKVEGSLLLDELFP
FT                   EDTLDFMVFFSSMAAMTGNPGQVAYNAANMFMASLAAQRRNRGLAAHAINIGAIVGNGY
FT                   VTRELNMGQQSYLYRVGHSWMSEQDFHEVFAEGVLSCMERVGSAELCCGLRIDDDESKS
FT                   WASNPMFQHLVYKSSNLVVADKKGKPGVLIKTRLFEATSHEEAMEILQDGFVLKLQSAL
FT                   QADPNKPMLDMSPDDLGVDSLIAVDLRSWFLKELGVDMPVLKIFNAASIRELLVTAAGV
FT                   VPEALIPNLVSGEQTVKSLVHPPIPPVPAPASPADLPVDIIFPETRASSVEPKIALPDA
FT                   TNAYSGSSATSLITGDSNSDNNDDTSSSIFTDDSEIGFPKREIQRTVPMSYGQSRFWFL
FT                   EHLVEDKAAFNITPTFELSGHLNIAEFAHAVQAAGQHHEALRTFFFTDNERNHMQGVWT
FT                   RSSLQLEHVAISDEREVEEASKQMEAHVFNLSDGEVMRVRLLSLNPEKHWIIFGFHHIN
FT                   MDGISFEVFWSDVEKAYQGQPLSEDGLQYPDFTLRQLREYEEGTWAGDLAYWRAQYTEI
FT                   QPAIPLLPFALQPMRPKVAQFGSHTAQIRLDVSLTDSIDRCCRMFKSTPFHFHLAVWKT
FT                   LLLRFFDMNDVCIGLGDGNRTEADILRSMGLFLNLLPVKFSQQPGQSFGESLKEVRNVT
FT                   QAAFSHSRVPFDVILTELNVPRSASHNPLCQTLFNYRPKVEQSRSFCGCVANGALLGGG
FT                   ETSFDLGLDVGNVGAGPELREEWSVTIVHRLDEVALRYPDRVALKDPHGGSLTYVEVQC
FT                   RINVIANELLRNGVGSTTRVGVFQSPSADLICSLMAILRVGGAYIPLDKKVGMDRLAMI
FT                   MKETQASMVLLDTNSMSDYALLRTTAKPIDVSTLNGSTARAVPNMAVPSQTAVIMYTSG
FT                   STGVPKGIMIAHSAYAHHIQSSSVVWKLKEGNETILHQSSYAWDASLWQIMVSLCSGAT
FT                   LVIASELTRGDPVALTRLVASENVTCTLATPTEYLLWLRHGRSHLTNSRLSTALSGGEY
FT                   IPSGLIKEIKSLRRPDLRLINAYGPAEISVACSSSEVRYNLDSTSTSLYTLPNYSVYIV
FT                   DTNLNPVPIGVPGEVVVGGAGVAQGYLDGTKTTERFTNDRYASKLFQEKNWTTIHRTGD
FT                   RGKLNRDGGLILLGRMDGDNQIKLRGMRMNIEEIEAAIVNSSAGAITQAVVSVRSDATD
FT                   QFLVAFAIMANAHENALQFLTRLSQELPLPAHMKPAAIIPVETIPQNTSGKTDRVAVSS
FT                   FPIPLVSSQLPDDSTLTAFEQSLRQLWQQALPQELRSFHSINSQSDFFHVGGSSLALVN
FT                   LQALIKENFGVSMALYQLFEASSLRGMAARIQDISGTALEHAVNWHAEVEVASNIASPL
FT                   NYGGTHIVASGVTTVVLTGATGFLGKEILRGLLEDEKVSSVHCLAVRRRSSGLSELFSH
FT                   PKVHLHYGDLGAPRLGLSESETRSIFSCADIVIHNGADVSFMKTYQTLKLINVASTKEL
FT                   VKLALPRRIPFHFVSSAGVARLAAQESFGEVSVSPYPPPSRPTDGYIAAKWVSEVYLER
FT                   VNCQFGLPVWIHRPSSITGTDAPELDLMGNVMRFIKEIQKVPDSSSWSGGFDLISVQSA
FT                   ASQLLEAVHQSGTAEAGETVTYLYESGEMKIGRDEVMPLMESGSGQQFQIVSLGEWVDA
FT                   AEQAGMSVLLGEYLRRAPEGQVLLPRLIKSNGFPEDE"
FT   CDS_pept        join(27132..27688,27747..28278)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294684" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942264"
FT                   /orf_name="Pc14g00090"
FT                   /product="Pc14g00090 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP74150.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831E74"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Q0"
FT                   /transl_table=1
FT                   /translation="MASHDQLPSNQTGIIQHEGGILQITHGLPIPELGPHQMLVKTAAV
FT                   ALNPCDYKMPLRFPTPGLWDGCDFSGTVVALGSEVAAQGRFHLGDKAFGAVQGSNMSDP
FT                   MSGSYCEYIRTEPGLTFHVPKGMDLVAAPSLSGTAIATLGVALFWSLQLPGTLHTPASK
FT                   SEDVLVYGGSSTIGLLAIQMVKLCGHRVITTCSPHNSDLVTSYGADLVFDYHSPTCAED
FT                   IRAATKNTLRYALDPFAEAKTLRLCHAAIGRTGGRYCALEQYQESLCSRKTIKHELVMG
FT                   GAISGRGVELPDPYGIPPQPEIGVWAQSWYLELQQLIDDGKLKPCPTQIIPGKFAGILE
FT                   GLDMLRNGRVSGKKLVVHMTTK"
FT   CDS_pept        join(complement(29304..29357),complement(29212..29253),
FT                   complement(28648..29154))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942265"
FT                   /orf_name="Pc14g00100"
FT                   /product="Pc14g00100 protein"
FT                   /protein_id="CAP74151.1"
FT                   /db_xref="UniParc:UPI0001831E75"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5I0"
FT                   /transl_table=1
FT                   /translation="MAVPDFEDVPDLTGTWVLNRELSTDPDELFVLQGVPWVVRKVLRH
FT                   ARLSLQIHQTTSLSKESTCMGASSKSSDLADNLKPVTTLHMTQTVHPGGFDSEGSYSVD
FT                   GSRQDVSLPIFGDVQMQLRFIDRPDILEDPIRQILEVASLSDKVIQELAHNASKGWEAE
FT                   VIWGFEELEGKKCMTRNISTTKDEKKVIAKMVYDGPN"
FT   CDS_pept        join(complement(31004..31504),complement(29842..30948))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670263"
FT                   /orf_name="Pc14g00110"
FT                   /product="Pc14g00110 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP74152.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831E76"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5I5"
FT                   /transl_table=1
FT                   /translation="MHTTHNYRHSRRSACDRCRGQKLRCERDHLNGMSCERCLKAQEIC
FT                   TTSMNQPAPIILPSNHGQNLLAREDHQSERFNQRHGSMSVLHKSSAPRVKKIHDPFPNS
FT                   GRLNMQDHYWGGGGSMPALPGGSLYLPSADIGFNMPLDFGNIIPPAEQWCNPHLNWSTD
FT                   AYNLPPARVPSNQVYPCEANSCFPFTFTSGAPPGASQATEMAISEPFQNRCFNYGDSEL
FT                   PFAIKDRPDPAWMNHPDIATINKPPSATTSQEGLPSTNGICKSLLRLKMGLVEDLELFE
FT                   TGSMLLESSSIFYGSSNLSIETLDLPIYRLLNYSSWLLEIVRSSCGTEESLDVTSTQRF
FT                   GSESSGYDDPLFILPDAGNSLDEDVTTVSPHDSGYHTTTTSPDGTTTPTIPKCDIALWL
FT                   GILEAHCSLVRIYRAVFMRLYQLFLIIPPTDAATILLLPKVRFGQFYLDGNLIAQVQSL
FT                   VDFSSAMMGKLDRALKLRSGPAQPQEDREFDSSDTVQKDWSSSIRDIVLAQEQDPCEMS
FT                   LMEIMECLRQRVKDPVVA"
FT   CDS_pept        join(complement(33791..34882),complement(33703..33728),
FT                   complement(33546..33630),complement(33320..33483),
FT                   complement(33060..33255))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942266"
FT                   /orf_name="Pc14g00120"
FT                   /product="Pc14g00120 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP74153.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0001831E77"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5I1"
FT                   /transl_table=1
FT                   /translation="MDWWNAITAQPIVALGVIGVTYGVWLATYRLWLSPLAHFPGPKLA
FT                   ALTMWYEFYYDSFLEGQYTFRIAEMHRKYGPIVRISPFELHIDDPEYYEILYSRDKPRN
FT                   KSLHLTGMFGAPASAFGSVDHRRHRIRRQPMNPFFSQQRIRQLEPMLRKMINKLCKGMR
FT                   DWKERQTPLHVYHAFNAYTTDVVVEYSMGESFHYLEDPDFTPQWSKTIEAIVQVGVQFK
FT                   QFRWVFSLFELFPRWLVVSINPHIGPVIDQKLESLRLAKTVIDSQTAEGNPADDKVNVP
FT                   KGTLFHALLDSKLPPEEKAPDRLSQEVFTVISAGGETTAKNLTTLTFHLLNNPDKLQRL
FT                   RDELNRLDPDGTASLVEYEAMPYLTSVMLEGLRITNAVATRLQRSCPDQVMIYKDWVIP
FT                   PGTPVGMTSIFMHHNEDIFPNSQSFIPERWMDPEQRKKLEKYLVAFSKGSRQCIGIPLA
FT                   RAEILLAIATIFREFDMELYETTVDDVQIVRDMFNGLPRKGSQGVRVVIRDCNGHPRQS
FT                   ATS"
FT   CDS_pept        join(complement(35423..35565),complement(35250..35337),
FT                   complement(34894..35142))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670264"
FT                   /orf_name="Pc14g00130"
FT                   /product="Putative uncharacterized protein Pc14g00130 "
FT                   /protein_id="CAP74154.1"
FT                   /db_xref="UniParc:UPI0001831E78"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5I2"
FT                   /transl_table=1
FT                   /translation="MALSVGALFSPDTSAIPEWETLELHQACLSSTYVYVYLPLKGKRN
FT                   EVNFNALSMKVPPRPRARARGLKVINPNLLEGKIFHAPDILALLPFPIHKWTPYDARGY
FT                   RQYGFQSSSGIHFSAEWDSVLLDRSVGQQSQNKKGRSTGKSAFASFLVDVFLLSL"
FT   mat_peptide     join(complement(35423..35520),complement(35250..35337),
FT                   complement(34897..35142))
FT                   /db_xref="UniProtKB/TrEMBL:B6H5I2 "
FT   sig_peptide     complement(35521..35565)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5I2 "
FT   CDS_pept        join(36081..36267,36314..37302,37349..37534)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942267"
FT                   /orf_name="Pc14g00140"
FT                   /product="Pc14g00140 protein"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP74155.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI0001831E79"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5I3"
FT                   /transl_table=1
FT                   /translation="MNFDLPADLKTHLESIDSFIHSTILPLQHSNDNNRFFDHRREYER
FT                   TDWENNGNPRKEWEELLGEARTLADSSGLYRFALPRVYGGQSHPDVNLWMSAIRYHLSS
FT                   NAVYGGGLGLANDLQNEHCIVGNFPDVLMLHHFGNEQQRNTLIPARLRGEFRTTFGLTE
FT                   PDHGSDATFMSTTARPTRGGFEIKGAKKWQTGAHHCTHFLIFARTSGKAGSAQGITAFL
FT                   VPRDTRGVRIVSYEWTLNMPTDHATVELNSVWVPESAVLGSIDQGLAIAQTFVHENRIR
FT                   QAASSCGAARYCLDRSIDRARARKIWGEGKSLADNQAIQFPVVELMTQVEMLRLFILKT
FT                   SWEMDRIVAECQSSKAQRAPWVEIEGRLSDQVAMCNFWANRLCCQAADRAIQIHGGDGY
FT                   SRHYPFEHIYRHFRRYRITEGAEEIQMRKIGAYIFGFAGPKKREMKHEHSKARI"
FT   CDS_pept        join(38376..38562,38703..40153)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823011"
FT                   /orf_name="Pc14g00150"
FT                   /product="Pc14g00150 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP74156.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001831E7A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5I4"
FT                   /transl_table=1
FT                   /translation="MVSPDASVHDDTKTSANAVSAESDNVFQDTKEPDAEQNHGDTSNN
FT                   KELKRKLKSRHLQMIAIGLFISSGTAIAESGPAGALIAYIFVGSIVYSVMSSLGEVATY
FT                   IPIPGAFTSYAARLIDPSLGFSMGWIYWFNWASTFAVELTATGTIIQYWDSSLNIAIFI
FT                   GVFWVLITAMNFLPVNFYGEVEFWFSTIKVATVIGFIIFAICIDVGVGQQGYLGFRYWS
FT                   TPGAFASYSPDLPVSVGKFVGFWAVLIQAGFSYQGTELVGVAAGETENPQKTVPSAIRK
FT                   TFVRILLFFVLTIFFIGLVVPYTNNRLTTAETNASSSPMVIAADLAGVKVLPSLINAVL
FT                   LSVVLSAANSNVYSGSRVLTGLAHEGFAPACFGWVTKHGVPYVSVTFTALFGLLGFMNV
FT                   SNDAGQVFTWLVNLSSVAGFVTWASINACHIAFMRVLANRGISRDTLPYKAILQPYLAW
FT                   YGLFFNILIALTQGFTSFIPHFRVTDFFVAYICPIVFVVLYLGHKIIFRPSFIRAADAD
FT                   IDTGRLHYEKEVDAPKPWYSRVWGWVAK"
FT   CDS_pept        join(complement(41769..41946),complement(41614..41711),
FT                   complement(41303..41563),complement(40447..41235))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163872" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670265"
FT                   /orf_name="Pc14g00160"
FT                   /product="Pc14g00160 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP74157.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831136"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5I6"
FT                   /transl_table=1
FT                   /translation="MEPKEYPPSFTSRSTSFIPFDQESDSRIILDDEKLPPVDGGVQAW
FT                   LFLMASAMLEALVWGYAFAFGIFQDYYSTHKPFEGSENIAVIGTCAMGLAYLIAPLAIV
FT                   LMILVPKIARWVSTIGVVIMCLSLALSSFSTNVMHLILSQGIGFGIGGCFAYTPTILFM
FT                   SEWFEKRKGLAFGIVWGGSGLSGIIFPLAIQWLLNQYGIEATLQISSVALFILAVPFLY
FT                   FHRPRLHTTEIAYHRLNFRFLYNKVFIIYQLGNTLEAIGFFLPTIYLPTYARSLGASDY
FT                   MASLTVILVNLFTVFGSVIMGFLSDRYHITTCILMSTVGTVISVFFVWGFAATIPPLYV
FT                   FCIAYGLLAGGFSSTWAGVSHEVQKANPLADATVIFPFMETGRGIGNVASGPLSEALLK
FT                   ADNWRGHALGAYGTGYGTLVVCTGATALIGGFSVMARYLKWI"
FT   CDS_pept        complement(43506..44786)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942268"
FT                   /orf_name="Pc14g00170"
FT                   /product="Pc14g00170 protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /protein_id="CAP74158.1"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="UniParc:UPI0001831137"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5I7"
FT                   /transl_table=1
FT                   /translation="MARSLLLVALSLGAAAMPAASGMSNIKNIVVLVQENLSFDHFAGG
FT                   LDYDSSIDGPQNPQYCNPANVSSPSEQVCANPDAKNIASDDPNHSIAGGNMQVFGTYHP
FT                   LAGAKSTMEGFISEQRASYPKDDLDRAAEAINYFTPEHIPVFDTIAQNFVLFDRWFAAV
FT                   PGPTNPNRAYLTSGTSHGHGHNDDDFLNSALPQKSIFEQLSEKGITWKNYENSTQSKPS
FT                   FLPDAMFYEWTAKNGKENVVPISQFYSDAKAGALPQFTWINPECCSFMSMHPPSPINMG
FT                   ENFVKSIYEAVRNSPQWNETLFILTWDEHGGFADHVSPPTDVPAGDSLTYTETARDGEP
FT                   YTFHFDRLGIRVPTVLISPWVSKGLVQHKPSDGNEFTHTSILKFVSELWGLDSLSPRVD
FT                   WSPSFGNLVTNSFRSDTPEKLPDAADF"
FT   mat_peptide     complement(43509..44720)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5I7 "
FT   sig_peptide     complement(44721..44786)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5I7 "
FT   CDS_pept        join(complement(47933..48087),complement(47770..47879),
FT                   complement(46702..47699),complement(45773..46645))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225953" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942269"
FT                   /orf_name="Pc14g00180"
FT                   /product="Pc14g00180 protein"
FT                   /function="transketolase activity"
FT                   /protein_id="CAP74159.1"
FT                   /db_xref="GO:0004802"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="UniParc:UPI0001831138"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5I8"
FT                   /transl_table=1
FT                   /translation="MSVEVQQNGVNGVHSSAMPLVHKLSKDHDLVLKTFRLLIADLCQQ
FT                   FNGGHPGGAIGMAAIGVALWRYVMRYAPHTPGFFNRDRFVLSNGHTCLFQYSFLHLTGY
FT                   KAMTFEQLKSYHSDRVDALCPGHPEIEHEGIEVTTGPLGQGIANAVGLAMATKNLAATY
FT                   NRPGFNVVDNHTWCMIGDACLQEGVGLEAISLAGHFRLNNLTVIYDNNQITCDGSVDLT
FT                   NTEDVNAKMRACGWDVIEVADGCFDIEAIVSALEQARSSKEKPTFINIKTVIGLHSSVA
FT                   GTAVAHGAAFGAQSIRDMKTAYGFNPEEHFVIGESVRQFFQGIPERGEQWVQEWDQLVN
FT                   DYAVQHPDLAAEFKARVRGELPPDWEEHIPTAFPDKPTATRASSGLVFNPIAKDINSFM
FT                   VGTADLSPSVNMIWPGKVDFQHPELRTTCGINGNYSGRYIHYGVREHAMAAISNGLAAY
FT                   SPNTIIPVTSTFFMFYLYAAPAVRMGALQHLQIIHVATHDSIGMGEDGPTHQPIELANL
FT                   YRAMPNLLYIRPGDSEETAGAWIAAIGAKQTPSIISTSRQALPQLAQTRRDGVALGAYV
FT                   LSEAESAAVTLIGVGAELSFALEVAKQLKVQKDITARVVSFPCQRLFEKQSLDYKRATL
FT                   QRHRGIPAVVIEPYAPNGWERYADAGISVTRFGQSLPGKAAYKFFGYEIATLTTKVASY
FT                   LERVQEDELLRGEFVDL"
FT   CDS_pept        join(48363..48690,48741..49369,49430..49633)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942270"
FT                   /orf_name="Pc14g00190"
FT                   /product="Pc14g00190 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP74160.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831139"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5I9"
FT                   /transl_table=1
FT                   /translation="MAPVLLDQPNGQQVVKTAGDRVPLKVSHPNPSLQITADHKLKSVN
FT                   TPVYAPKPGEALVHIKATGICGSDLHFWKTGRIGSLVFEGDCTIGHEASGIVLQCGEGV
FT                   NHLKPGDRVAVEPGVPCEHCFLCDEGRYNLCDDVQFAGVYPYEGTMQRYKNHPAKWLHK
FT                   LPDNVTFAEGALLEPLSVVMHGVKSAGLSLGRGVVVCGAGPIGLIALAAARASGAHPIV
FT                   VTDLEPARLAFAKEFVPSCITYEVDRTKDSQGNAEAIRALFGSGEYFAPETILECTGVE
FT                   SSVCTAAYTARRGGTVMVIGVGKAIMNNLPFMHISLAEIDLRFINRYRDTWPPAVACLS
FT                   GGILDLKKLVSHRFPLEKAQDALHLCADTRNGSIKVLVVDEQDVSL"
FT   CDS_pept        join(50951..51265,51357..51690,51748..52478)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202845" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670266"
FT                   /orf_name="Pc14g00200"
FT                   /product="Pc14g00200 protein"
FT                   /protein_id="CAP74161.1"
FT                   /db_xref="UniParc:UPI000183113A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5J1"
FT                   /transl_table=1
FT                   /translation="MNDWSQPEATPSNSTDAAFASPLGANSWGDGFSHDPGFLASQEEL
FT                   RCMLFNLAQSAAPTRAPSPDTQEQDGTQLRDRGQTSTRPVLSNPRRIEYLKNYVGQVAP
FT                   WIPALARSFPALLNAILAISARQMERKEGIQDSFDSLELYQEAIRLLSPLLQMRDPKVV
FT                   AACVLLCCLEMMSARAQDWHRHLEGCAALFDAFQMNGFSEGLLQAVFWCYARMDLCGAL
FT                   ISDGTQSTLLRPSKWLAPGCHEDDAAQLFKAAQSPDMHANYAVYLCARSCELVADRTQF
FT                   VELAVQNDCAGEAFNRRWLRLWGDLQNWLDNRPPELLPINTTTTKPFPNILFLQWAAIS
FT                   SNQLYHTACILLLNLMPKSIKLQPTPAISALWHARRICGISLANPHHGCLNNAIQPLWI
FT                   AGRLFSHVSEHRIIVELIRHIEAETGWGACWRIRDLELAWGYQVSRPDRTMDRPRFPVT
FT                   G"
FT   CDS_pept        join(complement(54381..54456),complement(54183..54331),
FT                   complement(53668..54129),complement(52511..53619))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942271"
FT                   /orf_name="Pc14g00210"
FT                   /product="Pc14g00210 protein"
FT                   /protein_id="CAP74162.1"
FT                   /db_xref="UniParc:UPI000183113B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5J2"
FT                   /transl_table=1
FT                   /translation="MTSPSVFSDHVDSDSTPLPQIPQMDKDQAQDEMSFTSLMSALPAD
FT                   RIVRTFSRFKGLRLKAEQLLKSLQEKGDGNQFIVVLNLSARTIKKLDEEHQSSLGGINY
FT                   RFQWEGTTGLIKVVPSERHDGITQISRAIDMKLIAMGLRWSEMVWTGTSTYKPTAGAGK
FT                   QGDQAFLPPIRCPNGLPSGSWPTFVIETGVSESLPRLREDAKRWFIISQGLVRIVIIMS
FT                   IKLTEVTFEKWQLAPTNAPCPLTRAYLDGLRTQPLNVPPLVTQPIPTQQPYSAQEVYVQ
FT                   PNNVVGAPLSIPFAAIYDRPPGPGEHDILINANDFLEITEKLF"
FT   CDS_pept        join(complement(57531..57537),complement(57012..57374),
FT                   complement(56568..56965),complement(55756..56513),
FT                   complement(55439..55704),complement(54822..55342))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179021" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976233"
FT                   /orf_name="Pc14g00220"
FT                   /product="Pc14g00220 protein"
FT                   /protein_id="CAP74163.1"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000183113C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5J3"
FT                   /transl_table=1
FT                   /translation="MGHYKYMLPNLDKIMLLTLSLCLSGPYLHKYVQDYILLQIVPNMS
FT                   TLPHMSKYVKICQNCIFEWDSHCCGDPPHEQYQDPRAILRIVVFSLYTFALKTPSIFPP
FT                   LSSPFAIILAMERVVIVGAGLYGLIAAKTYLQLVGTYESTAKSTDKVAEIPACFTENID
FT                   ASPTTPSESRLLVIDSASDIGGTWAEERLYPNLLSQNSYGLYEFSDLPLSDVVPEEHAS
FT                   DTQNQFIAGWKINRYLHAWVEKWQLKKHIRLNWTVDDISRLETKEWKLNIRVSTSPGRR
FT                   ITIICDKLVLATGLTSVPNMPDTKGPSVGSNNPAPVIHAKDVGEWAREHLGYQPLKAPD
FT                   SEVVSIPPKDSPDPQLRSVAIYGGAKSSFDLVHFFATLHRNDSKLHLKSTQESPVQVHW
FT                   IIRDRGAGPAWMVPPMSTLPNGNTVASDKAASSRLLTHLTPCCYKTPRRLSLGPSGGLH
FT                   WEGSWLARLFHGNPLGRWWVRWLWRSIDRSLEEAAQYGSDPKMEKLRPENSVVSCASGI
FT                   GIANQGDLWETIRLPHVYVYRSAITDIDTVRGKTTDTSTKAAVHLADSSYIHEIDLVIH
FT                   ATGYKPIVPIRFEPASLRLELAINDRIQHWEDLDRRSEVMVRKTLNATRCALPDRSPPS
FT                   WAESHTLVPYRLFRRMVAPELVAQGDRSFATLGVILSSTIAVVAEVQALWVAAFLTEGL
FT                   DSTVDIQSTPHQALSLENLSLEAMENTISEDVVLGSLTGTGLEVEAIQVWLLRGSTRIS
FT                   QTNYCISTMICSCAIWV"
FT   CDS_pept        join(complement(59220..59239),complement(58935..59172),
FT                   complement(58108..58875))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167998" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823012"
FT                   /orf_name="Pc14g00230"
FT                   /product="Pc14g00230 protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAP74164.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000183113D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5J4"
FT                   /transl_table=1
FT                   /translation="MPSQQPSYVLVTGATGFIGAHVVDNLLARGFSVRGSTRSKQKGDQ
FT                   MKAARPQYASKLDFVVVEDFTQIGVFDSVMDSIDAVIHVASPFFYDTTNNEQELILPAI
FT                   NGVKSILSASAKPGSKVQRLVMTSSFASVVDPSSTPAPGFTYTAANWNPLTYEEAIDLK
FT                   SDSVTAYRGSKKFAELAAWEFVKEEKTKFDLVTLCPPMVFGPVVHPVPTVQQLNESNMM
FT                   LWGVAAGVDPLPVTRVPGWIDARDLAEVHVQALLTPEAGGKRFVAASPEPFSYEYAADI
FT                   IRDEFNWAKETVTRNYKTGEKPSASYGIDGETVSRELGVKYRPFKETVIDLVRQIRELA
FT                   I"
FT   CDS_pept        join(complement(61140..61188),complement(60140..61070),
FT                   complement(59511..60078))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000121941" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942272"
FT                   /orf_name="Pc14g00240"
FT                   /product="Pc14g00240 protein"
FT                   /function="carboxy-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="carboxylic acid metabolic process "
FT                   /protein_id="CAP74165.1"
FT                   /db_xref="GO:0016831"
FT                   /db_xref="GO:0019752"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="UniParc:UPI000183113E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5J0"
FT                   /transl_table=1
FT                   /translation="MDHNQFKTAAHSAIDDIVNYFDSVPERRVLPAIEPGYLRPLIPEN
FT                   PPDEPEDWAQIQEDVDTKIKPGLTHWQSPNFMAYYPACVTYPSILGEMYSATFTAPAFN
FT                   WLCSPACTEMETIIMDWVAKALALPECFRSTSETRGGGVIQNSASDAIATIIVAARERR
FT                   VRELLLAEGLKEGTPEYEDRKFDVQAKLVAIASDQTHSSGAKGALIAGTRFRSVTTRLE
FT                   DNMEMTGPRLREVLEKCDEDGLTPYHITLTFGTTNTCSVDRFGEIKAVLQEKPAWQRIW
FT                   VHIDAAYAGASLVADEWQYIAKNFAEGVDSFNMNMHKWLLVNFDASVLFVRNRLDLTSA
FT                   LDITPTYLRNPYSESGSVIDYRNWCISLGRRFRALKIWFVIRSYGLNGMKAHIRKTIGL
FT                   GDTFAGLVRGRSDLFEIVTKPGFGLTVFRVKSPHGASNGASGSSDRVVKDEVADGLTKK
FT                   ISELVNTRGEIFITSTVVDGVCVIRVISANALAEEKYIRNAFDVIVRTTEEVLQEQK"
FT   CDS_pept        complement(61515..62066)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942273"
FT                   /orf_name="Pc14g00250"
FT                   /product="Pc14g00250 protein"
FT                   /protein_id="CAP74166.1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000183113F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5J5"
FT                   /transl_table=1
FT                   /translation="MDTPIRRVIAGHDAQGKAYFASDEILTPYDPTTAPAFSTPGPDSG
FT                   FGVIQIHRSRGFPVDNMRQLSDPHKTLVPLADTKGPSCRVLDLPPADAGWFHRTLSLDY
FT                   AVVLSGTVGFITDGGEEKILNQHDVIVCRGANHEWVNRGKDVARVFVVVVPSKEIVTED
FT                   GKRLEKTPAGDIYDPKEEED"
FT   CDS_pept        complement(62425..63018)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178752" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127311"
FT                   /orf_name="Pc14g00260"
FT                   /product="Pc14g00260 protein"
FT                   /protein_id="CAP74167.1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI0001831140"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5J6"
FT                   /transl_table=1
FT                   /translation="MPYKKNPLPYIRRYITTHNTEGESVFLSHAQVPDYLPSTPTGDDG
FT                   EIALLYATTSMPASVDAEADVAMYDEFLHQPPGITVDNGTVFRLIDLRPGKATPMHRTV
FT                   SVDYGVIIEGEVDLVLDSGASRRMGRGDVSVQRGTAHSFRNRSNTEWCRMLFVYLPMEK
FT                   LKIQGRDLNSEVYDEGFDNSDNGEGEQGASNEAR"
FT   CDS_pept        complement(63230..64252)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000085952" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942274"
FT                   /orf_name="Pc14g00270"
FT                   /product="Pc14g00270 protein"
FT                   /function="NAD+ binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP74168.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR017328"
FT                   /db_xref="UniParc:UPI0001831141"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5J7"
FT                   /transl_table=1
FT                   /translation="MSDDTSRHIKASMEPDIQSIVDRIKTGKATRIVVLTGAGISTGAG
FT                   IPDFRSPNTGLYDKLAPLRLPYPEAIFHVNYFSHTPEPFYAIARARHPGNLKPTVTHAF
FT                   LALLAKKNLLHFVFTQNIDGLEQDAGVPPDKVLWTHGNWKSQHCYKCKSSYPDDLMNKA
FT                   IRTGEVPYCLDTGCGGAVKPDVVFFGQSLSAEFDEKEKEVLEADLMLVMGTSLRVAPCS
FT                   RLPRLVRRGIPRVLINNEKAGDLGNRDDDVCILGSCDDGVRQLADALGWGEDLNDLWEE
FT                   AVATKKNDQTFEGGPSLDECIEKLASSIKDKMKVSDGHKRMLENHLNSKFGHIITKGHG
FT                   "
FT   CDS_pept        join(complement(65575..66629),complement(<64463..65522))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178753" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942275"
FT                   /orf_name="Pc14g00280"
FT                   /product="Pc14g00280 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP74169.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831142"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5J8"
FT                   /transl_table=1
FT                   /translation="MKRRLDARVTTPGSKRQTRQDPVSCESCRKKKLKCDRGLPCSSCS
FT                   ARKLECSYGGYGPATTPVQVTSQTYQRPMLDDRVSEPPRALQWTPRQETETQSRNGDEP
FT                   LLTADRLEAIVMGHRVPSAVPATLRAELSQRREPERSPSHQHTTPGVRLPPMRERHASR
FT                   ANPATIYLPLYLPPKVEALSLFRYYCKYLDFQYHLIIPSQVERQIETIYENVARNESFN
FT                   LAHTALLFSITAAALYYQLLTESSEHAEPFSQESTFLAGAALIQSNYIPYPTLEGLQAT
FT                   MIIGHHLSNMNFPSSVSPLFVHRSFVGQAISMGLHIVDGPRVLSERLETGFDKTNVELK
FT                   RRLWWDLAAYDWLIGFLSGPQEWTYSIQPQHMIVQVPLNVEDEEIGHSENGVPLSTPTA
FT                   ISYSLCRLRLAVVCRQIVDETSYYHLHGQEVPYEKILELDQKLQQVRAEIPSFFRFDQA
FT                   SQREYSAIYRERPTLAWQRALVQQGYHSRFCRLHRHYFVRGAKDPKYSYSHVVSLQSAR
FT                   KVLEVKRIMDEEEPVFTPHSSVVWAVMHHVFMAAAILLIDVCFNWDDILAERRKEEVLD
FT                   ACRMLSRAQQSSPIACEGIKAMMEILRRHWKHEKRVSSRDLQEPSTSLNSTAATASTPQ
FT                   PGIPTPVSLGSKSITFPLDISNGQSTVNHPTDALLDPLPLEDIWTEMLESSANVELNTP
FT                   DWTNLLTELTN"
FT   CDS_pept        join(66968..67002,67056..67272,67328..68104,68156..68253,
FT                   68307..68354,68434..68542)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976234"
FT                   /orf_name="Pc14g00290"
FT                   /product="Pc14g00290 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP74170.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0001831143"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5J9"
FT                   /transl_table=1
FT                   /translation="MSPKDNRPTEYTPRACLVIFGAFTCAFCTVGFMNSFGIFQEYYTK
FT                   NQLSSSPTSTIAWLGAIAIFLLFAISVGAGAMLDIFGPTLMVYVGSFGCVFALMMTSLC
FT                   HEFYQFLLAQGVVLGISMGMATWPMLALVGQYIKVKRAAAMGIVLGGSSLGGIIWPIAI
FT                   DRLINHPNIGFPWTMRIVGFIMIPCFTFSCAVAKSPKKATTNAESRDLNQARGENTTEQ
FT                   KDAPQSHKVEALALWRKPSLQLLCLAMFIIYFGMFAPFFYTTSYAVGKGFSTSLAFYTV
FT                   SIVNGASFFGRVLPGIVADKYGKFNCCIVATIASGIIAMCWTKVTSVTGLVIWSAAYGF
FT                   ASGGILSLQQACAAQVATPSTLGLAIGTVSASTALSAMANVPISGALVERYGTGSFELS
FT                   SNVWPSGRGSAFLFNTLAYSLGDGCSRS"
FT   CDS_pept        complement(69067..69561)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942276"
FT                   /orf_name="Pc14g00300"
FT                   /product="Pc14g00300 protein"
FT                   /protein_id="CAP74171.1"
FT                   /db_xref="UniParc:UPI0001831144"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K0"
FT                   /transl_table=1
FT                   /translation="MPSLRNILVCLMATSTTVYAERLKVVWSSGDFSTISGPAGGNTNG
FT                   HFKGFAIINQAGEAVYDQAYPDNHSPCYNTGDGREFTIEGDCWATPRKFKCKSDFGGHP
FT                   DTCEVKDGDGNSLGSAKGQTDTTFIGIAIGQDSSCVVEFDSDSDGCPVDDGNGPLHVTS
FT                   G"
FT   mat_peptide     complement(69070..69501)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K0 "
FT   sig_peptide     complement(69502..69561)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K0 "
FT   CDS_pept        complement(71014..72756)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234783" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942277"
FT                   /orf_name="Pc14g00310"
FT                   /product="Pc14g00310 protein"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP74172.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="UniParc:UPI000183121F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K1"
FT                   /transl_table=1
FT                   /translation="MKLSTAITVGLAHRALAANPQIDYNSAPPNLSTLSNASLFDTWRP
FT                   RAHLLPPSGKLGDPCAHYTDPKTGLFHVGWLHDGISAATTDDLVTYKDLNPDGGPSITA
FT                   GGKNDPLAVFDGSVIPNGIDGMPTLIYTSVSYLPIHWSIPYTRGSETQSLAVSYDGGRN
FT                   FTKLNQGPVIPAPPFAVNITAFRDPYAFQSPLLDKSVNSTEGTWYITITGGVHDVGPCS
FT                   FLYRQHDAGFQYWEYLGQWWNEPVNTTWGNGDWAGGWGFNFEVGNVFSLNAEGYSKDGE
FT                   IFMTLGTEGSGQPIVPQVSSIHDMLWVSGNVTNEGSVTFKPTMAGVLDWGLSGYAAAGQ
FT                   ILPASSQASKKSGAPDRFISTIWLTGDLFELAKGFPTAQQNWTGALLLPRELNIRTIPN
FT                   VVDNKLAREEFTSWRVSREGAGQLDLETMGISLARETYSALTSGPSFVESGRTLSKAGS
FT                   VPFNTSPSSKFFAMTANISFPATARDSGIQAGFQVLSSGLEATSIYYQFSNESIIVDRS
FT                   NTSAASKTTHGILSDNEAGRLRLFDVLENGKEKVETLELTVVVDNGILEVYANGRFALG
FT                   TWAR"
FT   mat_peptide     complement(71017..72705)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K1 "
FT   sig_peptide     complement(72706..72756)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K1 "
FT   CDS_pept        join(complement(76083..76532),complement(75366..76029),
FT                   complement(75025..75291),complement(74772..74944))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170996" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127312"
FT                   /orf_name="Pc14g00320"
FT                   /product="Pc14g00320 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular
FT                   oxygen, reduced flavin or flavoprotein as one donor, and
FT                   incorporation of one atom of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP74173.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016712"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002402"
FT                   /db_xref="InterPro:IPR002974"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0001831220"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K4"
FT                   /transl_table=1
FT                   /translation="MLFSPAVTLVGTLSVAFLVVRYFAQLHHHRKQSKALHCKPARSGS
FT                   SGFFGIPGFIRLSKAVREKRWIEHLYNEYAVYGNTYKQTFLSRNLITTIEPENVKAILA
FT                   TRFKDFSLGTRHQQFYPLLGDGIFTLDGAGWSHARGLLRPQFTRDQVADLSMLDDHISN
FT                   LIDLIPKDRSSFDIQRLFFLLTLDSATHFLFGESVGCMLPPSGKTGVLEKCAVGSAQGF
FT                   ANAFGTAQDYLAARSRAQGLYWVVNPKEFREASRQVHEVVDHYVNLALESKRNPEKKTD
FT                   GRYIFLEALAADTDDPKMLRDNMLNILLAGRDTTASLLSSTFFYLSRHPNVWNRLRREI
FT                   VEVFGDAKNPRSEMTQTKLKDIPYLRYVLNEVLRLQPPVPVNFRVSTKDTSLPLGGGVD
FT                   QQSPVYIKKGTMVAYSVYAMHRRTDLWGKDATSFRPERWEENAKHGWEYLPFNGGPRIC
FT                   LGQQYALTEASYTVVRLMQHFDTLENADPHPRQEPIKLSNLTMSHDLGVPIRLYSSDKI
FT                   "
FT   mat_peptide     join(complement(76083..76460),complement(75366..76029),
FT                   complement(75025..75291),complement(74775..74944))
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K4 "
FT   sig_peptide     complement(76461..76532)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K4 "
FT   CDS_pept        join(complement(78335..78544),complement(78064..78278),
FT                   complement(76765..78013))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170997" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942278"
FT                   /orf_name="Pc14g00330"
FT                   /product="Pc14g00330 protein"
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP74174.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="InterPro:IPR008758"
FT                   /db_xref="UniParc:UPI0001831221"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K2"
FT                   /transl_table=1
FT                   /translation="MHFSTVVKGIATLTALSGTAAGIVTSQFKRDLKLSAELGIHPDTL
FT                   LGQKTTVHDVTNSQLDETIEAEYVSIPIDHSNSSVGHYRNRYWVSEEHYKEDGPIFVFD
FT                   VGESTAEPAGQTYLSNSSTFFYQLVKEFGGIGIVWEHRYYGDSLPYNVSLDMEPEHLQY
FT                   LNNKQALADIPYFAAQFTRQDYSDVDLTPAGTPWVMVGGSYAGMRAAFTRQSYPDTIYA
FT                   AFASSAPVEARIDMSVYFDQVYDGMVTYGHLNCTRDIKAALEYIDEQLSKSESAAAAIK
FT                   REFFGEGAEKNSNGDFTAALVTIYNFFQSYGMGGGVGSLESFCEHMETDPKTSAAAPSE
FT                   GFAPTRGKKYVAERYASWPVFTQVVNMNMKTNCKKLETSEPLECDLGPPSANPDTISWT
FT                   WQYCTEWGYFQTNNFGAHSLLSKYQTLEYAQEYCNRFFPEAVAKGLFPKHPQTEATNAE
FT                   TGGWSIRPSNVYWSGGQFDPWRTLSPLAETRLGPQGVTLTTEIPKCNVETEENTIFGYI
FT                   MQKAEHCFDFHTAFVPGAISRGYFQTALKEWLGCFKAKTR"
FT   mat_peptide     join(complement(78335..78481),complement(78064..78278),
FT                   complement(76768..78013))
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K2 "
FT   sig_peptide     complement(78482..78544)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K2 "
FT   CDS_pept        join(80470..80746,80807..81037,81087..81188,81237..81430)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15942279"
FT                   /orf_name="Pc14g00340"
FT                   /product="Pc14g00340 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP74175.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0001831222"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K3"
FT                   /transl_table=1
FT                   /translation="MSRSCRLQEKVAIVTGSSSGLGRAIAIRYAQEGAKVVCADLVPTA
FT                   RSQEEVGITTHDLVIRDGGEATFVRTDVGDATQMENLVQVAVREYGRGLVNNAGISIEA
FT                   QTPAVLHLTDEATWDTTIRVNAKSVFLGCKYALTQMLAQEPHSSGDRGWIINISSIMGM
FT                   IGGPENPSYCASKGAVSNLTRQMALDYAPDNIHINAICPGYTQTAIFKETTTNLTSWED
FT                   LKRRHPLKGPGMPEDIARMAVVLASDDASWVTGVCLPVDGGYTAR"
FT   CDS_pept        join(complement(82774..83337),complement(82361..82721),
FT                   complement(81837..82297),complement(81710..81781))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000198296" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942280"
FT                   /orf_name="Pc14g00350"
FT                   /product="Pc14g00350 protein"
FT                   /function="serine-type carboxypeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP74176.1"
FT                   /db_xref="GO:0004185"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="UniParc:UPI0001831223"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K5"
FT                   /transl_table=1
FT                   /translation="MWKFWLSALISVGHASQTVLRPEPLANFTTFRSTNSLHSIRIRQQ
FT                   DESICAAGSAQYTGWLDIGPKHLFFWYFESQNDPVADPLTLWMNGGPGSSSMMGLFQEN
FT                   GPCLINEHGNGTVRNPWGWSRNSSLLFVDQPADVGWSYIDEGYEVAHDSQEAAVDMHRF
FT                   LQIFVSEIFPHKRFSDFHLSGESYAGKYIPYLGAEIVTRNQLYPSEPQINLKSCLIGNG
FT                   FMSSKDITFGYWETLCTTNPGISTPVFNQTRCDIIAANMPRCMEVYDTCAKGPDLAICT
FT                   AAYSVCYKGIIGLYEDESKKGGRNRFDITAPCYIDEICYKEAAYIEQYLNSPTVREALS
FT                   PPEGAKEYGIQSSAVVDAFATTPEAMTSSSDHIIFLASGVHFLAYQGNLDLACNTAGNL
FT                   RWANSLAWKGQTEFTSKPLLPWTSNVAGRNETVGTAKEVCVQLDGQAEASRFAFVTVNG
FT                   AGHLLPQDRGDVAFDILTRWIAGHSFA"
FT   mat_peptide     join(complement(82774..83292),complement(82361..82721),
FT                   complement(81837..82297),complement(81713..81781))
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K5 "
FT   sig_peptide     complement(83293..83337)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K5 "
FT   CDS_pept        join(84251..84510,84564..85064,85162..85195)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000200256" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942281"
FT                   /orf_name="Pc14g00360"
FT                   /product="Pc14g00360 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP74177.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831224"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K6"
FT                   /transl_table=1
FT                   /translation="MHLILTGATGLVGSSVLDAMLRNTAVSKISILSRSPVRMTEDAKD
FT                   PRVRVITHTDFESYKPELLDQLKDADGCVWALGTSQTNVTEEQYVKITKDYTLAAANAF
FT                   STIKPSNHPFRFIHVSGEGATQSPGRFSPIFARVKGNTEKLLGTLSESKPTFRADSVRP
FT                   AFVDPATHDAIKPYIPSSGATGIVPKLGLALLAPGIRCFVKSMHSPTEDLGSFLTEMAM
FT                   GRYEAKLEGPGAFRLGGGYVIGNSGMRRILELIKKKLTKPHK"
FT   sig_peptide     84251..84304
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K6 "
FT   mat_peptide     join(84305..84510,84564..85064,85162..85192)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K6 "
FT   CDS_pept        join(87106..87361,87410..87511,87564..87685,87735..87818,
FT                   87865..87944,87992..88043,88101..88312,88366..88587,
FT                   88642..88888,88950..89090,89149..89205,89263..89292)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171008" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942282"
FT                   /orf_name="Pc14g00370"
FT                   /product="Pc14g00370 protein"
FT                   /function="carbohydrate binding"
FT                   /function="carbon-oxygen lyase activity, acting on
FT                   polysaccharides"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP74178.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016837"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR015364"
FT                   /db_xref="InterPro:IPR016590"
FT                   /db_xref="UniParc:UPI0001831225"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K7"
FT                   /transl_table=1
FT                   /translation="MFFKSVAIASLALLAKQASAAFGITTSSDSYVIDAGSSNPLNFTV
FT                   SRSSCDITSINYYAAELQYQSTGSHIGSSLGSATVSATQSGDYIKVTCETSTLTHYYVV
FT                   RKGDSTIHMATYTTEEPSIGELRYIARLNADLLPNEEPFGDVSTIAGGTVIEGEDVLTH
FT                   ISSWWMEKLEASSTLVNGLLMTTSTTGVSGSAHRVCMILNQYETSSGGPFQRDINTNNV
FT                   GSYTGLYWYMNSGHVKTEDFRQGLHGPYSMTFSRSGTPSSKLDTSFFADLDIKGYVPTS
FT                   ARGYVKGTASGADSAFKWVVHWHNDAAQYWTYASSSGDFTSPAMKPGTYTMVYYQGEYP
FT                   VATSEVTVTAGKTTSKSISGSVKTGTTIFRIGDWDGTPNGFLNAANQLRMHPSDSRMSS
FT                   WSPATYTVGTSKVSSFPMALFKSVNSPVTIKFTASSDQTGAATLRIGTTLAFASGRPQV
FT                   KVNSYSGPTPAAPTNLNSRGVTRGAYRGLGEVYDVSIPAGTIVAGSNTITISVASGSSG
FT                   DKFLSPNFIFDCVELFQ"
FT   sig_peptide     87106..87165
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K7 "
FT   mat_peptide     join(87166..87361,87410..87511,87564..87685,87735..87818,
FT                   87865..87944,87992..88043,88101..88312,88366..88587,
FT                   88642..88888,88950..89090,89149..89205,89263..89289)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K7 "
FT   CDS_pept        join(complement(90904..91246),complement(89533..90824))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000257692" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976235"
FT                   /orf_name="Pc14g00380"
FT                   /product="Pc14g00380 protein"
FT                   /function="guanine deaminase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP74179.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008892"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="UniParc:UPI0001831226"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K8"
FT                   /transl_table=1
FT                   /translation="MGSITGDMEAQTDYTCTVYRGTFIQTILSDSGSKPELSCNQGALW
FT                   VSAADGRIKGWDWQANNDHGFAELMTRNGWVDIDDIGAQGQVDSHDSKTRVRIVIASEE
FT                   QNEFFFPGFIDTHIHAPQYPNVGLFGSSTLLDWLETYTFPVESRFGSPPDPKTGHQTQT
FT                   DPKDAPLLAQQIYDQVISRTLSHGTTCASYYATNHVPATNALSSLCHTRGQRAFIGRAC
FT                   MDNPKFCVDYYHDFSAEDSIVATRQTIEYIHTLDPEGNLVKPIVTPRFAPSCTRLALQN
FT                   LGELAASYSPPLHVQTHISENVNELALVKELFPEADSYAAVYDKYKLLTPRTILAHAVH
FT                   LSADERALIRAREAKISHCPASNSALGSGICPVRTLLDEGITVGLGTDVSGGYSPSILE
FT                   AARQACLASRLLGQSAAWQRDHSQSVDGKGSDGREKLSVPESLYLATRGGAAVVDMAND
FT                   LGGFDKGMLWDVQLIRLGGVKLGKKSPLDFVPGDGNADLVKTGPVGNVDLFGTESWEEK
FT                   IQKWVWSGDDRNVKALWVGGRLVHSRV"
FT   CDS_pept        complement(92157..95330)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000239369" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670267"
FT                   /orf_name="Pc14g00390"
FT                   /product="Pc14g00390 protein"
FT                   /function="glycine dehydrogenase (decarboxylating) activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="glycine metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP74180.1"
FT                   /db_xref="GO:0004375"
FT                   /db_xref="GO:0006544"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020580"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniParc:UPI0001831227"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5K9"
FT                   /transl_table=1
FT                   /translation="MAASLFALRGARQLALRSRVRVPSITRASLSPLNTRRVVHTSQPA
FT                   TRRGVYTSSISDHGDPHPQDIFQPLDTFPRRHIGPSPDAAAEMLAVLDPPVASLDDFVK
FT                   QVLPEDILSKKDLKVSEPHADISLYRSSVQGGLGETDMLKLLDTYRKQIDISGKTYIGT
FT                   GYYPTIVPPVIQRNVLENPAWYTSYTPYQPEISQGRLESLLNFQTLTADLTGMPFANAS
FT                   VLDEATAAAEAMTMSFATMPASKQKRADKSFVVSHLCHPQTIAVMKSRAEGFGINLVIG
FT                   DILADDFKLVKDQKDHLIGVLAQYPDTEGGIYDFQALGDSIHGQGGTFSVATDLLALTV
FT                   LKAPGEFGADIAFGSAQRLGVPMGFGGPHAAFFACADKYKRKVPGRVVGVSKDRLGNRA
FT                   LRLALQTREQHIRREKATSNICTAQALLANMTAMYAIYHGPVGLKSIAQRIMSMTSLLR
FT                   EKLVGLGYNVPVRSNSADGGAVFDTLAIELPSAAEADAIMAEARAASVFLRRLGGNKVG
FT                   LSLDETVGRDEVKGILDVFAAHKSASPVEVDGTLGLTTVPASLERTSSYLTHPVFNTYH
FT                   SETEMLRYIHHLESKDLSLAHSMIPLGSCTMKLNATTEMIPVSWPEFSKIHPFMPADQA
FT                   KGYTKMIDDLEQQLADITGMAEVTVQPNSGAQGEFAGLRVIKKYFEARGDAKRNLCLIP
FT                   VSAHGTNPASAAMAGMRVVTVKCDTKTGNLDLEDLKAKCEKHKDELAAFMITYPSTFGV
FT                   FEPGAKEACRLVHQHGGQVYMDGANMNAQIGLCSPGEIGADVCHLNLHKTFCIPHGGGG
FT                   PGVGPIGVGEHLRPFLPSHPTSEYLQSKRGDTSSPPISAAPWGSASILPITFNYINMMG
FT                   DRGLTHATKITLLNANYILSRLKPYYSILYTNDHGRCAHEFILDVRAFKDTCGVEAIDI
FT                   AKRLQDYGFHAPTMSWPVANTLMIEPTESENKAELDRFCDALISIRKEISEVESGAQPR
FT                   EGNVLKMSPHTQRDLLVAEWDRPYTREQAAYPLPLLLEKKMWPTVTRVDDAFGDQNLFC
FT                   TCGPVEDSE"
FT   CDS_pept        join(complement(97449..97672),complement(97353..97392),
FT                   complement(97169..97297),complement(97000..97117),
FT                   complement(96795..96940),complement(96526..96743),
FT                   complement(96016..96477),complement(95847..95957),
FT                   complement(95597..95750))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157494" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942283"
FT                   /orf_name="Pc14g00400"
FT                   /product="Pc14g00400 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP74181.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831228"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5L0"
FT                   /transl_table=1
FT                   /translation="MASMTPIDEKPPAEDRVEDIAGKRPPSYVEDDEFTPQEQKKIIRR
FT                   IDLRLVTMTGLAYCISLMDRTNLSMAAVAGLKEELHLHVGERYSIIVLMFFVPYIIFQP
FT                   PMTVIIRKIGPTYFLSSIIVCWAGIMIGMGFVQDWGSLMGTRVLLGVLEAGYFPGCVYL
FT                   LSCWYTRYDVQKRFSVFYLIGCVASALAGILAFGLMQLHGREGLTGWRWIFILEGVITG
FT                   VIGIMCYFFLVDFPDRAHKSWRFLNQRECAWVVRRINEDRNDGDMEAFSLKKFLKPSMD
FT                   AKIWGFAMIFFCLTTVTYAIAYFLPIILMNGMGFGVGEAQCLVAPPYGFAGIVMYGTAW
FT                   VGDKYRMRAPILIFNALLAIIGLPMMGFAKSDAVRYVGVFFTVAGANANIPSCMAYQAN
FT                   NVRGQWTRAFSSATLVGFGGLGGIVSSLVFREKDAPEYRPGIYAALACNILIVLLVLAL
FT                   SAWFRFCNKQADRGKRVIEGDAAFRNRMKAQSYDAIGAWSPPSSLPGGIRGVDMPRHDF
FT                   SDGKPAICSDWKAVSG"
FT   CDS_pept        join(complement(100679..100874),complement(100467..100629),
FT                   complement(99353..100414),complement(98975..99296))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171019" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976236"
FT                   /orf_name="Pc14g00410"
FT                   /product="Pc14g00410 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP74182.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0001831229"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5L1"
FT                   /transl_table=1
FT                   /translation="MSLVQHVSAIDGIDRELEPDLVEDYDFAPIRRKISYDVIQPSDAI
FT                   PVAETRPGTPAYKHSSAKRIAQVVVTVLACWSASGIVFGFAALKPVLVEEGVYHGHCTP
FT                   AEIDEGLELCSQQDLRLNLFFTIASITANVSALPVGTILDRYGSRVCWFISCLLLAVGG
FT                   VIMAFAFREPGFDGYIAGNFFLALAGTFLFVPSFQIANAFPRYAGTIVALVTGAFDASA
FT                   AVFLFYRLVYEASGKSFTPDKFFLGYLIVPACVFIALVTIMPARDYVSTLQLENKMERA
FT                   EDATRDVHDSDDEIESTAELNQVRKKRAERRQKKIRQIDEVLGDRDERQMRADREEDRQ
FT                   QTSWVWGVLHGLPAHRQMATPWFILITLMTVLQMIRMNYFIATVRSQYEYMLGSAQKAD
FT                   KIGALFDVALPVAGVLFTPVIGFLLDRLSVPTMLGIIVLFTTVIGVLNSIPAVWAGYVT
FT                   VLLFVLLRPLYYSAMSDYTTKVFGFATFGRVYGAIICLSGIANFSQYGLDALTHNKFDG
FT                   NPIPINVILAVAGFVVGTALVIFVFVSVRQMGGQDRVDEEERESLLLEEDEEEEGYEDN
FT                   GSYR"
FT   CDS_pept        101281..102925
FT                   /pseudo
FT                   /gene_family="HOG000200306" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(104823..104987),complement(103313..104758))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000239129" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942284"
FT                   /orf_name="Pc14g00430"
FT                   /product="Pc14g00430 protein"
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP74184.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183122A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5L2"
FT                   /transl_table=1
FT                   /translation="MTRSIEEQPDHQPHQVSTTTEKPSEIKEDETHLPTGARLIAIIIS
FT                   ILFAMFLVALDRTILATAVPRIANRFNALDDLSWYASAYLLTSCATQLSWGKVYTFYST
FT                   KTVFLIAILIFEVGSAICGGAPNSKAFILGRAIAGIGSAGIFSGATVIIAQIVPLAKRP
FT                   IFVGLMGSVFGISSIIGPLMGGAFTDNVTWRWCFYINLPVGGFTMVVLFIFLAVPHNPQ
FT                   PCTWKRKILRLDPLGSVFFLPSVICFLLALQWGGTAYPWSNGRIIALFVIAGILMIAFV
FT                   GVQIRLKKDATVPPHIFNQRSIISGVVYALCVGGGLISMLYTLPLWFQGVRGTSAVNSG
FT                   IDTIPMVLALVVGSILSGSIITATGYYVPWMFVAAILMSTGAGLMTTFQVDTNHAAWIG
FT                   YQVLFGIGIGTGMQQPSMAAQTILPMDEVSIGISLMFFAQSLGGAVFIAVAQSLFQNYL
FT                   GANLLHIQGIDVTKILAAGATGLSGAVPAAKLAQVLTLYNDGLRHSFIVAVAVSCLMIV
FT                   PALTMEWRSIKKGKSSATV"
FT   CDS_pept        join(105382..105535,105945..106294)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942285"
FT                   /orf_name="Pc14g00440"
FT                   /product="Putative uncharacterized protein Pc14g00440 "
FT                   /protein_id="CAP74185.1"
FT                   /db_xref="UniParc:UPI000183122B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5L3"
FT                   /transl_table=1
FT                   /translation="MSKDHLDVLKESQWEIHRKFPIPEHILVPSTEVENKTFSKFPWLS
FT                   SCYQRGDTLFRAQLDEVPYVGCESYVRGCDIFVNPWIIPELQSTIQLAQNMVGKRKSSY
FT                   LNRLPLEISLLVAEIICPIIYTQSDVQKIRNMLSVLALNLPDAFWRSRLQSKRDLFFEV
FT                   DLLD"
FT   CDS_pept        join(106950..107199,107268..107705,107758..108599)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171032" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942286"
FT                   /orf_name="Pc14g00450"
FT                   /product="Pc14g00450 protein"
FT                   /protein_id="CAP74186.1"
FT                   /db_xref="UniParc:UPI00018312FB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5L4"
FT                   /transl_table=1
FT                   /translation="MANISISAPGLSSGGFLYNNGNNNARLCVTAETEDFDMEIIKNWQ
FT                   EEGFDVVYLPYNGGGKDYARRLQSVKDGLGVGENYAVVAYGDAADYCLDYYINSVNSSR
FT                   LCALVAYYPSLIPDTRSRFPLSLQVLVHLAGETVDVLVQPAALGLQGKKRRQTRPINAG
FT                   IGTGERLDLAYPAFTYDNAVPGFAETDLEEYDHRAADLAWTRTLKVLRKGYSRDPDYEQ
FT                   RYEQHVEGKFFSSNVRKTMDGYVQHKTPGVTYTPTVSGGIGKKALRHFYEQYFIGKLPP
FT                   SMRLRLLSRTTGPDRIVDELYVGYEHTQEIPWMLPGVPPTNKRVEIILVSIVSMRAGRL
FT                   YSEHVYWDQASVLVQVGLLDPKLLPDGVQGVDRLPVVGREAARRILHEDTELEQEDYHN
FT                   KMIRRARARARRSMNQSSRASQAGEEPGLDLKSDVEQSLPDRSRNKGKAVQKTKPASLQ
FT                   RTATETAEHVDGDGADTETEFSAKARSDTGNQAAYVEDAGNDSAENGSKQT"
FT   CDS_pept        join(109692..110474,110543..111937)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076622" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942287"
FT                   /orf_name="Pc14g00460"
FT                   /product="Pc14g00460 protein"
FT                   /protein_id="CAP74187.1"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI00018312FC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5M9"
FT                   /transl_table=1
FT                   /translation="MEETVAELRRQLEEVRRAREEEKRAREEAERRGEEQRQAREKAEG
FT                   RVQHNTLLGLLDRCHISLSQAIQVETDAALTTQGDATDPVNRLYPKRITPWCEFPDLQE
FT                   KIWKKFDRIGTFTSRPLFPSNEQLDYVATNIQARPIYSEASIRNFERETVDIFVEKVIE
FT                   ALRDDETLRREFGIKGRVTCYDGAETSLENSMEQMTLQNARSPEPLANTRHGRKATQNP
FT                   RTPSTPQKRNRRANQFCVHTVANERKEPVYAVEFKAPHKEGDTFEYHSTRLVAAVVTQI
FT                   FSYMIDSGLQYGYICTGEAFVFLRIPEDPTVVQYYLCVPNQDVQANDQYRLHRTAVGQV
FT                   LAFTLQALAAKAPSQKWHDTAHDKLSTWKVEYLDILREIPETVRTQGRPTSNYRPSHWK
FT                   FEPKRHNTRSRARCQPGNSTPKHSSTEDSGSVEEHHSPSTAAAARSQASREKSSHDRSN
FT                   KQRPGDRRGRTEAEPNSQKNYQVTRAYCTIDCIRGIVNRGPLDKECPNLQSHLQHSSSH
FT                   RHSIGPSEFTRRLHCQLVRNRNEGFEQLHVRGRTGYLVKATLLTHGYTVVMKATTAEKQ
FT                   HRLQVEVENYNRLRNLQGQQIPVCLGAFKPSISYWYHGELMAQIMILGWSGMRLQHVIN
FT                   KENSSFFDQERKKVLAVLQSHGIIHGDSEWRNMLWDDAGCRLVVIDLEDMKWLKRPRAL
FT                   EPASGNTRHVHRVRDEKSRQNLLSSSAGVRT"
FT   CDS_pept        join(complement(114353..114678),complement(113394..114285))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184411" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823013"
FT                   /orf_name="Pc14g00470"
FT                   /product="Pc14g00470 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP74188.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR006353"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00018312FD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5N0"
FT                   /transl_table=1
FT                   /translation="MAAPTASVRRLSSADAKRCDLYSGPTVIAPPENMKAPCDANGTAT
FT                   RLERARKSIDETASDRATPEVEQPDPSSTDKFAIAFDIDGVLLKGGKALPESIGAMKYI
FT                   NGDNPPYIFVTNGGGKTEEERCIDLSRQLQMEVSPGQFICGHTPMREMAEAYQTVLVVG
FT                   GEGEKCRVVAEDYGFKDVVTPGDIIKSKHDTTPFRKLTEEEYRNSRDRNFDETTIDAIF
FT                   VFADSRDWAGDQQIILDLLMSKNGRLGTRSETFDEGPPIYFSHNDIVWSTSHEHSRLGM
FT                   GALRTSIEALYKELTGKELTTVAFGKPHLGTFGFATRLLREWRKGTYGIDQPPATVYFV
FT                   GDTPESDIRGTNEYNQISDTDWFSILVKTGVYQDNKTPQYPPRKVCEDVLEAVKFAVQR
FT                   ELGEDA"
FT   CDS_pept        join(115411..115503,115673..116890)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177819" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942288"
FT                   /orf_name="Pc14g00480"
FT                   /product="Pc14g00480 protein"
FT                   /protein_id="CAP74189.1"
FT                   /db_xref="UniParc:UPI00018312FE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5N1"
FT                   /transl_table=1
FT                   /translation="MTLTFCYMNTAVNYDLIVHEIVADLGMSGVKWVKDGVQHSLTLAL
FT                   ANMVRRHSRFQTGRRPRGYPGFKLDETHVTGPVSFLNPTSAHYEPSQQAEDIQAPPQIE
FT                   RLWRSRDNRKGRHAIRVDTEALPHVTRLTTPPLTQSVSAVAKIMLRMVTYVPYWDVSYL
FT                   VAMSFTIGSAVFIVNGFFVWLPLVDRKTEFHGEITIAGGWTGFVGATIFELGGVLLLLE
FT                   AFNTNHTGCFGWALESVLEKTIEDGVPQHAMKEIKPRMSECEHHHANRKSFLREKHHHT
FT                   SNNVHSHLDDTGYVTSSPDGRSFRWIPSKSELCTHYFHEIGFIASFVLFVSATVFWIGA
FT                   IVGIPAIFTRISQGLIDGLYWGTTTLGGTGFIVSSLLYMLETQSKWYIPAWHVLGWHIG
FT                   LWNLLAVLGLLFVVRWARQVATLARIISRPSLHFGAH"
FT   CDS_pept        join(complement(119615..119803),complement(119495..119570),
FT                   complement(119261..119443),complement(118720..119187),
FT                   complement(118012..118670))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942289"
FT                   /orf_name="Pc14g00490"
FT                   /product="Pc14g00490 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP74190.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018312FF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5N2"
FT                   /transl_table=1
FT                   /translation="MVRRPPAKWLIFSIAPCTASFIPRIVILTSTPSCALGMEGVDPFR
FT                   SLSRLAVLWLLSCLVMTKFGYPNDSEEGIIVSCYNLGCLLGCLINFCIGETLGRRRAIW
FT                   LAMGVVIVGAILQTTAFNVPHLIIGRIVTGAGTGLKTSTVPMYQAEMCEGKTRGRLISS
FT                   EVLFTAVGIVVAYWFDFGMSFVSGPIAWRLPIAMQMVFAIFVIVLVFGLPESPRWLMNH
FT                   GQEQEAMDVLCAVYDREPEDEFIVNEHKGIVSAIELEDSVSKQSFWKIFRNDEVKTGQR
FT                   VLLAWGIQLMNQVGGINLVVYFVPTVLRTNVGLTSQLSLILGGCIQIMFMLGSLLPAFK
FT                   LDSMGRRKTMMIGSLGLGICMMMVAALLSQVNEPSGKTYAEASVAFFFLYMLIHGMSIN
FT                   SVPWVYVPEILPLEARTKGTAIGVSSNWLWNFTVVMITPVIINRIQWKAYLIFMITNFL
FT                   FVPVIYFYYPETSNLRLEDIDLIFARGGDPVDQARKMAAEIKAYGHIQVEQHDDDKVAS
FT                   SVGVERV"
FT   mat_peptide     join(complement(119615..119746),complement(119495..119570),
FT                   complement(119261..119443),complement(118720..119187),
FT                   complement(118015..118670))
FT                   /db_xref="UniProtKB/TrEMBL:B6H5N2 "
FT   sig_peptide     complement(119747..119803)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5N2 "
FT   CDS_pept        complement(120662..124732)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217239" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127313"
FT                   /orf_name="Pc14g00500"
FT                   /product="Pc14g00500 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP74191.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniParc:UPI0001831300"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5N3"
FT                   /transl_table=1
FT                   /translation="MREVTEKGYQLGVDVGGTFTDVYVFTPHGQTVRAKVPTTIPDQSI
FT                   GIQQGIAKARELVHQQFGWSGTFQFIHHGTTTATNAVLEGKGARTALIVTAGHKDILAL
FT                   RRSQIPGGLGAWLHWTPPDPIVPLERVVQCKERMSVQGETVTPVDVENLRQSLKELARQ
FT                   KPEAVAISLLNSHSNEAHERVVAQTVREELGAGIAIICSTDVLREVGEYERTVTTCTNT
FT                   LVKPVVEKYLHNLSEALATESEAIRVLKSDGGLTSLTLASELPVNILMSGPAGGVKGVA
FT                   DVVARSTPYKNLITLDMGGTSTDCALIYNGQPQLRRETVVESLSVRAPAVDIKTVGAGG
FT                   GSITTYMELTETLRVGPESAGASPGPASYGKGGKQATVTDANLVLGYLPKTLLGGEFAL
FT                   DVQAAITAVEDIANQMKLPVIQTAEDIITIINETMYGALRLVSVEQGYDPREFALVAFG
FT                   GAGPLHANAVGQLLGAWPVIIPPSPGILCAQGDVTTKLRHEQSATFIRIVSGTTVAEAR
FT                   EQYQTLEQECRDTLSRTAGDLWPLSWKTAYQADLRYKGQALMITIDLTEEDLALTTDKW
FT                   HDVLRQKFDQQHQQMFTYCLPDFELELMRLGVVLEDASPGIDIPQVGKATIPPSDAKIG
FT                   EQNIIVQGEEKLATLWDRHKISKQGIQVMGPCIISEMDSNTLILPGYYGEIDSIGNILI
FT                   NPLERKPTAATTYTAESAKELVKGTPLIPTLISSTLASIRGEMDKMMLRCSMSPAIREQ
FT                   QDEFNVITDSEGKMLVGQFGSFITQFLDVWDGTIEEGDVFITNDTYQVQGAISHLNDII
FT                   AFLPIFHDGQIIGFASQFGHLTDVGGIVPGSMSINATSVFDDGVQIPCIKLYTGGVMNT
FT                   DLVDLLCRNSRQPAWYRSDLTAIVASCSMAATRVRELATRFGTEVYLAACSELLYRNRT
FT                   GFAKIIERQFDDLESKFTDFVDDDGHGVGPWALTCSMKRVEGNRLQFDWSGTSPQSERS
FT                   INFYLSETMFRMFIGYYLIAAAAPGTVINDGFHDLIDVHIPRGSVLKPVRPAPISCRTH
FT                   FLGRTLDIVQALIGQKQDSYQAAAGFSDSPHFFYSGFKPDGEWYQLYQIGFGGVPARQA
FT                   GDGPDCHCLFPAIKSIPTEIIELNYPLRIEANESVADSGGAGFYRGGNAQRTLYRFLAR
FT                   GEFSLHDDRWFTKPWGLKGGKPGQRSRKMLYRFSKSEDSPPTEILPSKCDHIRVDPGDL
FT                   LEWVTWGGGGLGDPLTRPAEKVALEVHRKLVTVEGARIAYGTVVNDDFTVDEAETEALR
FT                   AQMRMERSQLSESSIYDRGGSLEHLRETCLQETGLDAPLPQWETEIYGPHAGLEYVQDW
FT                   FNGMRSRKGWELN"
FT   CDS_pept        125855..126739
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942290"
FT                   /orf_name="Pc14g00510"
FT                   /product="Pc14g00510 protein"
FT                   /protein_id="CAP74192.1"
FT                   /db_xref="UniParc:UPI0001831301"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5N4"
FT                   /transl_table=1
FT                   /translation="MRSLTTSFISLSLLSGTVHAESIARVWTHFYPNCPGEAFSNLDTY
FT                   EKYHVSGPSQNITQGSCKSFSVPSYEKNLVDAISVDAELLSNDHDLPFLSGGSGCNITV
FT                   HEVPECIDPPLISKEIRDGVAISQCASRQFVAYSQVWVNLVCDSDSPLHNENIPTHGAK
FT                   ENNKQADTHQSIPTSQPDAPVRAEKHTTVEDIKNIQMPGSNSDSWRASQATHSQREPVQ
FT                   EGRVNQAGHAQSDQIVHHIMQLLKNKTSHIVTGKHHAHSNVTLHHNGTAPGNSTVMTRR
FT                   RLSVLRNRAARLV"
FT   sig_peptide     125855..125914
FT                   /db_xref="UniProtKB/TrEMBL:B6H5N4 "
FT   mat_peptide     125915..126736
FT                   /db_xref="UniProtKB/TrEMBL:B6H5N4 "
FT   CDS_pept        join(complement(128319..128710),complement(127804..128268),
FT                   complement(127616..127757),complement(127174..127563))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178084" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127314"
FT                   /orf_name="Pc14g00520"
FT                   /product="Pc14g00520 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP74193.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831302"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5N5"
FT                   /transl_table=1
FT                   /translation="MENQSRPARYMAHVFEELGLTTMWRSSLDVKLLCAQRFVRLFAYG
FT                   GSTLILASYLSAMGISDDRIGLFMTLTLVGDVVISFFLTLFADAMGRKAVLSLGSVLMA
FT                   GSGVIFALFGNFWILLAAAVFGVISPSGNEIGPFRAVEESTLAHLTPHELLSDVFAWYS
FT                   LIGNAGSATGMLVCGWIINSLESIHGWAFIPACRIIFFVYAGVGVVKLILTLGLSGKVE
FT                   VQKEEPQEQSSETRPLLSEPVEQDVEPATKKGLFPSIEKDLWSLVIRLFILFGVDSFAS
FT                   GLASLSWMTYFFKGKFNLPSGGLGTMFFTTNIISAASMLVASSLAKRIGNVKTMVFTHL
FT                   PSAICLALISVPSSLPLALTFLILRACTQNMDVAPRSAFLAAALPADKRTAIMGAVNVV
FT                   KTTAQSMGPLLTGILSSNGHFGVSFIIAGCLKVTYDLGMLFSFAGKEAARRKQAAQDAD
FT                   EETS"
FT   CDS_pept        join(complement(130521..130653),complement(129634..130470),
FT                   complement(128897..129585))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161766" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942291"
FT                   /orf_name="Pc14g00530"
FT                   /product="Pc14g00530 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="CAP74194.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="UniParc:UPI0001831303"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5N6"
FT                   /transl_table=1
FT                   /translation="MVAKHFYLLGEAITSARPIEVETTVDYQGLQLLIAGQFAIVEPNG
FT                   IGFQSEDSVLSTTSEILANEEPIAISIDGKAVREIPGPKGLPFVGNFFEVYPDHLGNHQ
FT                   RLFDQYGPIIQTTNMGRTVYHTNDPELSAIVFSESDFFTKKINEAHPLHPIKNQQAGVF
FT                   LGDTDTPEWRAAHKFLPPALGPKAVRHYAPTMQETVEDAFNVFDELDERGEAWNVYPYM
FT                   LKLGAQAVGKLVLGMDFKHFSTVDAPPHELVYRIAESLELNKKVTARGDWYAKLPFGDP
FT                   KRLRHARDRIVEMVNESIQNASRNGVEDLPLQDAALQASNMIDYIIRATDNKGEKLPKT
FT                   SLMEALVVATGAGFTTTSSLLSWLLYSLVNYPGMQERLLQELIDNDIDADTPMTADLTD
FT                   RLTFLDKFIKETQRRHNPSYQPARTAKVDMILPGGYKLPEDSIVIPALHHIHNNPAVWS
FT                   NPARFDPDRWDTAEVKDRHKSAYIPFATGPRMCIGFNFALQEVKVFLPKLLYRYKFTKE
FT                   NDGPVEYDPMFQLIRPTNLYVRAERRVKWPPKTEQ"
FT   CDS_pept        join(131231..131360,131418..132715)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942292"
FT                   /orf_name="Pc14g00540"
FT                   /product="Pc14g00540 protein"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP74195.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI0001831304"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5N7"
FT                   /transl_table=1
FT                   /translation="MSVPETKELKAEWKADVELPEYTLKDVAAHNTKGDTWMVIHGQVF
FT                   DLTTYLQDHPGGAEALIEVAGTDATAAYEDVGHSEDAREIMQPFLVGTLKDAQQYVRPK
FT                   AVRVVSQKAPVEAGSSSSTIKTIACALGGLIPVFYVFSKSNNLTTNLGAISQLIPHQLK
FT                   SLRLPHGGFVNGFLAASAISTAVGVVVARQAGKFTKIDSGFMRYPPRIKSKKVIRADPH
FT                   LTHGFLEPQQYQRLPLVEKTELATNVYRFVFALPTATDVLGLPIGQHVAIRAVVDGTTV
FT                   TRSYTPTSNNIDRGRIELVIKCYPDGLLSGKYLAGLTVGDEVEFRGPKGSMRYTKGLCR
FT                   KIGMVAGGTGITPMYQLIRAICENDTDTTEVSLVYANRSEADILLREELERFARQYPKN
FT                   FKLWYMLDSAPEGWTYGSGYVDQAVLAEQLPAASPDTKVMLCGPPGMVNATKKNLVALG
FT                   FTKPGAVAKMTDQIFCF"
FT   CDS_pept        complement(133022..133690)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942293"
FT                   /orf_name="Pc14g00550"
FT                   /product="Putative uncharacterized protein Pc14g00550 "
FT                   /protein_id="CAP74196.1"
FT                   /db_xref="UniParc:UPI0001831305"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5N8"
FT                   /transl_table=1
FT                   /translation="MAPAIREVTQTLIVADTTFVSVITLGHTKPWPTLNLATLTATTPF
FT                   TTVIHVVDRAATPPPKQIRSARSTGLSNGNKGAIAGSILGVGALLLLLYYLYLCHLQSR
FT                   PLTPRSAKVPLDPEDPTPAPEPVSTDNAPSKNKKSVTISSDLPRYLPRYYGSKDIKSII
FT                   TPIVRMSAEVDLKTRFETREGRLGQRVRYMIRKRKKPRVKKRRRRRRRRKRKATKDDAN
FT                   "
FT   CDS_pept        join(complement(134994..135152),complement(134261..134941))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178062" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942294"
FT                   /orf_name="Pc14g00560"
FT                   /product="Pc14g00560 protein"
FT                   /protein_id="CAP74197.1"
FT                   /db_xref="UniParc:UPI0001831306"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5N9"
FT                   /transl_table=1
FT                   /translation="MSRLSISLKALINAPAARPSTVPAPANITSVYQKIQETAQSKKIS
FT                   QPSWVALSTAATMTMNSPESLAALYELASTNPDKQVETAELMREVGLKCISFNGIPRTI
FT                   NCLNAFRASLPDSVGSQLSRTPTRAPTPENISAISDRGHALWDSIYRPFEKKLYNKLAD
FT                   SHPDLPVHILHSNYGALLSDPERSTGVSAGRILTSIIAISCLRAQSGVGPQVISHVFGL
FT                   RKALEDGSWVNDVEGEEAAQWLASDEGNTWILNSVDAIVEAISQGAGSNFAPARAKL"
FT   CDS_pept        join(135594..135718,135768..135923,135974..136148,
FT                   136207..136300,136349..136434,136491..136621,
FT                   136671..136800,136851..136947,137005..137274,
FT                   137338..137422,137472..137589)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942295"
FT                   /orf_name="Pc14g00570"
FT                   /product="Pc14g00570 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP74198.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018313D6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5P0"
FT                   /transl_table=1
FT                   /translation="MDPPKSRVLELEEAKKAPLDQYGDLSHQQKLTRKILWKLDIHILP
FT                   ILALLFLMSFLDRTNVGNAKIIGLEADLSITDHQYNVGLAVFYLTYICSELPSNLVLKK
FT                   ASPKIWLPFLTGIWGIITMCLGFVQNFAGFVAVRALLGIAEGGLLPGMVLYLSSFYKRG
FT                   DLALRIGLFYTAASLSGAFGGLLARGLAEIGPRGGIEGWRWILIIEGLLTFVCGVLSFF
FT                   ALPNSLQSASFLTAEEKQFGEKRLMLDSPGSLEGSLASEAESFKWSEVRRGVLDLQVWL
FT                   SASAYFAILSGLYSFGLFLPTIIKDLGFAKDANEVQLWSVIPYAVAAVLTVFVAIVSDR
FT                   LRLRGVVMLFTLPIAIIGYAAIANIDSPRVQYGMTFLMATGQYASVPCILVWLSNNSAG
FT                   HYKRATTSALQLAIANAGGFVSTFNYPSRDGPLFHRGHTIVLGLLVFAWFMILLNVLYC
FT                   AKINRDKRKGKYDQYAGYNDDRNPEFMMVL"
FT   CDS_pept        join(complement(138797..138933),complement(137720..138695))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167573" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942296"
FT                   /orf_name="Pc14g00580"
FT                   /product="Pc14g00580 protein"
FT                   /function="phosphoric diester hydrolase activity "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP74199.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008081"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniParc:UPI00018313D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5L9"
FT                   /transl_table=1
FT                   /translation="MLVSNNQTRLSFWKCSHLDCIAYPGSKRAMFCRAVQRPLWALIFI
FT                   IGILTVAWQCFLYLFPCELELVNFPSERSSSSSDWSTYGVIPIPCHSHNDYWRHVPLRS
FT                   ALRAGCISFEVDVWPWGNEILVGHSASTVLRGTLQSLYLDPLLKMLDTHNEPPSRNWPK
FT                   VMGQEMVGLFSNDPKQSLTLLVDCKTEGGRTWPLLVERLNPFREKGYLTHFNGSDVVYG
FT                   PITVVASGDAPLHLLLENTTYRDVFYDAPLDNLTFPAEITADDYKSMDSTYNPSNSYYA
FT                   SADFRTAIGSLSLSRLSNVQLAILRSQVRAAHKLGLKVRYWGTPTWPVGLRNHVWHVLV
FT                   HEGVDVVNTDDLRGATRQDWKPHHWWQWWV"
FT   CDS_pept        join(complement(141979..142255),complement(141644..141924),
FT                   complement(141407..141579),complement(140977..141355),
FT                   complement(140890..140921),complement(140500..140839),
FT                   complement(140315..140449))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000221244" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15942297"
FT                   /orf_name="Pc14g00590"
FT                   /product="Pc14g00590 protein"
FT                   /function="CoA-transferase activity"
FT                   /biological_process="ketone body catabolic process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAP74200.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0008410"
FT                   /db_xref="GO:0046952"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="UniParc:UPI00018313D8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5M0"
FT                   /transl_table=1
FT                   /translation="MTALRISTTLSRKALTACRPRLFLGVRTSVRPWQPFSTSTSTRYS
FT                   ITTPLKSLAPKVERSGSKLYKDADAAVADIKSGSTILSSGFGLCGVAETLINAMHRRGA
FT                   DQLHSLTAVSNNAGAAGKGGLSTLSQNGQINRLILSYLGNNKALEKKYLTGHIAIELCP
FT                   QGTLAERLRAGGAGIPAFFTPTGEGKIPVRMDESGKVLESGKPRETREFNGKTYLMEEA
FT                   LTGDVAILRAWKADEAGNCVFRYTTKAFGPIMAKAATLTIVEAENIVPIGSIDPNDVDL
FT                   PGIFVDRIVPATDDKHIEIRKLRSGETTVAGSGKDEARIQRELIGRRAAKELKPGFYVN
FT                   LGVGIPTLAPSFLPKDVKVWIQSENGILGMGDYPTEQELDPDIINAGKETVTLVPGAAT
FT                   FDSSESFGMIRGGHVDVSILGALQVSANGDLANYMIPGKVFKGMGGAMDLISNPEKTKI
FT                   VVATSHVAKDGSPKIVQKCSLPLTGANVVSTIITDLCVFQVDRATGELTLTELAPGVEV
FT                   EEVQSKTDAKFTIADTLEIME"
FT   CDS_pept        join(complement(145174..145361),complement(144623..145120),
FT                   complement(144061..144567),complement(143852..143990),
FT                   complement(143694..143770),complement(143568..143641),
FT                   complement(142837..143519))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217773" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976237"
FT                   /orf_name="Pc14g00600"
FT                   /product="Pc14g00600 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP74201.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00018313D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5M1"
FT                   /transl_table=1
FT                   /translation="MEVESAGSASSPHGKQAACLNCRRSKIRCNRLAGESSCEKCKQTN
FT                   AECIVPNHHLGRQKGVKNKRKGLEKAIHQIEQAIKRPKVDSSDDEAQRAISVLQELLGQ
FT                   AQGQLIQNEHGHKRGVSEASDHPRMTSPRDIHAEESLTLDDAENPLQLLARASDLQLSP
FT                   TGMRRAPKSPVPLSEGPSFMQSTSQGEPGAKSFFVPTRANLDIGPEVDPIELGLVTFDE
FT                   SESLFSFFYQNLAHTRWGLDPLVHTPYFVRSQSAFLFTSIMAGAALFLPSAAALSKRLS
FT                   RHCKCLAKRVITHRHKSVEIVLAFMANVPWMSPGDRLGDDDTCSYIAMALTVALDLSLN
FT                   KIVSPSSSFDPELMNRLARAECIDAKRALHMDGFDDVDPSSEWGLRLLRRRERAWIALV
FT                   CLARGRSYTVPPTTLIENCDRWHLSTIADPRDGPMNSMAVLRRDLDGLFQKVKSSCDSY
FT                   RIVDTGSEAAQSIKKTIQTFYERWYATWALAIGEGDTRSLPPYVEILVTHTQLSTYGGV
FT                   INHPTAPIEVKRFFRAAGLSSALNVLRAAIQGESRLKSMPNNTVIMISFAACSALSLSI
FT                   TPGDSNSSLAPSVRNLIEETAGVLERIGATPSHRNGASVLYGRFLRELIRRAPALPLQS
FT                   RGNLGKVDPPEPVFTSTCLDNGPLPVTLPPEDLWFEPLHFSAMSDNQIVDAVNRAGTAF
FT                   GASIPDVPLDDMLNWDWLDFANPDFNF"
FT   tRNA            145480..145552
FT                   /gene_name="tRNA-Lys (CTT)"
FT   CDS_pept        complement(146444..147775)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178051" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670268"
FT                   /orf_name="Pc14g00610"
FT                   /product="Pc14g00610 protein"
FT                   /protein_id="CAP74202.1"
FT                   /db_xref="UniParc:UPI00018313DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5M2"
FT                   /transl_table=1
FT                   /translation="MAPSHSFILFLSFVLSPFVQAAPWIVTDTYEQEVNTDYYSDLVTE
FT                   IHQISPTATLPAEALSTATSTDTVYDYTVVQKLYPTGYGEERGLYDSYGYGYYNTMDDD
FT                   GNYHSTVYKVNLTYSAPTACSTQWTTTTAVAVTPPYEIATLLPRDHVTTSTSVDSSEPF
FT                   QSTTYIYEVVFVEPTQIPSRTLSSLSSYNTPTSRYLGARCQYTDSDYNGNSGYYTGLSD
FT                   GPGNGDGSSNGYYYGYGYYDDDNWFTSKWGSGLGISYLAIVLICALGWIGIIFILGMIE
FT                   AWVRFRRLMTGWQTRRGLPLFWSFIWLPLSLFCLFCFRKGYRARSKEDAEILQKRWDAM
FT                   SFWTKLRLFFAWGFRFKYPTVLGPAPALVKASKRPDQSGPRLLDATPPSTGMPSRAASA
FT                   EGVPAAGPEMSQVPASQAQPHAASQASGALPAGRDEETGPVRYA"
FT   mat_peptide     complement(146447..147712)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5M2 "
FT   sig_peptide     complement(147713..147775)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5M2 "
FT   CDS_pept        join(complement(149006..149050),complement(148334..148918))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178040" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823014"
FT                   /orf_name="Pc14g00620"
FT                   /product="Pc14g00620 protein"
FT                   /biological_process="protein transport"
FT                   /protein_id="CAP74203.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI00018313DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5M3"
FT                   /transl_table=1
FT                   /translation="MVRKDPIFEARTNVKLHSNRLKKEAVRAEATFKSEKAKADKAMKN
FT                   REFQIARIHAASAVREKRRQVTLKSEAARADVIINELKAAQSTRDTSRTLALASRGLDA
FT                   ASRSVNLEHLVSHANNFLARSEDFKIASSAIEDVAQGVSMQEYGAEGEADVDRLMEQLA
FT                   DDAGVDMRMNLEADAVPKEEVKEPKQVDPEVEDGLGARLRALRAAN"
FT   CDS_pept        join(complement(150507..150709),complement(149997..150451),
FT                   complement(149621..149910))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234449" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823015"
FT                   /orf_name="Pc14g00630"
FT                   /product="Pc14g00630 protein"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP74204.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011700"
FT                   /db_xref="UniParc:UPI00018313DC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5M4"
FT                   /transl_table=1
FT                   /translation="MADTINPLDTLPTSPSPEMYTVSPADTSLESPEPEDDVKVEDDEK
FT                   KPTKKRKSWGQELPTPKTNLPPRKRAKTDDEKEQRRIERVLRNRAAAQTSRERKRLEME
FT                   KLETEKIRMEQQNQFLIQRLSQMETENNRLSQQVAKLSAEVRGSRSVTPKASSPAVESP
FT                   TLTPTLFKQEGDELPMERIPFPTPSVTDYSPTLKPSTLAEASDVTQHPAAVLCDLQSPL
FT                   SDDDFRRLFHGDSPAEPNPSFPEDGFAFDVLDGGDISAFPFDSMVDFDPESVVLEGVQP
FT                   SGLSDETSLQTTSLQPSHGASTSRCDGQSIAASG"
FT   CDS_pept        join(complement(153315..153776),complement(153019..153263),
FT                   complement(152101..152971))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178028" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670269"
FT                   /orf_name="Pc14g00640"
FT                   /product="Pc14g00640 protein"
FT                   /protein_id="CAP74205.1"
FT                   /db_xref="InterPro:IPR007955"
FT                   /db_xref="UniParc:UPI00018313DD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5M5"
FT                   /transl_table=1
FT                   /translation="MTTQFDRRVYFDKPAQNTHFAFFGLSEELPAMPKVSSSRAAAAAR
FT                   RHNPLAEDITSAGHLRTQSSKKGKGKADENDEDGENGQRFVDAKMSRKILQIGQELADE
FT                   DAAEQLKNSARPKSNAFEFDTRLEDEEEPFSDDEGKFEADDWVDEEVEQVEVDPNDLDM
FT                   FNKFMPHEEDPIFHPKDPSSAGPTNLADLILEKIAEHEAKQAGEGPYGQYIQGGGVPED
FT                   AVQIPAKAVEVYEKVGMILSRYKSGPLPKPIKILPSVPNWQTLLDITRPESWTGNAVYA
FT                   VTRIFISSKPAVAQEFINAVLLERVREEIHETKKLNVHTYNALRKALYKPACFFKGLLF
FT                   PLVSTGTCTLREAHIVSSVIARVSVPVLHSAAALLRMCDLAAEQSLTSLESTGAVNMFI
FT                   RVFLEKKYALPYKVIDALVFHFMRFRAVDPSEDAMNDGPSGLGSKSYKLPVLWHQSLLV
FT                   FAQRYRNDITEDQREALLDLLLVRGHKDIGPEVRRELIAGRGRGVVVPDPEVQNALDAG
FT                   DDTMDVTM"
FT   CDS_pept        154216..156009
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178007" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670270"
FT                   /orf_name="Pc14g00650"
FT                   /product="Pc14g00650 protein"
FT                   /protein_id="CAP74206.1"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="UniParc:UPI00018313DE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5M6"
FT                   /transl_table=1
FT                   /translation="MASGQAPGSSAPSSNINSPILPPNGGPLLNAQFTDLNPRSSPAPS
FT                   AQGDGRAKRNKRDSRKKREAKGLDTENAPPPKKRATAAPSTALPSSKLSILRPLLLAEP
FT                   HASDRYPPQPRQLNRVTRKTSDVLGQSWDFYEVVDKLTNKNGFRYSYAIADPGFPHIKY
FT                   RQTDVRPYHTRFSFEDSPAAISFSESATAVTTSDAWHTARANVCAREGTYYYEARVISG
FT                   IVNDPQAPQNNGRSTTSPRGHVRIGFARREADLDVNVGVDCYGYGIRDVNGEVVNRMRC
FT                   EFFFPKGEAINEGDVIGMLITLPPLSLHKKIVEGTYDPADNTSPQPVATNIIRDRIPFH
FT                   YKSDFCWQQSNVFSTKHLRDYAFNLKETPTFGPPSPLNSEDATLRTLPGSSITIFKNGV
FT                   QMGTPFKELYAFLPPASRLANGTNNLGIGERENADDGLIGYYPAVSCYGGGAVECRFEG
FT                   PWWVGPPEKTETGEPVRAMGERFNDQIAEDVLADIVDEVEAMFTWGGIDGDVINNNTEL
FT                   DGAGVVGGAEVLKGGVGAALDSTLAHTPGTAGASDSAANSNRETPAAGDVGNHGLEDAM
FT                   SVGTAGTPNVEVQGDGDVEMT"
FT   CDS_pept        join(complement(157661..157796),complement(157280..157604),
FT                   complement(157057..157232),complement(156139..157004))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000116699" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943315"
FT                   /orf_name="Pc14g00660"
FT                   /product="Pc14g00660 protein"
FT                   /function="glutaminyl-tRNA synthase (glutamine-hydrolyzing)
FT                   activity"
FT                   /biological_process="translation"
FT                   /protein_id="CAP74207.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0050567"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="UniParc:UPI00018313DF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5M7"
FT                   /transl_table=1
FT                   /translation="MSLLREAERCVANQYAHGFNAFITPLSRAGPWLDRVKEADVRKEE
FT                   GKPKSAVDGRLISIKDNICTRDLPTTCASRILDKFTSPFNATVVDQLEAAGAIVAGKTN
FT                   LDEFGMGSNSTNSHFGPVKNPRRDSSGEDLSAGGSSGGSAASVAADQCLASLGTDTGGS
FT                   VRLPAAYTGTVGFKPSYGLISRWGVAAYANSLDTVGIIGKTTANVRDIFDILNQHDHRD
FT                   PTSLSISSRSRIQASLQTPQLASRLTSAPLRVGVPIEYNVSELTPSVRRAWALSLAHLK
FT                   KQGHTVHSVSLPDTKHALSTYYVLGPAEASSNLAKYDGVRYGTRAEGPDGDGKPDGYLF
FT                   SNTRGQGFGQEVKRRIVLGTFTLSADAIDNYFIQAQRVRRLVQQDFDAVFTAKHPLAAQ
FT                   GADKIAKENEVDVIICPTAPSSPPRLSDLMSNSTKKSPLDAYVADVFTVPASLAGLPAI
FT                   SVPVMVSGQQDAELAGIQVIGQYGDDQLVMRVGEMLEGRNLD"
FT   CDS_pept        join(158125..158300,158349..159390)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294683" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823293"
FT                   /orf_name="Pc14g00670"
FT                   /product="Pc14g00670 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP74208.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018313E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5M8"
FT                   /transl_table=1
FT                   /translation="MFSRSVLQTATRSVRPASARAVPQLGKAPFGRRYVSVYGYTQAKA
FT                   LIYSKYGEPKDVLRLHKHSISAPHATQVNLRLLTAPMNPADVNQIQGVYPSKPPFQTEL
FT                   GNVEPAAVGGNEGAFEVLSTGAGVKNLSKGDWVIMKRTGLGTWRTHAQLDESQLIKVEN
FT                   KEGLTPLQVGTVSVNPVTAYRMLRDFCEWDWMRAGEEWVIQNGANSGVGRAAIQLGREW
FT                   GIKTLNVIRQRKTPEETEALKQELRDLGATVVITEEEMLNGNFRDMVHEFTRKGREPIR
FT                   LALNCVGGKNATALAKTLAPDSHMVTYGAMSKQPVALPSGLLIFKNLAFDGFWVSKWGD
FT                   KNPQLKESTIKDVLQLTRSGKFKDIPVDEVKWNWETEGPELAESVQGTLGGYRSGKGVF
FT                   TFSGGD"
FT   CDS_pept        join(complement(161197..161351),complement(159532..161149))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000177996" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127577"
FT                   /orf_name="Pc14g00680"
FT                   /product="Pc14g00680 protein"
FT                   /function="hydrolase activity"
FT                   /biological_process="nucleotide catabolic process "
FT                   /protein_id="CAP74209.1"
FT                   /db_xref="GO:0009166"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR014485"
FT                   /db_xref="UniParc:UPI00018313E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5P1"
FT                   /transl_table=1
FT                   /translation="MLSLLWLLPSALAAQPSAPDPISAPLRDLEFGQLNFIHTTDTHGW
FT                   LAGHLQEPSYSADWGDYISFTTRMREKAEAQGQDLLVIDTGDRVEGNGLYDSSEPKGIY
FT                   LSDILRHQHIDLLTSGNHELYKQNTSEAELLVTVPNFRGNYLASNIDIIHPTTKELVPL
FT                   APRFKKFTTKKQGIRIVAFGFLFDFNGNYNNTVVQRVSSTIKEDWFQEAIRDKEVDLFL
FT                   VIGHVPVHSPEYRAIFKEIRGIRWDTPIQFFGGHQHVRDYAQFDSKAFGLASGRFMETV
FT                   GFMSIDGLASKTSHQSAAGPVFKRRYIDNNLLSYYHHTGLDQETFPTEKGINVSELIAE
FT                   ARTDLHLDHVHGCAPHDLWMSRAKYPDPNSIYTWLETQVLGDLRDESRGDVPRLAIVNT
FT                   GAMRFDIFKGPFTEDSAFIVSPFTSTFRYVKDVPYDKAQLVVDVLNEQPQVLSTEETSL
FT                   TTLAPPEQLAYPEDVIAQTWSSASEQIPMSGSDLVPGYTTKDDAGTDGDDTIHSPINFY
FT                   RVPNCIRTLIPANTSETPKTVDLVYLDFIEKKVILAAKFAGLDIDIAKESDAYMPGTTL
FT                   TNLILDWVKKNWEC"
FT   mat_peptide     join(complement(161197..161294),complement(159535..161149))
FT                   /db_xref="UniProtKB/TrEMBL:B6H5P1 "
FT   sig_peptide     complement(161295..161351)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5P1 "
FT   CDS_pept        join(161767..162014,162074..162197,162292..162545,
FT                   162600..163071)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000281450" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670511"
FT                   /orf_name="Pc14g00690"
FT                   /product="Pc14g00690 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP74210.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="UniParc:UPI00018313E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5P2"
FT                   /transl_table=1
FT                   /translation="MAAPRLFRPTARLFSSRLASTALRSNLRQSACAPSILRRGYATET
FT                   GTKEVTVRDALNEALAEELEANQKTFVLGEEVAQYNGAYKVTKGLLDRFGPKRVIDTPI
FT                   TEAGFCGIAVGAALAGLHPIAIDQIINSAAKTHYMSGGIQPCNITFRGPNGFAAGVAAQ
FT                   HSQDYSAWYGSIPGLKVVSPWSSEDAKGLLKAAIRDPNPVVVLENELMYGQSFPMSEAA
FT                   QKNDFVLPIGKAKIERPGKDLTIVSVSRCVGQSMTAAAELKQKYGVDAEVINLRSIKPL
FT                   DVETIIASLKKTGRIMVVESGYPMFGVSSEILALSMEYGFDYLTAPAVRVTGAEVPTPY
FT                   AAGLEAMAFPQEDTIVSQAAKLLRL"
FT   sig_peptide     161767..161892
FT                   /db_xref="UniProtKB/TrEMBL:B6H5P2 "
FT   mat_peptide     join(161893..162014,162074..162197,162292..162545,
FT                   162600..163068)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5P2 "
FT   CDS_pept        join(complement(164068..164076),complement(163407..163937))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217774" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976487"
FT                   /orf_name="Pc14g00700"
FT                   /product="Pc14g00700 protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP74211.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00018313E3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5P3"
FT                   /transl_table=1
FT                   /translation="MAPTESARSALSSFTCTLCNKSYSRHPEYEAHIGSYDHQHRKRLQ
FT                   DLKQLTRDPNAVEKNRRAERKADAQAGLKVIETPVDNVSSGGSSGFKKGGFKSSFAAVK
FT                   GTVAPAAPVKKNVLGDDDEDNGPKPQSDDPSQVRRAKKGEYGDMESDTDEEYGQEGYYD
FT                   PRQPTDCFAGCTAPRV"
FT   CDS_pept        join(164599..164803,164858..165636)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217776" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670512"
FT                   /orf_name="Pc14g00710"
FT                   /product="Pc14g00710 protein"
FT                   /protein_id="CAP74212.1"
FT                   /db_xref="InterPro:IPR012472"
FT                   /db_xref="UniParc:UPI00018314C3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5P4"
FT                   /transl_table=1
FT                   /translation="MPSHVPSKPEDIDTKSIISLQELEPSPVRDSLDVESGEYFPRAPS
FT                   PAQHGIGISVPKLGLSGHGWDSWLTGIQRYSTYPPTAFFILHLANTSLIPLVTRSVSAS
FT                   ESYLLLTRPIYQAPGLEHLVLTIPIIAHIASGIALRNIRATRRARLYGAETRAQRSTLY
FT                   FWPRMSLQARTGYFVTPLIAFHAFVNRATPLIVEGGSSGVGLGYIAHGFARSPVFWNVF
FT                   YFFFVSASVWHFVGGWATWMGWRVTTARKERGQKGSLDGYLRLTETKSRRQRKMWWVVN
FT                   GIATAGAALWLAGALGVVGRAGEGAGWEAKGWNEMYSHVPIIGEWL"
FT   CDS_pept        166143..168233
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177995" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943316"
FT                   /orf_name="Pc14g00720"
FT                   /product="Pc14g00720 protein"
FT                   /function="RNA binding"
FT                   /function="tRNA (guanine-N2-)-methyltransferase activity "
FT                   /protein_id="CAP74213.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004809"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="UniParc:UPI00018314C4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5P5"
FT                   /transl_table=1
FT                   /translation="MEDPQIQLVEHQGEKYNVVKEGLARILNPPAQEAASKGTKKDLKD
FT                   DDQVQSVFYNPIQQFNRDLSVLAIRAHGEHIIDLKKQKAAQKLKRQAGNGEKKRKREDD
FT                   QAENPRPAPKAEHKENTETNDQQVPAPPADQEPKPEARPEQPAASFTVLDALSATGLRA
FT                   LRYASELPFVTKVVANDLSRSAIKSMKKNIEYNNLKTIQPNLADARVYMYGLDDASKFD
FT                   VIDLDPYGTASPFLDAAVQAAKDGGLLCVTCTDAGVWASTGYSEKAFSLYGGIPMKGLH
FT                   SHEGGLRLILNAIAMSAAKYGVAIEPLLSLSIDFYARVFVRIHRSPAQVKFTAGNMMLV
FT                   YNCDVGCGAWSTQPIGSTRSKLDRKGNPIYHHGLAQAPAVGPHCEHCGTKTHLAGPMWG
FT                   GPLHNPDFIQKILDMLPGADRDTYQTCDRIEGMLTTALEEDLDLTPSNSEPSSPKQPAS
FT                   SKKNLHDPAYPAIIPRMDVAAREKYPFFLTLSALAKVIHATTIPIDEFRGALSHLGYRS
FT                   TRSHTKPNSIRTDAPWEVIWEIMREWVRQKSPIKETSLKPGTPGAAIMSKGRENLRKLG
FT                   DEDQWLSLLKQDLTSAVDAGRDVGDLVTKVEAALYRSGSRTSWQRAPAPAETLPDADPQ
FT                   PVPEKEKAPAQPFKRPHPSALEVVFDEALGRQVSAAHTKKRLVRYQLNPRANWGPLNRA
FT                   GR"
FT   CDS_pept        join(168680..168745,168815..168977,169028..169227)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000256797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670513"
FT                   /orf_name="Pc14g00730"
FT                   /product="Pc14g00730 protein"
FT                   /function="carbon-sulfur lyase activity"
FT                   /protein_id="CAP74214.1"
FT                   /db_xref="GO:0016846"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniParc:UPI00018314C5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5P6"
FT                   /transl_table=1
FT                   /translation="MAVGGCFCGKVRIEYSGQPLASALCHCLDCRKLTGGPYSFNYIVQ
FT                   TAELHVSGNPKEVPKTSDSGNEIKNYFCPDCGTPLYGLKIKPNGDRDETTVIRAGILDN
FT                   VGILHERTPVVEIYTEQRLKWVSPIEGADQFTGMLPLP"
FT   CDS_pept        complement(169520..175768)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177963" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943317"
FT                   /orf_name="Pc14g00740"
FT                   /product="Pc14g00740 protein"
FT                   /function="fatty acid synthase activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="fatty acid synthase complex "
FT                   /protein_id="CAP74215.1"
FT                   /db_xref="GO:0004312"
FT                   /db_xref="GO:0005835"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR013565"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016452"
FT                   /db_xref="UniParc:UPI00018314C6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5P7"
FT                   /transl_table=1
FT                   /translation="MYGTSTGPQTGINTPRSSQSLRPLILSHGSLEFSFLVPTSLHFHA
FT                   SQLKDSFTASLPEPTDELAQDDEPSSVTELVARYIGHVAHELEEEDDAQGNYLDVLKLV
FT                   LNEFERAFMRGNDVHAVAAALPGIVAKKNQVVEAYYAGRAAAGRPTKPYDSALFRAASD
FT                   EAAGIYSVFGGQGNIEEYFDELRNIYTTYPSFVEELITTSAELLQTLSREPEASKLYPK
FT                   GMDIMQWLQDRDAQPDIDYLVSAPVSLPLIGLVQLAHYMVTCKVLGRQPGDVLERILGT
FT                   TGHSQGVVTAAVIATATSWDSFATAAQNALTMLFWIGLRSQQAYPRTSIAPSVLQDSIE
FT                   NGEGTPTPMLSIRDLSLTAVQEHIDATNQHLPEDRHISISLVNSARNFVVTGPPISLYG
FT                   LNVRLRKVKAATGLDQNRMPFTQRKVRFVNRFLPITAPFHSQYLVSAYDRILEDLEDVV
FT                   EIPAKSLEIPVFHTKTGEDLRQLGDKDVVPSLVRMITHDAVNWEQATVFPRATHIVDFG
FT                   PGGISGLGVLTNRNKDGTGVRVILAGEMDGTNAEVGYKPELFDRDEHSVKFAVDWVKEH
FT                   GPRLTQTSTGQTYVDTKMSRLLGIPPVMVAGMTPTTVPWDFVAATMNAGYHIELAGGGY
FT                   YNAKTMTEAITKIEKAIPPGRGITINLIYVNPRAMAWQIPLIGRLRAEGVPIEGLTIGA
FT                   GVPSIEVANEYIETLGIKHIAFKPGSVDAIQQVINVAKANPKFPIILQWTGGRGGGHHS
FT                   FEDFHQPILQMYSRIRKQDNIVLVAGSGFGGSEDTYPYLSGKWSAKYGYPPMPFDGCLF
FT                   GSRMMIAKEAHTSYNAKKAIADAPGVDDAEWEKTYQKATGGVITVLSEMGEPIHKLATR
FT                   GVLFWQEMDQKIFKLDKAKRVPELKKQRNYIIKKLNDDFHKVWFGRNAAGETVDLEDMT
FT                   YAEVVRRMVDLMYIKHESRWIDPSLKRLTGDFIRRVEERFTTAQGQASLLQSYSDIDTP
FT                   YPAVDNILSAYPEAANQLINAQDVQHFLLLCQKRGQKPVPFVPVLDENFEFFFKKDSLW
FT                   QSEDLEAVVDQDVGRTCILQGPMAARFSNVIDEPVKDILDGVHQGHIAGLLRDVYGGDS
FT                   TKIPVIEYFGGQLMSTTDSDSDGLIISEEPSKTSFRLSSTAALPDLDRWLGLLAGNVYS
FT                   WRHALFLADVYVQGHRFQTNPMKRIVAPTAGMYVEVSNPNDPAKTVISVREPYQSGKLV
FT                   KTVEAKINEKGQISLSLFEGRTAENGVVPLNFLFTYHPETGYAPIREVMGDRNDRIKEF
FT                   YYRVWFGNKDVPFDTPTTATFSGGQKTITAQDVADFVHAVGNTGEAFVDRPSKEVFAPM
FT                   DFAIVAGWQAITKPIFPRTIDGDLLKLVHLSNGFKMVPGAQPLKVGDVLDTTAQINSVI
FT                   NQDSGKMVEVCGTIKRENKAIMHVTSQFLYRGAYTDYENTFQRKDEVPIQVHLATSRDV
FT                   AILRSKEWFRMDDAEIELLGQTLTFRLQSLIRFKNATVFSNVQTVGQVLLELPTKEVIQ
FT                   VASVEYEAGDSHGNPVVDYLQRNGTSIEQPVYFENPIPLSGKTALELRAPASNETYARV
FT                   SGDYNPIHVSRVFSSYANLPGTITHGMYSSAAVRSLVETWAAENNIGRVRGFQVSLVGM
FT                   VLPNDMITVKLQHVGMIAGRKIIKVEASNKETEEKVLQGEAEVEQPVTSYVFTGQGSQE
FT                   QGMGMELYGSSPVAQEVWDRADRHFMENYGLSIIDIVKNNPKELTVYFGGPRGKAIRQN
FT                   YMAMTFESVNADGSIKSEKIFKEVDENTASYTYRSPTGLLSATQFTQPALTLMEKASFE
FT                   DMRAKGLVQRDSSFAGHSLGEYSALAALADVMPIESLVSVVFYRGLTMQVAVERDAQGR
FT                   SNYSMCAVNPSRISKTFNEQALQYVVENISETTGWLLEIVNYNVANMQYVAAGDLRALD
FT                   CLTNLLNFLKAQNIDIPALMESMSLEDVKEHLVSIIQECVKQTEAKPRPISLERGFATI
FT                   PLKGIDVPFHSTFLRSGVKPFRSFLLKKINKTTIDPSKLVGKYIPNVTARPFEITKEYF
FT                   EDVYRLTNSPRIASILANWEKYEEGNENVAK"
FT   CDS_pept        join(176993..177512,177563..182499,182561..182671)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000177974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943318"
FT                   /orf_name="Pc14g00750"
FT                   /product="Pc14g00750 protein"
FT                   /function="fatty-acyl-CoA synthase activity"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP74216.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004321"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR021186"
FT                   /db_xref="UniParc:UPI00018314C7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5P8"
FT                   /transl_table=1
FT                   /translation="MRPEVEQELAHTLLVELLAYQFASPVRWIETQDVILAEQRTERIV
FT                   EIGPADTLGGMARRTLASKYEAYDAATSVQRQILCYNKDANEIYYDVEPVEEEPEAAAE
FT                   PASSPAPGAAPAAAPAAGAPPPPPSAGPAAAVEDVPVTAVDILRTLVAQKLKKSLADVP
FT                   LSKAIKDLVGGKSTLQNEILGDLGKEFGSTPEKPEDVPLDELGASMQATFNGQLGKQSS
FT                   SLIARMVSSKMPGGFNITSVRKYLETRWGLGSGRQDGVLLLALTMEPAARLGSEADAKA
FT                   YLDDVSNKYAASAGVSLSTPAAGGDAGGGGGMVMDPAAIDALTKDQRALFKQQLEIIAR
FT                   YLKMDLRGGEKAYVTSQETQKALQAQLDLWQAEHGDFYASGIEPSFDQLKARVYDSSWN
FT                   WARQDALSMYYDIIFGRLQVVDREIVSQCIRIMNRSNPLLLDFMQYHIDNCPAERGETY
FT                   QLAKELGQQLIENCREVLEVAPVYKDVAVPTGPQTTIDARGNIGYKEVPRTSARKLEHY
FT                   VKHMAEGGPISEYSNRTKVQNDLKNVYKLIRKQHRLSKSSQIQFDALYKDVVHALGMNE
FT                   SQIIPQENGHSKKGGRNATKRTTATRPGKVETIPFLHLKKKTEHGWDYNKKLTGIYLNV
FT                   MESAAKDGLSFQGKNVLMTGAGAGSIGAEVLQGLISGGAQVVVTTSRFSREVTEYYQAM
FT                   YARYGARGSQLVVVPFNQGSKQDVEALVDYIYDTKKGLGWDLDFIVPFAAIPENGREID
FT                   SIDSKSELAHRIMLTNLLRLLGSVKTQKQAHGFETRPAQVVLPLSPNHGTFGNDGLYSE
FT                   SKLALETLFNRWYSENWGHYLTICGAVIGWTRGTGLMSGNNMVAEGVEKLGVRTFSQQE
FT                   MAFNLLGLMAPAIVNLCQLDPVFADLNGGLQFIPDLKGLMTKLRTDIMETSDVRQAVIK
FT                   ETAIEHKVVNGEDSGVLYKKVVAEPRANIKFEFPNLPDWEKEVKPLNESLKGMVNLDKV
FT                   VVVTGFSEVGPWGNSRTRWEMESKGKFSLEGCVEMAWIMGLIKHHNGPLKGQAYSGWVD
FT                   AKTGEPVDDKDVKPKYEKHILEHTGIRLIEPELFKGYDPKKKQLLQEIVIQEDLEPFES
FT                   SKETAEEFKREHGDKVEIFEIPESGEYTVRLRKGATMLIPKALQFDRLVAGQVPTGWDA
FT                   SRYGIPDDIIEQVDPVTLFVLVCTAESMLSAGITDPYEFYKYVHLSEVGNCIGSGIGGT
FT                   HALRGMYKDRFMDKPLQKDILQESFINTMSAWVNMLLLSSTGPIKTPVGACATAVESVD
FT                   IGYETIVEGKARVCFVGGFDDFQEEGSYEFANMKATSNAEDEFAHGRTPQEMSRPTTTT
FT                   RAGFMESQGCGMQLIMSAQLALDMGVPIHGIIALTTTATDKIGRSVPAPGQGVLTTARE
FT                   NPGKFPSPLLDIKYRRRQLDLRKKQIKEWQESELLYLQEEADAMKAQSDETFNEADYMQ
FT                   ERAQHIEREALRQEKDAQYSLGNNFWKQDPRIAPLRGAMATWGLTVDDIDVASFHGTST
FT                   VANDKNESDVICQQMKHLGRSKGNAVMGIFQKYLTGHPKGAAGAWMFNGCLQVLESGLV
FT                   PGNRNADNVDKVMEKFDYIVYPSRSIQTDGVKAFSVTSFGFGQKGAQVIGIHPKYLYAT
FT                   LDQAQYQAYKTKVEARQKKAYRYFHNGLINNSIFVAKTKAPYEDELQSKVFLNPDYRVS
FT                   VDKKTSELKYSATAPETKESESTRQTLESLAKANAAENSKIGVDVEHIDSVNIENETFV
FT                   ERNFTQSEQDYCRKAASPQSSFAGRWSAKEAVFKSLGVSSKGAGSALKEIEIGVDANGA
FT                   PVVNLHGAAAAAAKQAGVKQVSVSISHSDSQAVAVAVSQF"
FT   CDS_pept        join(complement(184442..185770),complement(184105..184392),
FT                   complement(183832..184057),complement(183547..183779))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127578"
FT                   /orf_name="Pc14g00760"
FT                   /product="Pc14g00760 protein"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="catalytic activity"
FT                   /function="transcription activator activity"
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP74217.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="GO:0016563"
FT                   /db_xref="InterPro:IPR008851"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="UniParc:UPI00018314C8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Q4"
FT                   /transl_table=1
FT                   /translation="MSTPTNPSNARTPTGPNGAPVMRMRRPKAADPLVRPKRRPVPKPA
FT                   GAAPAPNGTATKTLPSRPSQTPAIFPSERPMLELSNNNMAANGFSGPLLSDKYVDYPVV
FT                   TTKRALMEGLKHHIARFASKKSVDPRDESQFTRPVRLHRRDPRARTHDPNAGRSEIDGQ
FT                   PMDEAEREAFDARKAAREKERAENLSQIAPALGSTSKRPNAPKQKTQQVFKSDMTPEEI
FT                   ARARIKYEEALPWHLEDFDNRHTWVGNYEAALSETHAVFILDNGKMRMVPAEKWYKFNA
FT                   KSNFKALTIDEAEKFMAKRVKDPRWFMEKQQQLEQEKELETYAKQRKVYAGKQGTSIKT
FT                   EGLEAGEMDFEEDRFADDEEHDDLFNEDEDAKDAEKRIKEDQLKANVFNLKDEKEYDAE
FT                   EMREKREREARRVLGKGVRKALKRRERNFDYSSGSDVNPYTDEESSDDSETERAKEEER
FT                   KKAEEEKNQKEALSKGTNTPSGRPKHTDALKKASAAGSRKRIGSPNASDASGTDTSRKK
FT                   AKSMHLSTSQPPSRPISPSALQGKKRVRNIPGGAGSGSDVDTGAGSGAEMTEGGKIKKL
FT                   KLNPPTSVSRGGTPQGSRAASPLPRPPGSRANSPDGPRGPRVSTPVSGNQTFPTAGEIH
FT                   AAIPASGILSSDLLKVFRPRIGESKENHRRFIAIVKDVSVYGKEDRMLRPGPWKGN"
FT   CDS_pept        join(complement(188957..189128),complement(188547..188906),
FT                   complement(188146..188510),complement(187946..188099),
FT                   complement(187607..187887),complement(187383..187486),
FT                   complement(186388..187330))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943319"
FT                   /orf_name="Pc14g00770"
FT                   /product="Pc14g00770 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP74218.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR004648"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniParc:UPI00018314C9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Q5"
FT                   /transl_table=1
FT                   /translation="MQETPASSPYMTSDDENVLEIDDDDSKSSVEDPPDNSPYAQVRAS
FT                   VPATDDISLSINTPRMWILSLLFSLTGSAANLFFSLRYPSVAITPIIALVLVHPLGKFW
FT                   DVLLKQTDDPLEIFENGSLHHREFLSGEIDAPPVPLASRVRLWLGQGRWNEKEHACVYI
FT                   SSNVSFGFAFATDVRQVIVEQHKFYNQDVPIIYQLLLIISTQVLGYAFAGLTRRFLVRP
FT                   SAMIWPGTLMSTAMFSTMHKSVNKKANGWSISRYKFFVVVWAGAFVWYFVPGLLMPALS
FT                   YFNVITWLAPKNVVISNLFGVASGLGMFPLTFDWAQIAYIGSPLLTPWWAAANIVTGLV
FT                   VVIWVAAPILYYKNVLFSAYMPIVSTAVFDNTGRPYNVSRILTADFLFDEKAYQDYSPV
FT                   YLPITYVLSYGVQFAALASLVTHTVCWYGKDIWHQTRKAFEERRDDVHCRLMRRYKDAP
FT                   LTWYLLVFISMLAIAIFTVEYYPTHLPWYGLLLALGITCVFFIPVGIIMAVTNQHSSLY
FT                   LICQLLCGIVFPGRPVANMIFVTYSYISSAQGIKFSSDLKLGHYMKIPPRILFGVQMMA
FT                   TLVSSLTQIGVLNWMFTFVPGLCTPEAINGFNCPIARVHFNGSILWGVVGPQRFFGPGG
FT                   LYRPLVWAFLLGAVAPLGAWLLGRHRKKSFWRMVNFPILFGSLSWIPPATGLNFSIWAL
FT                   VCFVFNYVIRRRRTAWWEKYAMTLSAALDSGLAFAVVVVFFAFIYPGLVDGFKWWGTEI
FT                   YKQVSPRYSGCLMSANCVKGCDWVACPYKPLEPGQRFGQ"
FT   CDS_pept        join(complement(191255..191275),complement(191157..191202),
FT                   complement(191003..191106),complement(190837..190950),
FT                   complement(189974..190771))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177950" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943320"
FT                   /orf_name="Pc14g00780"
FT                   /product="Pc14g00780 protein"
FT                   /function="binding"
FT                   /protein_id="CAP74219.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR007205"
FT                   /db_xref="InterPro:IPR007206"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018315B7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Q6"
FT                   /transl_table=1
FT                   /translation="MPSELEELVEFLHHGNTQIRQIACENLVGFSTAQPDLFKRHQLLP
FT                   VRDLKLLARDYIPIAKNALTMLVNLSGDEEVLKLLAEDDKFIETLLAKLTNPKEPNADE
FT                   VAMLLANLVKSETLHKLLSLKRKAPESVSTSENAIDQLMDCFVKGAEGALNKHANYDYL
FT                   SYVFADLSQTEKGRAYFTQRQEYDDVVPITKLTVFTEHRSDIRRKGVASTIKNVAFEVD
FT                   SHPMLFDEDGVNLLPYLLLPLAGPEELSEEDTADMLPDLQLLPPDKQRDSDTSIITTHL
FT                   ETLLLLTTTRDGRDKMRAVKVYPLIRETHLHVEDENVTEACDRLVQVLMRDEEGEGEGE
FT                   PEQPQIEAPQNEDEKVVELF"
FT   CDS_pept        join(191703..191820,191871..191952,192008..192686)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000282238" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943321"
FT                   /orf_name="Pc14g00790"
FT                   /product="Pc14g00790 protein"
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="CAP74220.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniParc:UPI00018315B8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Q7"
FT                   /transl_table=1
FT                   /translation="MENPNLNEIHDFLVSLAFKAGDIINNALPETSGTGSKMNSADLVT
FT                   EYDRAVENMISTSLREKYPNYEFHGEETYDPARPLTDAPTFIVDPIDGTVNFVHGFPFA
FT                   CVSLGFAVGRIPAVGVVYNPSTKTLYSAIRGQGAFLNRETRLPLKGDNVEPLSGLANAL
FT                   IAIEWGADRSGNNWDTKVRTYEKLGKSKENGGAMVRSMRSLGSAALNLCAVADGTLDLY
FT                   WEGGCWSWDVCAGWVILSEAGGIMVDGNPGVWEARLDGRKYLAVRGSPGGSGQKEMVEE
FT                   FWSHVQGELKY"
FT   CDS_pept        join(complement(195943..195992),complement(194991..195872),
FT                   complement(192836..194927))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670514"
FT                   /orf_name="Pc14g00800"
FT                   /product="Pc14g00800 protein"
FT                   /protein_id="CAP74221.1"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR016445"
FT                   /db_xref="UniParc:UPI00018315B9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Q8"
FT                   /transl_table=1
FT                   /translation="MLLIHQVGSVRVGEVVRYTITYTPAADPILPIPSNIYVRVKNTSA
FT                   IPLRAAYLHGPYTLYAACYPSHFDPNTKYERQDLEGTPQFEPYLKAGGGWDAVIKVPAN
FT                   LLEAHDFGSPGQGGPASGQSVSWIVEIQSQVIFSSSAAVHFELLVGRDEKSLAHFSGGA
FT                   WGSGNGSPGPPAKLQDHWVPETRGSRVLASKGVYSKAIALHVDDTTSLWSSPPFPSAKL
FT                   GSKSADRESQDSQAFCENPAPEDSTRAPMKSAKKKVHLVLLTHGLHSNLGADMLYLKES
FT                   IDAAMRKSKKEDSHARAPHVNPVDQEDPTSNSSHVKQERNSQCEDNPDDDDEEQVIVRG
FT                   FSGNAVRTERGIQYLGKRLAKYVLLLTYPDQPYFPLKGSKSNPFSRPFGAPKERAQPFS
FT                   HSAESTPQENAQEFQSEDHAYQVTSISFVGHSLGGLIQTYAIAYIQKHSPQFFEQIRPV
FT                   NFIALATPFLGLSNENPMYVRFALDLGLVGRTGQDLGLSWTAPKVRSGWGAIIAGRGES
FT                   AKDPGHSDPGSKPLLRILPCGPAHEVLKKFHHRTVYSNVVNDGIVPLRTSSLLFLDWKG
FT                   LDRVEKARRDNGLVGTMAEWGWAELTGANSKSPRLARPDGESPLSLSTMEADHRNAYST
FT                   THVTASPKGDILDEHTTSPTPGQFLAPPSRVSNRRIPEEGAVKENVSGSAPSSPLDGFF
FT                   SLFRLNQGKNPPNSKNAKIYKRSQTLRTFETGDGDGTMPIPHGPSSHEHEGVHTPPKTT
FT                   FFESAGDLLMPPLPPADFILDPAARPRTIFHDRIYHPGDIPPPLPTKRRTVAFGSLQGK
FT                   QSKPAPTQDLPASIADSESGLKVEEKIARAYHRDLTWRKVLVRLEPDAHNNIIVRRMFT
FT                   NAYGWPVVKHLVDTHFGQTSTAEMDDSLKQNVELAKSPDVGPTSSGDEVEGQSQSVDQN
FT                   SVRNTDDLPNVSDLHLSEDVPSGPSDTLPAEDESHMSTNDRSLVSRQDSARWTDREVVE
FT                   DDSESGFEVETNAGFRHI"
FT   CDS_pept        complement(196431..197759)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177918" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127579"
FT                   /orf_name="Pc14g00810"
FT                   /product="Pc14g00810 protein"
FT                   /function="diacylglycerol kinase activity"
FT                   /biological_process="activation of protein kinase C
FT                   activity by G-protein coupled receptor protein signaling
FT                   pathway"
FT                   /protein_id="CAP74222.1"
FT                   /db_xref="GO:0004143"
FT                   /db_xref="GO:0007205"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="UniParc:UPI00018315BA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Q9"
FT                   /transl_table=1
FT                   /translation="MSESLVVKIVDNTLKYTSHAGIEFLVDFDDILCVLSNHVPTYSVL
FT                   FFQKTEPDGPNSENFSLKKIDIESLPAALSPFVINIPSHLRHEDEPPVIQVVVSSGSGT
FT                   GRAKTIFQDVVRPLLTYIGLENYELYETQSAQTISELTRSKFLERAHNGVPQTIILLSG
FT                   DGGLIDMLEGFYKSKTAIGVSPNIALIPCGTGNAMANSIGLRSGPVPGLSTLLRGSLSS
FT                   IPVFAAKFSPGSRLVIDEGRQRADIDTDVHHTIYGAVVASWGLHAALVADSDTFEYRKF
FT                   GVDRFKMAANELLHPSDGTPPHQFKGKITLTTSDGPGEARSTEAVGGLEHMYALAALVP
FT                   RLEKEFLISPDSVPLDGHMRFIRFGPMSAEDAMHLMTLAYQGGRHVMEDTVTYADVEQV
FT                   RIDFGEDEERWRRICIDGKIVAVERNGWVEICKQPSRLLNLIH"
FT   CDS_pept        join(complement(199804..202231),complement(198411..199750))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177917" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127580"
FT                   /orf_name="Pc14g00820"
FT                   /product="Pc14g00820 protein"
FT                   /function="acid phosphatase activity"
FT                   /protein_id="CAP74223.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="UniParc:UPI00018315BB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5R0"
FT                   /transl_table=1
FT                   /translation="MDNAAERSNGSSADAGPLRPAQPNLSSSLADMDSDYNDQTPTGPV
FT                   TEPTAVSTKPTSHSKSTQSQPGKADSGFDHRSLSRTGQSSRSLSHAARRFSGSTAASTA
FT                   ASSISEVESCSLRPWRIGVCALDVKARSKPSQNILTRLQSKGEFEVIVFGDKVILDEAV
FT                   ENWPVCDFLVAFFSDGFPLDKAIAYAKLRKPLCVNDLPMQKVLWDRRLCLRILDHMGVP
FT                   TPKRLEVNRDGGPILESAELGQHIYRLTGVKLEGPESGIGGGAPQTKNVSMSEDGEALI
FT                   VDGKVFKKPFVEKPVNGEDHNIHIYFPNDQQYGGGGRRLFRKVGNKSSEYDPNLTVPRS
FT                   VTEKDASYLYEQFLRVDNAEDVKAYTVGPDFCHAETRKSPVVDGLVRRNTHGKEIRYIT
FT                   KLGKEEAIIASKISNGFGQRICGFDMLRVGDKSYVIDVNGWSFVKDNNDYYDKCANILR
FT                   DIFLEERRRCEGISESSEPPSPDIGSSRRSTAGSHRQTLKTLLKSPSTSRLYGPSPKPT
FT                   DASESCTPPLASSGVESTDVSAAISKLNSREAHSTSRGYSPSNTKSPALSVQHANDEAL
FT                   PPLPASKHSWKLKGMVAVIRHADRTPKQKFKFTFHSQPFVDLLKGHQNEVVIKGEAALS
FT                   SVSDAVKIAMEKGLEDIEKLKLLRTSLEKKGGWPGTKVQIKPMFRKRKPEEMGEQGPLQ
FT                   ASTPLSEGKPFDEPPAPVPNEGGGLTPETEDLRRSQTRSDSISGATFSRFSAAENDLIL
FT                   DKLQLVIKWGGEPTHAARYQSQDLGVNMRDDLKLMNREALNNVRVFTSSERRVSTSAQI
FT                   WACSFLDQKDIPEDLIQVRKDLLDDSNAAKDVMDKVKKKLKLLLREGSAPSQFAWPKDK
FT                   NIPEPSVVLARVVELMKFHRSVMRQNFEKLDSAPYIFPTSSNEPETPSQPTSVDGLDPP
FT                   GISDIQGRWCAGEDPRLFKERWEKLFAEFCDTEKVDPSKLSELYDSMKFDALHNRQFLE
FT                   WVFMPQDSPRDSDEDQKCKNAAKADASAEGKPGQESGSDKSEERTESQTFAHRFGLKKR
FT                   IFASESLPHLRALDDSYDHYFKLFPGSQSSKCKVDERLSQLRELYKLAKVLFDYVTPQE
FT                   YGITDSEKLEIGLLTSLPLLQEIVRDLEEVQASPDAKSFFYFTKESHIYTLLNCILEGG
FT                   IQTKIARSAIPELDYLSQICFELYEARDSESDSYSYSIRISVSPGCHAFDPLDVQLDSR
FT                   HSIGCTPRRSLTAHQDWKEVIETLKAKFNT"
FT   CDS_pept        join(203053..203157,203218..204696,204754..205005,
FT                   205073..205711,205766..206377)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217777" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670515"
FT                   /orf_name="Pc14g00830"
FT                   /product="Pc14g00830 protein"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="CAP74224.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007319"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00018315BC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5R1"
FT                   /transl_table=1
FT                   /translation="MPSADNFDLPLAKRQKRVSQVKAGTRGSKIFAPFRTLGLVSPTPV
FT                   PFTSVRLGKSTFQITTSVGHSLQTYDLRRGLNLIFLSRPQTPEIITATCAWQDKVFAAW
FT                   GHLRSQSPGGVWVFKRGKRVAVLEGPADLNGPIERLVVFGSWVVGCWTGGLEVWKTDTY
FT                   EHYASLRPQSARGEKIYTGVMCNMPTYLNKIFVGRSDGAVDIWNLRSGKLLHTLPSLSS
FT                   DAGAVTAIQPTPALSLVAIAYKGGALAIQNVSSGQLVLSLKNASSRGLPVTSISFRGDG
FT                   LGAGHDGRSSGVMATASSGSGDITLWDLNNGGRIAGILRGAHRVSSGEKPMGANRVEFL
FT                   DGQPVLVSSGDDNSLKTWIFDETPFSPIPRPLHRRNGHSAAISALDFLPTSSDGSESGG
FT                   KWLLSASKDCSLWGLSLRKDSQHTEVSQGSLERKAKKGGPSNISSSEDLKAPEVTCIAC
FT                   SLNRDGGMGVTASGPIWSNPKVTNADASNATGWESVVTGHRGDKFARTWFWGKKKAGRW
FT                   AFATSDGTEVKSVTVSQCGTFAVIGSAGGSIDMFNMQSGLHRQSFPARAPAGRTTKSNA
FT                   QASVAAASKHTKAVTGLMIDSLNRTVVSCGLDGKVKFWDLLSGKFLDELDWHPMAAITG
FT                   LRYSKASELVAFSCDDLSIRVIDLETRKLVREFWGCVGQVNDFIFSNDGRWIVAASMDS
FT                   VVRVWDMPTGHLIDIFRVSSTCVALAMSSTGEFLATAHAGSIGISLWSNRSLFMPVTTK
FT                   NLDENVIENVGLPATSGEGGAGLIEAAFADTTEQDEEEGPVLATEQLQHDMMTLSLVPK
FT                   SRWQSLLHLDTIRERNRPKEAPKAPEKAPFFLPSLLGSSGPEAAKEIPGSEDTDAGSVA
FT                   KIAEAERLRIAKLQNGGNPSAPQSIFTRSLASGHDSGDFNSFIDHLKTLSPAKADLEIR
FT                   SLDPRVRDGHSELSDFVIALTARLKSKRDFELVNAWMAVFLKIHADTVRLSSTQDEPQY
FT                   CLLQEALATWSAEQQREGKRLAELVGYCRGVVGFLRSAR"
FT   CDS_pept        join(206726..206985,207058..208522)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217778" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943322"
FT                   /orf_name="Pc14g00840"
FT                   /product="Pc14g00840 protein"
FT                   /protein_id="CAP74225.1"
FT                   /db_xref="UniParc:UPI00018315BD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5R2"
FT                   /transl_table=1
FT                   /translation="MGIPHLTRHLLPYAESVLLDGRANDSGLPQVQAVVIDGPSLVYHV
FT                   YRRLLGWMDPNSDVLDYQPTCDEISRGVSSLLLELTRLGVKIHKICFDGALPISKREVR
FT                   FSRIEKSRHRLELARRNLSLPAAPKCRDVIPTKRGQVWCSRGLPQRRKGLPENPFMVSA
FT                   VFEDLRSRWNKEQIRKEVDDDISCLVADTDYPWADITVMVPGEADVECARVAKLTGCAV
FT                   LTDDSDLLLHDLGQHGAVLFLDSVQTSSGVWDPAQPDIRGLRICPHSLSGRLGIPSIQW
FT                   FAYELQRNAHLRFAELARISKESSKATQLSSDYLEFLREYQHETADNEVIREAAQSMQS
FT                   LDPRVSELFWQYELPDIYCVDEQPHVYLGILNEDSSRRCAWEQGRTYRSLGYSFFNISR
FT                   PASKRFPVVHEFVRRGGRIVAEEIALSGTKTVTSGLELLRRRLAVAHSTFDDGLAAESF
FT                   WFLFVLSDIYRDGSGTTTVPSAKELESFLTNGYMAQSTKWADIHLLAQMQAGLYSLRIL
FT                   KQLVDIAAPGDDLVDSSSLLADLPPLHIMMSRQKIIQSFASTRLVRHAVHRLIETYA"
FT   CDS_pept        join(complement(209714..209784),complement(209593..209658),
FT                   complement(209174..209536),complement(209030..209111))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183747" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943323"
FT                   /orf_name="Pc14g00850"
FT                   /product="Pc14g00850 protein"
FT                   /protein_id="CAP74226.1"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="UniParc:UPI00018315BE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5R3"
FT                   /transl_table=1
FT                   /translation="MGVQKKTRKFALAKRAISMRDNRLKQNQDKTEKGKEAKKDDLVRE
FT                   APQAPSSMFFQFNTALAPPYSVLVDTNFISHTIQHKLEVIPTMLDCLYAKCIPIVTDCV
FT                   LAELEKLGPKYRLALRVAKDPRFERVKCDHKGTYADDCLVDRVIKHRVYIIATNDRDLK
FT                   RRIRKIPGAPIMSVARGKYVIERLPDAPEK"
FT   CDS_pept        join(complement(211045..211565),complement(210353..210980))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224730" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127581"
FT                   /gene_name="mri1"
FT                   /orf_name="Pc14g00860"
FT                   /product="Methylthioribose-1-phosphate isomerase "
FT                   /EC_number="5.3.1.23"
FT                   /function="S-methyl-5-thioribose-1-phosphate isomerase
FT                   activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP74227.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0046523"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="UniParc:UPI00018315BF"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6H5R4"
FT                   /transl_table=1
FT                   /translation="MLQAIKFSKGNLEILDQLQLPFVEEYIPIRTTEDGWHAIKDMKVR
FT                   GAPAIAIVAMLALAAELTSAVDSDKLSQSPEEVCQYITEKLAYLVTSRPTAVNLADAAR
FT                   KLEAVVTDCTKAPGSTGHEVATAFIKAAEDMMGKDLEDNKRIGHNGAEWIAIHAAKGNS
FT                   EVAVLTHCNTGSLATSGYGTALGVVRSLAEKNTLRHAYCTETRPYNQGSRLTAFELVHD
FT                   KIPATLITDSMAAALLADTKVGVNAIVVGADRVAANGDTANKIGTYALAVLAKYHGVKF
FT                   LVAAPRTTIDMATASGKDIVIEQRAASEVTSIKGPRAGSEATDQIAIETVKIAAPGINV
FT                   WNPAFDITPASLIDGIITEVGVVEKGADEKYHLGGLFDGSTF"
FT   CDS_pept        join(complement(212416..212521),complement(212250..212363),
FT                   complement(212104..212162),complement(211920..212045))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943324"
FT                   /orf_name="Pc14g00870"
FT                   /product="Pc14g00870 protein"
FT                   /protein_id="CAP74228.1"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI00018315C0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5R5"
FT                   /transl_table=1
FT                   /translation="MENAPASEGKDPSLFLSEIIGAPVIVKLNSGVVYKGELQSVDGYM
FT                   NIALEKTEEYVNGKLRRNYGDAFVRGNNVDPRIHCSMLLIAPTYENLQEDRIQAWLGLT
FT                   NTSHETVDQTREPGVMEATCLGVTFLSCFV"
FT   CDS_pept        213189..214355
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181631" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943325"
FT                   /orf_name="Pc14g00880"
FT                   /product="Pc14g00880 protein"
FT                   /protein_id="CAP74229.1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="UniParc:UPI00018315C1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5R6"
FT                   /transl_table=1
FT                   /translation="MSFFKKPSWAIKNTGEASTDFYRRSEQTYSDIIAASREAHQKPKS
FT                   PEIPEHTEDTKDTEDPKQKKRRRLSREKGKERSDSSLAQDVTRDVDSDKIVLSEAQDIS
FT                   ASSHDSSLEPVSSMKQRETTKSDFPENHSSPSPQKPRGPEPLGALPVRPVIVLADDSET
FT                   RSPRPVQPAQPIQPPEVPADDPVVQIMITSEIANTKPLLVHRKMSQRLRDVRLAWCNRQ
FT                   NFEPHIQASIYLTWKGRRLFDVTTCRTLGIETGKNSAAIPGIDDDSFADQKELRVHMEA
FT                   VTDLPLPVNQRISSPDNDNPPTKSQSPEDDQGEPMKLILRSPGYDDFRIKARQTTLISR
FT                   LISAFRNKQNISVDRDIFLLFDGDKLDPDSSLGDYDIDNLDLVDVQIR"
FT   CDS_pept        join(214713..214898,214972..215161,215229..215233)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181652" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943326"
FT                   /orf_name="Pc14g00890"
FT                   /product="Pc14g00890 protein"
FT                   /protein_id="CAP74230.1"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniParc:UPI00018315C2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5R7"
FT                   /transl_table=1
FT                   /translation="MKVITANFVTCAVKECKTSPASFPLHFQDAELEQQELDFQPEFIR
FT                   NILPRIDWEALRTISNELGFPSLPDSKPEGDALENEQTLRDLHRLLLETQVTEGKLTCG
FT                   NCGHSYMIKEGIANFLLPSHLV"
FT   CDS_pept        join(complement(215827..219331),complement(215669..215772))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181654" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943327"
FT                   /orf_name="Pc14g00900"
FT                   /product="Pc14g00900 protein"
FT                   /function="histone-lysine N-methyltransferase activity "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /cellular_component="Set1C/COMPASS complex"
FT                   /protein_id="CAP74231.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0018024"
FT                   /db_xref="GO:0048188"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR015722"
FT                   /db_xref="InterPro:IPR017111"
FT                   /db_xref="UniParc:UPI00018316AE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5R8"
FT                   /transl_table=1
FT                   /translation="MSRASAGFADFFPTAPSVLQQKRFKTAQERRKLHVEGDQNSERVP
FT                   DCPVSLAPSTPTTIDTPLKPDTNEEEARTSSVPNVPELTISAKAKSAEDKTGPPAPAAN
FT                   HVPSQIDTLTPLTNAESSPPCKLTSPSQPKIAGGGSPGTSSRPNPEITKSSITPIHTPP
FT                   TPQSQTRHFELRVRGCKVVYDPDLDKRTSSKEKRRKLEYVDIVNNGQSDAPPDPRLAIA
FT                   NYTRGSGCKQKTKYRPAPYNLKPWSYDVATSIGPGPPIQVVVTGFDPLTPIAPISALFS
FT                   SFGDVAEIKNRTDPITGRFLGICSIKYKDSTSARGNGPASASSAARRAYFECKKEQRIG
FT                   TRRIRVELDRDGIVSDRMAAKAVESQRQASKINLPPASEPRPDVQIKKSEPPPTAPKGP
FT                   SGRSSLRPGVVIPEGPRAGVRSPVVQSLVEETPILSQIKRDPYIFIAHCYVPVLSTTVP
FT                   HLRKRLRLFAYKHIRCDKTGYYIIFENSRRGEEETERCYRLCHMQPLFTYIMNMESQPY
FT                   GNPNYERSPSPERLRTERRDKAEKDRAKKEAELDIEEEKKQRALDLDPCREVLSIIIRD
FT                   LRDKLLEDVKSRIAAPALYDYLEPSKHASRRERLGISDPEGTKRSVFQIDSTPGSRGEM
FT                   SAGRDPLKSSGLNVLALPRIRKAHGLDHAGAAFLDERRRQPLRKKEVRPLYHRLQQLHD
FT                   DEDSDDEQRTPATQDADDRESRPPSRASSTSSEFERDGGYRSDDQEEEGSAQVMDDLDA
FT                   TNEISDLSHELQVSPTGKRKRLTEDDEARKRQRQEDELFGIDSETAKHEDLAKDLKTPA
FT                   AIGDDLAENGDELATHDQPAEQFTEHVTHKHPEGDDVSVSETWQAEPIDEPRTEIEWGV
FT                   SKDEPRATVEDDENIVLDLDGWQHLVKDDEDLQFLREVLVDQSESIIQNLAAWGWKQKE
FT                   IKALNGLETGTTHDAISIPGYYVPNTTGAARTEGRKRILEAEKSKYLPHRIKVQKAREE
FT                   REANAKADPQAAAAEAARIAAAKTISKSTSRSTRVNNRRLIADINAQKQALPTANGEGD
FT                   VLRFNQLKKRKKPVRFARSAIHNWGLYAEENITANDMIIEYVGEKVRQQVADMRERRYL
FT                   KSGIGSSYLFRIDENTVIDATKRGGIARFINHSCTPNCTAKIIKVDGSKRIVIYALRDI
FT                   ERDEELTYDYKFEREWDSDDRIPCLCGSTGCKGFLN"
FT   CDS_pept        join(complement(222889..222929),complement(222750..222818),
FT                   complement(222537..222559),complement(222173..222269),
FT                   complement(221249..221556),complement(220233..220864))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127582"
FT                   /orf_name="Pc14g00910"
FT                   /product="Putative uncharacterized protein Pc14g00910 "
FT                   /protein_id="CAP74232.1"
FT                   /db_xref="UniParc:UPI00018316AF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5R9"
FT                   /transl_table=1
FT                   /translation="MGTLVYVDATGPDSSPEAILAGVAGVSFMAPTTSVGGSRYNTDTS
FT                   VISPFSQTTLPRRRVPLTSLIWGQGASSRDSLLLAFKVHEPSQRCIDHNSLALDHESSP
FT                   SSATSYGGGSKRCPTASAYILRVAYTGYMHLNWVTSRNLAPGVIATAVISDELRGASAL
FT                   SFCVDKYKLEEDKGDLGNTLLDAECFAVRFLSYLRSVRSDSDKAILRFAYRGPSSALIT
FT                   TTTTDDDDKSPPSSSSSGRFAVGPVPTGSFGNHLAPNDQSRVRLREIQPGSWVLLLDQR
FT                   SRSSSDDEDVFLRYSFIRIRRISAEIASEQQQQRSVPVPVPNLVEVVGGLTEFLRDTVL
FT                   GIDISTCEKRVEEAEKDRAQRVSIQTGKRCIDIYVMAESSARALFNQLL"
FT   CDS_pept        join(223199..223346,223402..223545,223615..224044,
FT                   224101..225136,225197..225445)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076623" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670516"
FT                   /orf_name="Pc14g00920"
FT                   /product="Pc14g00920 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP74233.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018316B0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5S0"
FT                   /transl_table=1
FT                   /translation="MLRHAPDGSHSSAASDRSDNHHRAHSSAITKKERASQPAGRLACD
FT                   ICRERKVRCDRGDPKCGRCARLGYDCSYQGRKRHRAAQADMPRQLCELQTRLAHAEALL
FT                   RTTPSPAFTPTTARQISPYVDLSWPLVTPSDRPGDHERLMQRLQSHVTPPIDRAFEGLD
FT                   MLANLTEDIPDFWGVMDPALTPDALPLLPGDTPQLPTPFDTGYLHTANGNLVPPTFENS
FT                   LFSTHELEEPISPSDLAVLHQKYFDIFYPVLPILNQSRFRREWAQDPASPRIRGLSYAV
FT                   ALVGSMIAPEYAHLQSRCYSDARKYIELCERDDDETNIMSLNAFQALLFIIRYELTKKH
FT                   FVRAWMTLGRAVTLAQILNLHHIDGVDATRHQRTGSPKNAIETGYVSDIRDPASMEEIR
FT                   RSFWSLYIFESYGSVRTDRPCTLEEDTLCIYLPSPGELKESFLPSPMPFISESTKLTGV
FT                   GYLTSYAAVTIMVKLARLCFEHVSILSRSASDSGFWDRHYRLVKTINDYTAIFQRYLTA
FT                   KAVREDPLAFSLHLNLCATHISLHEAAIRKVEEQDLPKLVAAESRKCSAAAAFKILGAI
FT                   RMNWPVQRSERDHFTLQATFIGWPISMSLIALSRSLANGDTTPIGIVDSLRLLRAALDQ
FT                   VEEPDGYWHQASGAAVTALGKWDEQQRESRSVE"
FT   CDS_pept        complement(225973..226323)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943328"
FT                   /orf_name="Pc14g00930"
FT                   /product="Putative uncharacterized protein Pc14g00930 "
FT                   /protein_id="CAP74234.1"
FT                   /db_xref="UniParc:UPI00018316B1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5S1"
FT                   /transl_table=1
FT                   /translation="MQEYQGSRIERVKAIVKVGGDLTRLQAFDGWYFYIMQRWVTPWIG
FT                   LDTLAINIARLCSTGTKLGFVDFPEQKGLLGWQDTIAAEAKKQGWLGASNKWSEHRNGG
FT                   VGTGSCSRFGPY"
FT   CDS_pept        join(complement(228911..229030),complement(228778..228840),
FT                   complement(228328..228693),complement(228225..228266),
FT                   complement(227784..228164),complement(227682..227723),
FT                   complement(227463..227622),complement(227227..227382),
FT                   complement(226802..227148))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169919" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943329"
FT                   /orf_name="Pc14g00940"
FT                   /product="Pc14g00940 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP74235.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018316B2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5S2"
FT                   /transl_table=1
FT                   /translation="MSAIDADPERQGSNGILASTDSSKNDVPKETSPRPIHGWKWAIAY
FT                   ASMISTTFLFALDNTIVADIQPVILDLFGEVSLLPWIGVGFALGTMCVLPWGKVYGVFN
FT                   AKYVYLFNIVLFEIGSAVCGAAPNMTALVVGRVIAGVGGSGMYSGTLSFVAMLTSLKER
FT                   PIYMAGSTVIWGIGSVLGPVVGGAFADSSATWRWAFYINLPIGAVFAPAYLFLVPSVDP
FT                   QPLKSWTEKCRMIDWVMATTFLAGAACLVMAITFGGTLYSWSSGSEIALWVVAGVLLLI
FT                   CIAVAKFHPGVEKDNRLYPAHFLRRPIQVNLQVQMFLVSGVVLAMTYYIPLFFQFSRGD
FT                   GPLDAGVRLLPFIISMVIFAMANGALMPKLPYVLPWHIFGSALVVAGTALMYTADIHTS
FT                   NARIYGYSILVGSGAGCYVVAGFPVVQSLVAPKDIPNAVGAMAISQDLGMVIFLAMCGS
FT                   IYQNTALQKVSQAMPKLSAADISNLAAGTSSQTYKALSESERALVAPQITDAMSNVWLF
FT                   FLVAGILSFVLTPPLGVSFSPFGVLGMQLRGLTNWFCRKRG"
FT   CDS_pept        join(complement(230848..230883),complement(230124..230740),
FT                   complement(229488..230076))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127583"
FT                   /orf_name="Pc14g00950"
FT                   /product="Pc14g00950 protein"
FT                   /protein_id="CAP74236.1"
FT                   /db_xref="UniParc:UPI00018316B3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5S3"
FT                   /transl_table=1
FT                   /translation="MRRISKPRNKVPGPVRLRTRVSQVRRNANHQGWIVETHSGERQIE
FT                   CKKLIYATGANSSPIRPKWPRENFHKPVIHSLDIAPNLSLIESDVIQRATVVGASKSSY
FT                   DTVYQLLKAGKKVDCVIRPSASGAFSMFAPTFMGLWHISDHISTRFASSFSPSIMSCNG
FT                   LWDNFLQRSVIGRSLMRVYWQVATGLAVRYARFGDDEHTEHLRPWPHTDGYGSLLLFWG
FT                   SGGIGIATVPDLWQVIHEGDVTVHRTEIKSLSHLDVVNFKNGFSVPTDIVIHCIGFEKG
FT                   YDTFSPPLQEELGLHYDSSVFSKWTVLDAQAEQKVNNELPILKKSPFEALEQRKHTQGP
FT                   NWHYRCLIVPELAAKGEIHRVSWSHSLCLHTTGSGTQCIVGVCVSERLDESPWEGGNGA
FT                   RGSDLQCMDSQAIY"
FT   CDS_pept        join(complement(232690..232798),complement(232224..232617),
FT                   complement(231411..232145),complement(230961..231354))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976488"
FT                   /orf_name="Pc14g00960"
FT                   /product="Pc14g00960 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP74237.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00018316B4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5S4"
FT                   /transl_table=1
FT                   /translation="MAKPVPLTPEKKITDDPMIVADPEPVAGAMDDLDLEEMGYVPQMK
FT                   REFSLIQLIGSAYTLTNSWLGVAGAFTTGITAAGSAGIIYGLILMFILNLFVGISLSEL
FT                   ISAMPNSGGQYYWAMRLAPRKYARSFAYITGVCNLFAAYCTTASSSIAVSMFIFGSVKL
FT                   AVPAFALSAWRVYLGAVALNLVAGLVNIWEKAVTKSVLVGLVISLLTCVLITIVLPATA
FT                   VDHTDAKFIFGTLERSNGWSSDGMAFIVGLINANFSFAVLDSAAHLAEETPDPARNVPK
FT                   AIMMTVFIGFVTAFPFACVLMYCLTDFESVVNSPTNVPILQLFYVTYGNRQSAALATMA
FT                   FVTISYICSLFPQHAYQARMCWAFCRDNGMPFSKYWSHIDPSTHVPLRAHILSVCIVFA
FT                   IGLIYIASSTAFNSLITGVIVFPYLTYLAPMISSIWRGKNQPRGPFNLGIIGVVSKVIT
FT                   VVFCSFTVIMYSFPYVMPVTPSSTSPTKSFKHTKQTLIPKDMNYITVIYGIALVYGSID
FT                   WFSRARYQFRVHKSEPRSNELCETSR"
FT   CDS_pept        join(complement(234917..234945),complement(234135..234861),
FT                   complement(233783..234076))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127584"
FT                   /orf_name="Pc14g00970"
FT                   /product="Pc14g00970 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP74238.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018316B5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5S5"
FT                   /transl_table=1
FT                   /translation="MSKITILGAGITGMGIASQLPKNTEITILGDFLPGDAMDQRYVSQ
FT                   WAGAIWLGVHDSTPWEQGMQLNSFSELWRIAERHPESGIRQIEMTEIMDIGDPAKVWYQ
FT                   GKVPGFRFLSPSELPKGAKFGMAFQTLVITPPTFLSWFRQHLEKQGVRFQRTYVKSLRD
FT                   LRGMGHDVLINATGFGAMKLLDVEEKRITPVRQQNIRLRKDGYNRCYIRRGPDGYYSTA
FT                   FARGDGTIYMGGIKSLGDTDFASYEDQRKEILQRQHHNQPDVFPSPNPLEYDIITDHVG
FT                   VFPIIESQNGGVRVEKQVLHGQKVIHAYGQEAGGYTFSFGLGQQVSEYVQEYLTELPKP
FT                   AETPIPSKL"
FT   mat_peptide     join(complement(234135..234839),complement(233786..234076))
FT                   /db_xref="UniProtKB/TrEMBL:B6H5S5 "
FT   sig_peptide     join(complement(234917..234945),complement(234840..234861))
FT                   /db_xref="UniProtKB/TrEMBL:B6H5S5 "
FT   CDS_pept        complement(236227..237654)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234844" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943330"
FT                   /orf_name="Pc14g00980"
FT                   /product="Pc14g00980 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP74239.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00018316B6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5S6"
FT                   /transl_table=1
FT                   /translation="MPSFRVRFAPQRAYHTDQNETSTAVPNETETKPTHTRTRSGCRGC
FT                   RQRRVKCDETFPVCLRCRRRGSICQPVLPASQWQPEVWCLGTADPLSQLTQPINFDADV
FT                   NLRLLQYWFERMSQIMSLDRDRNPMSFPIVKYLSASNSLVYVIQCVSAAHEQHFQPSHM
FT                   TASLEERSKALRNLRQELQSQSLSSPLCFLVILMLGMSSSWITTQPTDYGREHLLAAQA
FT                   SVEMTLEQQDRVDDDLVHLSMGFYVYWDMACSFCLDIADHTQVSRSRLAAYVTTARSRF
FT                   HTITSHSIDLYFLLGQLGRYCRSIADGMPRDFVRETTFEAELNSYTSAEENQFAYLLAE
FT                   AFRNHGLLMLYRLCGRTVHFALEVETDSEEGASKCPIRALALRTLEMLFITPINSPYVN
FT                   LHTLPLLSAAAELESTDTELRERVIEQLQVVYSTNRIPPTLWVIELLQELWNLHDSGIE
FT                   ITWLDLMLVKQWRLRIG"
FT   CDS_pept        join(238471..238732,238808..240186)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000139601" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943331"
FT                   /orf_name="Pc14g00990"
FT                   /product="Pc14g00990 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on CH-OH group
FT                   of donors"
FT                   /biological_process="alcohol metabolic process "
FT                   /protein_id="CAP74240.1"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="GO:0016614"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniParc:UPI00018316B7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5S7"
FT                   /transl_table=1
FT                   /translation="MDSPLSTIVEDLPISRRQFDYIIVGGGTAGCVIADRVAENLPNAT
FT                   ILMIEGGESELGKEEILNLNGAADLWGSDMYDYSYRSVPQPYGNSNIIHSRAKMLGGCS
FT                   SHNGAISFAPLAYDCKRWQDLGAENWTHAEMLRLVRKLRNNIIPVDERHRSQLVKDWLK
FT                   TCSELFGVPHIDDFNREIEERGNLTTGCGFLSMAYTPENNHRSSASVAYIHPILRGEVK
FT                   RPNLTILQNTWVSRILFQGTTATGVTATTKAGHEYSLVATSETVLCAGAIDTPRLMLLS
FT                   GLGPREQLATHQIPLVHDIPGVGENLQDHAETMYMWELHEAVPPEQVAMGSEGVMVLRR
FT                   EDINARGDDNDVMDSLFHMFTVPFDTYTKPMGYESPKNAFCVIPYTPRPASVGRLWLKS
FT                   ANPKDKPMLDQRYFSDLEGYDKASNLFMLKMARRMAQAEPFKKYIKREIAPGAHITSDE
FT                   DLCEYGRKVHNTVYHPCGTAKMGNVETDRMAVVDPSLKVRGVKHLRVADASVFPCMTSI
FT                   NPMITVLAIGERAAELIIKDACRTERAVL"
FT   CDS_pept        complement(240546..241955)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234844" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943332"
FT                   /orf_name="Pc14g01000"
FT                   /product="Pc14g01000 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP74241.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00018316B8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5S8"
FT                   /transl_table=1
FT                   /translation="MPRRFNVRFAPTTQVSVQKPIACDQCQYSEIGTPPQRSRSGCKNC
FT                   KKRRVKCDETFPVCLRCQKRGTVCESESSLPQWQLEISPLILSDITSPSQVRLLRHWCE
FT                   KASQIMVLDPESNPFSFPILEYLHISPSLMPTILSISAAHERFFKKDCLETCLEERGKA
FT                   LLLLQKELGGRQQPHPITFMTVFMLGISTPWIDPSSSQFGYEHLNGARALIELILNPST
FT                   NTDSKFAQLALGTYLYWDMACSFLVDPNQQSTISSSIPEAVAKIAGDFHPIMGYSAEIM
FT                   YTLANLGRYCRSFIDLGIRDKALEEEFETRLLAWRPTTKNTELILLGSSFRNHGLINLY
FT                   RICGRTGCRIGEDLDMGNHSPVDNIETEKVIRQYALQTVKDLSLIPTHNWHTNMQAISL
FT                   LTAGSELTADDHRERDMVVDRFTALYSINRLPGKLMAIDILQDVWQARDFEITISWVHI
FT                   MLLRGWRLSLG"
FT   CDS_pept        242696..244414
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204545" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943333"
FT                   /orf_name="Pc14g01010"
FT                   /product="Pc14g01010 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP74242.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI00018316B9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5S9"
FT                   /transl_table=1
FT                   /translation="MDALVVGAGVGGIYSTYRLSRMGLSVKCVDVASDVGGTWYWNRYP
FT                   GAMSDTESYLYRYSWDKEDLQTYPWSHHYVYQPEILKYLQHVVEKHDLRKYMKFETEMT
FT                   SATWNEDTQRWIVTCSGSEEWNISARYLVNSLGLLSKIHYPDIRGLSSFAGDLIHTARW
FT                   PEDLNLEGKRVGIIGNGSTGIQVMTALAPIVESLTSFQRHPQYSVPSGQRPVTKEYRDK
FT                   VNATYEQIWDGVWSSTVGFGVVESKRNTMDASPEERQKAFQEVWEQGNGFRFMFSAFGD
FT                   ITTNKAANEEACKFIRGKIDEVVKYPRKAAILKPKDLYARRPLCDTGYYEIFNRENVDV
FT                   IDLKESPIDQIVPEGIRTTDGTTHHLDALIFATGFDAIEGNYMRVKISGRNGKTIQEHW
FT                   KNGPKAFGSIACAGFPNMFIVAGPQGPFANFPPVIESEINFIMSCIEYAEENIVAAQVD
FT                   EPNRAANGTSNGAANGTSSGTSNATANGALKTNESYARKGKPTIMEVSDKAETEWIDLC
FT                   NRLIEGSLFTTTASWIFGQNIPGRKPSTNFYFGGLKSYLDWVKFQTSNGFPGFLG"
FT   CDS_pept        join(246898..247143,247196..247223,247307..247339,
FT                   247429..247457)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823294"
FT                   /orf_name="Pc14g01020"
FT                   /product="Putative uncharacterized protein Pc14g01020 "
FT                   /protein_id="CAP74243.1"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI00018316BA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5T0"
FT                   /transl_table=1
FT                   /translation="MYRSADGKVVAAAAKETGTATLTYPCDESFYVTDGWVRLNVHGGD
FT                   HFVLTKGEFVYLKKGTTVDFTFGPGFANVAVFMDSEPFCYNSESEYYNNTQKLYERVGL
FT                   LWQKREE"
FT   CDS_pept        join(complement(249016..249344),complement(247828..248921),
FT                   complement(247612..247772))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178129" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670517"
FT                   /orf_name="Pc14g01030"
FT                   /product="Pc14g01030 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP74244.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000183178C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5T1"
FT                   /transl_table=1
FT                   /translation="MQLHISFLPFVGILGVILHKFLIYPVLLSPLSKVPAAHWSCRFCS
FT                   IWIYWLRWTNQENRTVYDKHMKLGPSLLLGPSLLSINTFDDGVKPIYQGGFPKPDFYFN
FT                   GFAIYNTENIPTFEDNALHSARKRMISNTFSKSFISLSPTARAATRDVLFGRYLPLIRK
FT                   ASGEDKPVEVLGMNYSYSMDTFVQFQFGRSLGSNLLEDHKERKLYLDGFFAPYPFLFWQ
FT                   YYFPKLANFLRKIGIYLIPRSVDTKFGAAEDWNLQKCDSAQQLIASSEPIHSDDQPVIF
FT                   QQALQSMSDPNGTKSAYPQRMQIASDMFAHSSAAFETSGNTETYLFYEMCRNPEWQTKL
FT                   REELRGVKLPQQDDLKRKVEVDDIAEPKAIDALPVLHAIIMETLRLWPAVPGGQPRVVP
FT                   KTCSLGGYSDIPAGTIVQSYAYILHRTPEVFPDPFQWKPQRWLDASPDELANMKRWFWA
FT                   FSSGPRMCIGSNFAYYSMKYLVAAVYAHYTTSIHAHGDMDLLDFYLAGPKGHRLEVKFH
FT                   AAPYAGDTSA"
FT   mat_peptide     join(complement(249016..249299),complement(247828..248921),
FT                   complement(247615..247772))
FT                   /db_xref="UniProtKB/TrEMBL:B6H5T1 "
FT   sig_peptide     complement(249300..249344)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5T1 "
FT   CDS_pept        join(complement(251533..251660),complement(251285..251481),
FT                   complement(250185..251210),complement(249975..250126))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943334"
FT                   /orf_name="Pc14g01040"
FT                   /product="Pc14g01040 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP74245.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000183178D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5T2"
FT                   /transl_table=1
FT                   /translation="MSDLHVYLIAPNGLKFKQPLGLFIDNEWRSSSRGMGIPTINPANE
FT                   EEICTVHAADTKDVDMAVEAARRAFNGEWRTLDTSVRGELLYKLAGLIEQHADVLATID
FT                   AWDNGKTYHAARNEDVVGAISLLRYYAGWSDKIHGKVIDPNADKLAYVMREPIGVCGAI
FT                   IPWNFPLVNMVTKVAPALAAGNTLIVKAAEQTPLSALYFANLVKEAGIPAGVVNVLNGT
FT                   GREVGSAIAAHADIDMITFTGSTPTGKQIMKNAASTLKRVTLETGGKSPMLVFPDADLE
FT                   QAVRWGHRGIMSNQGQVCSATSRIFVHADIYEDFVNQFKAEVERISKVGDPFHSDTFQG
FT                   PQVTRDQFDRVLSYMETGKREGARLVCGGKAFKNVRGKGFYVAPTVFADVTDSMAIVQD
FT                   EVFGPFVVIAPFHEESEAIKRANSTVFGLGASVFTKDISRALRVSKRIQSGTIWINSSN
FT                   DDDVRVPFGGYKQSGFGREMGEEGIEAFTITKSVHINLNARL"
FT   CDS_pept        join(252180..252414,252476..252765,252840..253413,
FT                   253472..253737)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158582" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943335"
FT                   /orf_name="Pc14g01050"
FT                   /product="Pc14g01050 protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP74246.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI000183178E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5T3"
FT                   /transl_table=1
FT                   /translation="MTSFPHPNGTVPFWRLEPQELDNFRSTPDLPDESDIVIIGGGYSA
FT                   AALVTHIQKQYPNHPSILVLEARQLCSGASGRNGGHIKPDPYLHASGIAAQYGLAAGAE
FT                   VADFEVANLNAAKEYIEREGLDCDFVATGACDVHFTSSQDTRIKKRLRDLKAAGVAAAQ
FT                   AVSEVGEDDAEIVSGVKGAKGCVSYNAAHLWPYKLIHHMFTMALKHGGLNLQTNTCATS
FT                   VFPATNSQSSWVIQTNRGPVKASKVIIASNAYTPALLPEYREQIIPYRAVSCRITTPSP
FT                   APPILNTYALRFKDWDFDYLIPRSDGSIVVGGARSAYFRKKDLWYNNTDDSEVIEETRK
FT                   YFDGYMQRHFRGWENSGAKVSEIWTGIMGYSRDKLPRLGPVPGKRGMFIMAGWTGHGMP
FT                   QIFLAAKGMAKMVVKDVPYYETGLPRAFEETADRLQNAPNKVLESWYQATQSPRL"
FT   CDS_pept        join(254636..254930,254997..255598,255658..256245)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943336"
FT                   /orf_name="Pc14g01060"
FT                   /product="Pc14g01060 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP74247.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000183178F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5T4"
FT                   /transl_table=1
FT                   /translation="MAITTEFPISLRDPTLLDCRGLINGEWRHATNQKTFPVYEPATGS
FT                   VLHQCADFEREEFLQAINAAYIGYKNFYNDTTAKDRAQLLRRWHDLIIENVEDLAIILS
FT                   LENGKTLAEAKGEVTYAATFVAWFAEEAVRNYGDVIPSSYAHSTVLTYKEPVGVCGIIT
FT                   PWNFPAAMITRKIAPAFAAGCSVVIKPPSETPFSAIALAKLALKAGVPSSLIHVIPTKD
FT                   RKASLELASNPLVRKISFTGSTAVGKMLTRLASETMKKVSMELGGNAPFVVFEDADLNQ
FT                   AVDAALICKFRASGQTCVCANRLYVHKQIVKAFAEKLAAKVRTLKLGRGIDDGTTQGPL
FT                   VNAAAVEKVKAHVADALAKGGQLWTGGQAPSHLSGFFFEPTIITGATSDMTVATEETFG
FT                   PLAAIFPFESEEDVMMQANASEYGLAGYFFSQDVSRIFRIARQLECGMIGVNTGLISAA
FT                   ESPFGGIKESGVGREGSRYGLSEYQNIKSVTIGNLG"
FT   CDS_pept        257004..258026
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823295"
FT                   /orf_name="Pc14g01070"
FT                   /product="Pc14g01070 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP74248.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831790"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5T5"
FT                   /transl_table=1
FT                   /translation="MTSPKKIVVIGGTGMFGGSVARSLKDNPEFEVVLTTRDPNSSKAA
FT                   KCREQGFLLVKANSWNASELDLVLAGAYGVFLNTDSDNLNFKNEVGPPESAMGKIVIDA
FT                   AIRQNVKYFVFSGLPQSNRLTNGEVSILSFDNKNAIANYGRKAGFEAFVEVNSGWAMDI
FT                   FFMETYANAFGGFATIPDSEGFLSLRIFPMSNDPELIPWTSVRDDYGDAVHAVFLEPPK
FT                   YANRIIWAISEVASFQDVVDAYNRLTGTQVARFVPQTEPLKASTPGKTKEVNGLRNYCH
FT                   YLQGKYCNNQVTDDRLLEEMGALKAVATKARGRGHASTQSIDGFLRDNARVKLQSISKI
FT                   "
FT   sig_peptide     257004..257066
FT                   /db_xref="UniProtKB/TrEMBL:B6H5T5 "
FT   mat_peptide     257067..258023
FT                   /db_xref="UniProtKB/TrEMBL:B6H5T5 "
FT   CDS_pept        join(258710..258837,258897..259262,259371..260388)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976489"
FT                   /orf_name="Pc14g01080"
FT                   /product="Pc14g01080 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP74249.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI0001831791"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5T6"
FT                   /transl_table=1
FT                   /translation="MSSATQTITAPNGVSYQQPTGLFINNQWVASSSGQKLQSINPATE
FT                   EEITSVHAATVEDVDKAVCAARAAFEGEEWQSLVGTARGKLMHKVADLVESQQHVLATI
FT                   EALDNGKPYSQALGDIEEVFSVFRYYGGWADKAYGQTIETSRSKFAYTVREPIGVCGQI
FT                   IPWNYPLGMAAWKLGPALACGNTVVIKAAEQTPLSILYFANILVEAGFPPGVVNIINGY
FT                   GREAGSALVQHPEVDKVAFTGSTPTGKQIMRMASDTMKNITLETGGKSALVIFDDAQIP
FT                   NAVKWAHYGVMGNMGQICTATSRIFVHDKIYDSFIQRFKEYVAKVQVIGCPFEEKTYQG
FT                   PQVSKDQFEKILQYGRIAQEEGATIVAGGRAAEARPNGKGYFVEPTIVRDVQPHMRIYK
FT                   EEIFGPFAVFVRFSTEAEAIRLSNVTEYGLAAAVCTSDVTRAHRVASKLKAGMVWINSS
FT                   NNSDFRVPFGGVKQSGIGRELGQAGLDAYSQLKSVHLNLQLVEQI"
FT   CDS_pept        complement(260708..262084)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116236" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670518"
FT                   /orf_name="Pc14g01090"
FT                   /product="Pc14g01090 protein"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP74250.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001831792"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5T7"
FT                   /transl_table=1
FT                   /translation="MADQRYGQDRPVSDTSVLGRPLELTFSKRTAKNRLLKAAMTERLS
FT                   SWNPKDLSKRGIPTPEIINAYKWFGEGGIGTILTGNLIVDAVNIEGAGNLIIPPDAPFE
FT                   GPRFEAYKRLAWAGNHDGSLILGQLSHGGRQVQTRFQPHPVSASAVHLDKEVWGMKFAK
FT                   PHAASHDEIKDIVESFAHAAEYLYHAGFDGVQLHGAHGYLLSQFLSRRTNQRVDEYGGS
FT                   IANRARIIVEIVSAIRERIPLSSGFVLGIKLNSVEFDEKGFTPDECGELCVLLEKECQF
FT                   DFVELSGGTYEDMAFEHKRESTKQREAFFLEFAEAIVPRLEKTKVFVTGGLLTVNAMVK
FT                   ALEVVDGVGLARALCAEPNLPKDILEGRIQTGAVIQKVDRQDYGLTETVAGTQIRQMGR
FT                   NQAPMDLTREDVVEAFLESTSKWEKALEEDGDKSEIYGYVDVEGVELAPMSNGDNTSKL
FT                   "
FT   CDS_pept        join(complement(265034..265444),complement(263946..264964),
FT                   complement(263089..263878))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076624" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943337"
FT                   /orf_name="Pc14g01100"
FT                   /product="Pc14g01100 protein"
FT                   /protein_id="CAP74251.1"
FT                   /db_xref="UniParc:UPI0001831793"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5T8"
FT                   /transl_table=1
FT                   /translation="MFDNVLLGHDTELTPIPRTYRSSDRLIHTLSEEDSERALCRTSLE
FT                   YEPRSKQQTFGRQSRGLFTGWKFTAFLAFMSSLLVFLFNTGFLIYSAAGTRNGNGMTLV
FT                   KGDCNQVHHLGKAMHWLVNVLSTGVLSASNFGMQCLVAPTRKDVDRAHRTASWLDIGVP
FT                   SLRNLFRISRKRSFLWLCLCFSSLPFHLFYNSAIYYKTAVPAYEVFAGPGSLHQMDWPD
FT                   VQLNNIPKTSDQADSLKSLLHAAKNGTLHHLDSASCVAAFAQTYQTSYGKLLLATESAK
FT                   DNDSYTLVYANPVYQPKYYPGNKAMLPYPWVCPSDSGSQRVCSENGSSAVHKWAENKNW
FT                   TVDVQPGYMTSASYNIQHCLAEPVPQKCSLQYSPPSMVAVVVANLVKTGILLYIWLGMP
FT                   RAPLLTVGDGIASFLRRSDPYSLGMCLPSDGSAIYTHPVYAKLPSLKNRKFRRPAVYTG
FT                   KRRLWGSSVSTRWGIFILWWMLSIIAGLVMLMFGLNNAIGIHIWQTKPGEINSQTITST
FT                   GDSQGFVANSIMANLPQLIFSFLYVAYNSILTSMCLSAEWSRFGHRRKGLRVSHNPRLS
FT                   QRSNYFLTLPYRYAVPLMATSAVLHWLVSQSLFVIAIEAYNTHMERDPLQDVYACGYSP
FT                   LAIVIATSIGGVMFTCLIVLSLRRLESAMPVAGSCSLAIAAACHPGFNPNVDKPEPVEM
FT                   ESEDEGEDMALLPLQWGSISIDGPIGHCSFTSGDVDTPEKGQKYQ"
FT   CDS_pept        join(complement(266368..266616),complement(266167..266280))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216590" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823296"
FT                   /orf_name="Pc14g01110"
FT                   /product="Pc14g01110 protein"
FT                   /protein_id="CAP74252.1"
FT                   /db_xref="UniParc:UPI0001831794"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5T9"
FT                   /transl_table=1
FT                   /translation="MPFSAVIRPAVIRPLSVVRISPISRGCYHNTPKSSYTNGGPSIYV
FT                   ATSFPDDFESSPLASERPKTANEAHNWDESLATLSEVAVKADRGDVQVNIQQKSKTLKT
FT                   PKTPTMEDREPELDEM"
FT   CDS_pept        join(268864..268868,268923..268993,269052..269283,
FT                   269362..271138)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000258898" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943338"
FT                   /orf_name="Pc14g01120"
FT                   /product="Pc14g01120 protein"
FT                   /function="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing) activity"
FT                   /function="sugar binding"
FT                   /biological_process="carbohydrate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP74253.1"
FT                   /db_xref="GO:0004360"
FT                   /db_xref="GO:0005529"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016051"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniParc:UPI0001831795"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5U0"
FT                   /transl_table=1
FT                   /translation="MCGIFGYINYLVEKDRRFIIDTLLNGLSRLEYRGYDSAGMAVDGN
FT                   KKNEVCAFKEVGKVAKLKELIDQSSYDMTKTFESHAGISHTRWATHGTPSRQNCHPHRS
FT                   DANWEFSVVHNGIITNYKELKALLESKGFRFETETDTECIAKLAKYLYDQHPDIEFTVL
FT                   AKAVIKELEGAFGLLLKSVHYPHEVIAARKGSPLVIGVKTSKKMKVDFVDVEYSEDGVL
FT                   SAEQASQNAAAKKSATSLLAPPDKSLLHRSQSRAFLSDDGIPQPVEFFLSSDPSAIIEH
FT                   TKKVLYLEDDDIAHIHEGQLNIHRLTKDDGTSNVRAIQTIELELQEIMKGKFDHFMQKE
FT                   IFEQPESVVNTMRGRLDVANKKVTLGGLRQYISTIRRCRRIIFIACGTSYHSCMAVRGI
FT                   FEELTEIPIAVELASDFLDRQAPVFRDDTCVFVSQSGETADSLMALRYCLERGALTVGC
FT                   VNVVGSSISLLTHCGVHINAGPEIGVASTKAYTSQFVAMVMFALSLSEDRASKQERREE
FT                   IMEGLGQISEQFKQILKLNDPIKDLCAKFFKDQKSLLLLGRGAQFPTALEGALKIKEIS
FT                   YLHCEAVMSGELKHGVLALVDENLPIIMILTRDNLFTKSLNAYQQVIARGGRPIVICNH
FT                   DDPEFSSALTEKINVPKTVDCLQGLLNVIPLQLISYWLAVAEGLNVDFPRNLAKSVTVE
FT                   "
FT   CDS_pept        join(271569..271795,271927..272326)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000229253" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943339"
FT                   /orf_name="Pc14g01130"
FT                   /product="Pc14g01130 protein"
FT                   /function="riboflavin synthase activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /cellular_component="riboflavin synthase complex "
FT                   /protein_id="CAP74254.1"
FT                   /db_xref="GO:0004746"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="GO:0009349"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="UniParc:UPI0001831796"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5U1"
FT                   /transl_table=1
FT                   /translation="MVKANNSPWRDAPANTDSTTGSGLRVAIVHARWNTVIIDQLVAGA
FT                   KKNLLAAGVLEENITVQTVPGSYELPLAVQRLYAASQLQANSSVQGISATDLLSSPTAE
FT                   VTGSANAASPKKPFDAIIAIGVLIKGATMHFEYIADAVSHGLMRVQLDAGVPVIFGLLT
FT                   VLTEEQGLERAGLGNSGMHNHGEDWGSAAVELGLKRRDWAEGKIL"
FT   CDS_pept        join(complement(273711..273713),complement(273348..273506),
FT                   complement(272904..273230),complement(272514..272840))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000091086" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976490"
FT                   /orf_name="Pc14g01140"
FT                   /product="Pc14g01140 protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="CAP74255.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI0001831797"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5U2"
FT                   /transl_table=1
FT                   /translation="MVEYAVKAVENGGTAVGIRCKDGVVLAVEKIITSKLLKPGANKRI
FT                   ATVDRHVGIVSAGLVPDGRHFVSRARDEASSWRSTYKGPIPTSAIANRLGGYVQAYTLY
FT                   SSVRPFGVTAIVGGWDTEAELPVDGQVGNGPKSGSGGKVEGAKAGGPGLYMIEPSGLYW
FT                   GYYGAATGKGRQAAKAELEKLDLSSGNLSLADGVKEAARIIYVAHEDSKDKEFELEMTW
FT                   ISSVDGPTKGRHEEVPKEILEEAEKAAKRALEGDDEEEEDKGEGEQMEE"
FT   CDS_pept        join(274330..274428,274490..275134)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235090" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943340"
FT                   /orf_name="Pc14g01150"
FT                   /product="Pc14g01150 protein"
FT                   /protein_id="CAP74256.1"
FT                   /db_xref="UniParc:UPI0001831798"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5U3"
FT                   /transl_table=1
FT                   /translation="MSSSILHQCPQCGHVSDISNALAAFIENPHCKQCGMSASESDSKV
FT                   QDELSALFDTQMSMTQLHPTPRETTVPSQVPEIAYSITQHYHHSAHRVAQQTNQPSSID
FT                   LLRHHGLDPSALTSQQIALFENADAEQKERLLQTWQLYSQLGKEASAPAADFAMQDSAM
FT                   DDSGDMNAYVDAEPYMVSGYENVADRASHIPKEPTTGETYVGSKDPVYQGPQWWELTKA
FT                   GPMESNYGAFEEMRRYYPSCGVYHW"
FT   CDS_pept        complement(275732..276067)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181665" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943341"
FT                   /orf_name="Pc14g01160"
FT                   /product="Pc14g01160 protein"
FT                   /protein_id="CAP74257.1"
FT                   /db_xref="UniParc:UPI00017177A3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5U4"
FT                   /transl_table=1
FT                   /translation="MKFTSVVVAVIAAGTVQAAALAPSETLPKWCGHIGQGCKRTTDAS
FT                   LDVKRSADALAEAMAGGLPLVLQKWCGHIGQGCYKAKRAADAVDEVKRTSDALARAFAA
FT                   LEEEDDE"
FT   mat_peptide     complement(275735..276013)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5U4 "
FT   sig_peptide     complement(276014..276067)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5U4 "
FT   CDS_pept        join(276892..276921,277043..277100,277161..277235,
FT                   277303..278206,278259..278346)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000021113" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976491"
FT                   /orf_name="Pc14g01170"
FT                   /product="Pc14g01170 protein"
FT                   /function="NAD+ or NADH binding"
FT                   /function="isocitrate dehydrogenase (NAD+) activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAP74258.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004449"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004434"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="UniParc:UPI0001831799"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5U5"
FT                   /transl_table=1
FT                   /translation="MFSRTAQPARTLLRSASAASSLGRSIPARTFASVQSDIFKPTKYG
FT                   GKYTVTLIPGDGIGAEVAESVKTIFKADNVPIEWEQVDVSGVDAGNKHSEELFRESLAS
FT                   LKRNKLGLKGILHTPIERSGHQSFNVALRQELDIYASISLIKNIPGYETRHKNVDLCII
FT                   RENTEGEYSGLEHQSVNGVVESLKIITRAKSERIAKFAFSFALANNRKKVTCIHKANIM
FT                   KLADGLFRSTFHKVAEDYPTLEVNDMIVDNASMQAVSRPQQFDVMVMPNLYGGILSNVG
FT                   AALVGGPGLVPGCNMGRDVAVFEPGCRHVGLDIKGKDQANPSAMILSGSMLLRHLGLDD
FT                   HANRISKAVYDVIGEGRTMTRDMGGQATTHEFTRAVLDKMEASL"
FT   sig_peptide     join(276892..276921,277043..277081)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5U5 "
FT   mat_peptide     join(277082..277100,277161..277235,277303..278206,
FT                   278259..278343)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5U5 "
FT   CDS_pept        join(complement(279810..279832),complement(278911..279730))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111527" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823297"
FT                   /orf_name="Pc14g01180"
FT                   /product="Pc14g01180 protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAP74259.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR022238"
FT                   /db_xref="UniParc:UPI000183179A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5U6"
FT                   /transl_table=1
FT                   /translation="MSRPEDILPPDLFYNDNESRKYTKSSRIRNIQANMTSRALELLDL
FT                   KSPSFILDLGCGSGLSGEMLSEVTPEEGGPHTWIGMDISPSMLDVALQREVEGDLFLAD
FT                   IGQGVPFRPGTFDAAISISAIQWLCNAETSDVTAEGRLRRFFEGLYASLRRGGRAVCQF
FT                   YPKNDVQRSMISGAAIKAGFGAGILEDDPGTKSSKLYLVLTVGGGGLTGDITGVVNGMD
FT                   DVSVLDARRKAAEINNARGPPRKGDKAWILHKKEQMAKKGKVVKASSKYTGRKRRIAF"
FT   CDS_pept        join(280041..280110,280170..280786)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000116065" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943342"
FT                   /orf_name="Pc14g01190"
FT                   /product="Pc14g01190 protein"
FT                   /protein_id="CAP74260.1"
FT                   /db_xref="InterPro:IPR007277"
FT                   /db_xref="UniParc:UPI0001831869"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5U7"
FT                   /transl_table=1
FT                   /translation="MWILPLVGYFGVVVGFAFLTLSIASGLYYLSELVEEHTVLARRLL
FT                   TRLIYGIAGIQVLLMIIDRFPVSLSLLSIASHMVYASNLRRFPIVKLSDPLFILSCLLV
FT                   GLNHWLWFRHFSKPLPTSNNWRQPYGVNYDEMPSFSEVASYFGLCVWLVPFALFVSLSA
FT                   GENVLPSMGSEYATGERAKPTGLGPSDGKSKNKGMAKALVDGVRDWTRETGELMGFWRG
FT                   ESTRRF"
FT   sig_peptide     join(280041..280110,280170..280177)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5U7 "
FT   mat_peptide     280178..280783
FT                   /db_xref="UniProtKB/TrEMBL:B6H5U7 "
FT   CDS_pept        join(complement(286043..286070),complement(285522..285731),
FT                   complement(282081..285476),complement(281422..282027),
FT                   complement(281337..281362))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181676" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943343"
FT                   /orf_name="Pc14g01200"
FT                   /product="Pc14g01200 protein"
FT                   /function="GTPase activator activity"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP74261.1"
FT                   /db_xref="GO:0005096"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000183186A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5U8"
FT                   /transl_table=1
FT                   /translation="MPGRLCTTNTRNPLFPSPPLRFLKLSHPLHSHSLCHQGVCSPLFS
FT                   FELVDRSRIPLSSSLALKLKLPGFRAFAPWVFASSMSQVPRENDESSPTSYKNQSSYPV
FT                   NNGLIPRDYLARSDQRPGPAPGSRHIAPSPLHTSSLPQSYRVDGSTSSQSPLSPKSNPS
FT                   SQDRSPISRVANAPYSAPPFSTGQSLSQSPEMVGTESANASAQPGERNTPKQSRAPEPD
FT                   RSASSSVSSIHSMPGDRAPNRTMPRTSSIDSAISSLSSNSQRSTFDVNALSPADINNLI
FT                   NAAGSAEAVIVHLLKEKHQAASQNAQLWKLVDKQRTLILGLNKDLERAFQEKDKYRKKL
FT                   KDIQDAPPLPVAEPMASVAAPSSDKEKPSRKPDPPSIAPPSEASRRGFENTTSPVSATD
FT                   IPSPVGDGKSRFPHPSRKPPPAPLNLRQADNKRASSASDTDSGSDYGDSENRNGIPSAD
FT                   RGRRKTREQDDQDREAALQKDMFGSTGSVGLSQTSSSHTSRDTATCSPEMVPRELSTRS
FT                   PPNVGDSNSLGSLLGARPPPASSFNGRSIAAMPMSPGLPLSPRPEDRPINSPMPRMPRD
FT                   MATSMASGHQAPIPLSPRMANHPTGFAPIPSGRPNGPIPSIDPTVMIDSPRSPNFPDNQ
FT                   IYRGLMSDEYQGLLLPPNALPLVQVRVSSSRLRPSRNSYMASKPLDEEPVFTLSVILRS
FT                   EMSELWRVEKVIGALPQLDQKVRQSSPFPGKLPDRSIFSGHSPAKVDLRRAALNAYFDK
FT                   LLDTPMDENAALAICQFLTSDAIEPRDDETSLLKGIAQARPDMPRGPDGKPRKEGYLTK
FT                   RGKNFGGWKARYFVLDGPELRYYESPGGPHMGTIKLHHAQIGKQSPKSTENTSASGTDE
FT                   DSDNQYRHAFLVLEPKKKDSSALVRHVLCAESDEERDTWVDALMEYVESASSENEGRGS
FT                   VSSKSQAPSQDEFQTQQKQPVSAAESKSKKLNNGSKRSGRGVDSPDQDIGVSVQGFSFD
FT                   DAVQADPPTIGSTLEQAPRSPRLPAALSTEFKDMAMSSSDQALQSPRLISRPTNGTVIQ
FT                   DVEAWGNKAKTSTKEKKRSIWGFRTRSSFDLAAQASNDTAVASNPVERTGPVRPVFGIP
FT                   LAEAVQDCGPPGIDVELPAVVYRCIEYLHAKEAALEEGIFRLSGSNVVIKALKERFNTE
FT                   GDVDFVSGDQYYDIHAVASLFKQYLRELPTTVLTRELHLDFLRVLELDDRQKKVAAFNS
FT                   LVHRLPRPNLALLRALSQFLIEIVNNADVNKMTVRNVGIVFAPTLNIPAPVFSMFLTDY
FT                   DSIFGDTDSSFAKPPTELTVENTLSADDIRSPRHQMFSDLPTPSYQQTSFRTTGDVNGP
FT                   SDGPRTHHDTGFTPMQPSYDQPTSSRHEQYNQPPGAGASYSSLNGMLGPNSEDTRSAKT
FT                   KRRESSMLFMEDPSFYQGK"
FT   CDS_pept        join(complement(287794..288541),complement(286540..287741),
FT                   complement(286351..286482))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181687" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127585"
FT                   /orf_name="Pc14g01210"
FT                   /product="Pc14g01210 protein"
FT                   /biological_process="mitochondrion organization "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP74262.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0007005"
FT                   /db_xref="InterPro:IPR012571"
FT                   /db_xref="UniParc:UPI000183186B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5U9"
FT                   /transl_table=1
FT                   /translation="MSANLGRRLYAHIWDTANPIVGRIRMNRVSAPDAYTSRLFLDSSL
FT                   PNHSRRISTLPAKPARFTKRFASGGFFVLGVSPTSTAADTTASCIISSPKIAAQYVWKR
FT                   TLHTSDGHQRGEQASKDTHERNENDRPQTLGQSGKDTSTTHSQTKLSQDTQQSTTNSRH
FT                   LMDRLPHMPHLHRPTKEELLAAATGFWSRLKVRFKWFSIRSVRPYNLDEIAALFSWVLL
FT                   GHIVWVVVGTTTFFSLLILAINTVFAQETLAGWVGNYLTKSSGVKVVFESAIVPKWKNG
FT                   VITFKNVFVSKRPGQGAGHVSKGSSKSAAAAAAARGDTGLEDSQVVSDEEEDTNYTQFD
FT                   LSIETVNVTLSFTKWLNGKGPLHDVEVKGIRGVVDRRHVYWPEEDLDPKSYRHEHTPGD
FT                   FEIDSFKMHDLLVTVYQPDNFRPFSVSIFSCDLPQLRKQWLFYDFLSANMMSGSYDNSL
FT                   FTIHARQTHGFTGIRQDSEVDEDGKPSPWKKHNRIRVDGLNIDHLNRGVEGPFSWIHEG
FT                   TVDIVADIMLPAENDESLAKVMVDFYDRLETTVTTNRYPEPLSSSSSPESETEDRRFLA
FT                   MDLRVHLNNVRAVVPIFTRDLSYINNALIRPIVAYINSKRTFIPINCRLVKRVGDFDGS
FT                   WTVFDSGLMDDLSAATYDAFARDVVDDQARKRRFKKVGFWSLQLAAQAIFMGMAGNIA"
FT   CDS_pept        join(288815..288884,288938..289578,289631..289687)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976492"
FT                   /orf_name="Pc14g01220"
FT                   /product="Pc14g01220 protein"
FT                   /function="RNA binding"
FT                   /protein_id="CAP74263.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000183186C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5V0"
FT                   /transl_table=1
FT                   /translation="MSAPTAIRQSEQPLGVQPETISHDQDDEVLIDVQATNEDAPINPV
FT                   AETAGDSEMRIDEEGRPVFTPAKDVATAYRIETRKVPVPPHRMTPLKASWAKICPPIVE
FT                   HLKLQVRMNIKSRSVELRTSKFTNDVGALQKGADFVKAFTLGFDLDDAIALLRLDDLYI
FT                   QTFEIKDVKTLNGEHLGRAIGRIAGKDGKTKFAIENASRTRVVLADQKIHILGGFKNIH
FT                   IAREAIVSLILGSPPGKVYGNLRTVASRMKERF"
FT   CDS_pept        join(complement(290657..290748),complement(289915..290602))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000091081" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943344"
FT                   /orf_name="Pc14g01230"
FT                   /product="Pc14g01230 protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="CAP74264.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI000183186D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5V1"
FT                   /transl_table=1
FT                   /translation="MTSLMGNHSGTIGYSFSEPTSANVKQHSFYPYTDNGGSTLGITGA
FT                   DFAILAGDTRSTSGYNINSRMVPKVFKIGGDDETGEGANIILSVVGFAADGNALKEKLD
FT                   TMVRMYKYQHGKSMSVGACAQRLSTILYEKRFFPYYVHAILAGLDEEGVGALYSYDPVG
FT                   SYEREQCRAAGAASSLIMPFLDNQVNSKNQYIPGSGEGHALVPKKAEPLDKETATKLVK
FT                   DAFTSAVERHIEVGDGLQLVIVTREGIEEVFHALKQD"
FT   CDS_pept        join(291100..291174,291229..291277,291360..291913)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943345"
FT                   /orf_name="Pc14g01240"
FT                   /product="Pc14g01240 protein"
FT                   /protein_id="CAP74265.1"
FT                   /db_xref="InterPro:IPR012479"
FT                   /db_xref="UniParc:UPI000183186E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5V2"
FT                   /transl_table=1
FT                   /translation="MLGLGDYESSSEGEAERKGHSPSSQRNKDIPPIASQAGQNEGRKP
FT                   SLHQPKETRSHVASDSVPEGPVLGPAAIDMAPLSEDKHSTSGRSSPFSASRSLVQDLTL
FT                   PPVPNLDIPPSPPGSPNPAANAKFEHFLSLKKQGVHFNSKLACSSSLKNPSLLKKMMKH
FT                   AGINEQSQYDTSLPADLWNPSDLPKWGFKEELLRTQQDFRKQSEEKKASGQRSSVDFVT
FT                   GSA"
FT   CDS_pept        complement(292347..293030)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186475" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943346"
FT                   /orf_name="Pc14g01250"
FT                   /product="Pc14g01250 protein"
FT                   /protein_id="CAP74266.1"
FT                   /db_xref="UniParc:UPI000183186F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5V3"
FT                   /transl_table=1
FT                   /translation="MSSPGSSRAGSTASAPPIDDNVPSRVYNITNQFFRRHYDINSADN
FT                   QPLFYGEVSEFTPNKPDLILHAGTSSKGPIVAVSKFAKSSGDYKIGIGNTDDVNAVQWE
FT                   DMTKELIRKPKYRFEMTVQCESDQTQSGRRSFLWKRTRTIGVEDSAPSKWTGQNYKLVD
FT                   EHTEQLLAVFSGAAGLERGGKLQIRVEYGEDFDRMALVTCLSLYEKAKRRKHRAGGGGG
FT                   GGGGG"
FT   CDS_pept        join(293518..293547,293600..293747,293821..294425)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181719" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943347"
FT                   /orf_name="Pc14g01260"
FT                   /product="Pc14g01260 protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="CAP74267.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR016295"
FT                   /db_xref="UniParc:UPI0001831870"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5V4"
FT                   /transl_table=1
FT                   /translation="MNHFPEAWGRPRNDVYGAYDHSYLQTSGPKAHTSSPAVTGTSVVG
FT                   VKFNGGVAIATDNLASYGSLARFSDVKRLRNFGDKAMVGFGGDVSDMQYLDRLLDSMDI
FT                   KENYSHHGNMLNAKNLHTYLAKVFYKRRSEFNPLWNHVLVAGFDGQGEPFLSSADLLGT
FT                   TFSAPHLATGFGAHLAVPILRRKFPEGTPLEQVSKEDAVEALKECLKVLFYRDARSADK
FT                   YSIAVITKDGIDLKEDEQIQGQSWAFAERIRGYGAQTA"
FT   CDS_pept        join(complement(295675..295689),complement(294804..295525),
FT                   complement(294608..294740))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000063755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823298"
FT                   /orf_name="Pc14g01270"
FT                   /product="Pc14g01270 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP74268.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniParc:UPI0001831871"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5V5"
FT                   /transl_table=1
FT                   /translation="MSTFTRLIRFLAKDGQIYYGDALLPSGVSDIAKATKARVIQGDIF
FT                   GQHRITDQVADVRMLLAPLARKDIGTVRCLGLNYEQHAKESNMPIPKYPVLFYKPVTSI
FT                   SGPGDDIPVAQLAQEGEGLDYECELVAVIGKEATNVTESKALDYVLGYAVGNDVSHRDW
FT                   QIKRGGGQWGLGKGFDGWAPFGPGIVSSSVIADPNNLAISTKLNGQTVQSSSTKDMIFG
FT                   VAKTIAFLSQGTTLLPGDLIFTGTPQGVGMGRKPALWLKDGDQVEVSLEGVGSCVNRVV
FT                   FDKPSSKL"
FT   CDS_pept        join(295855..295939,296117..296277)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235089" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943348"
FT                   /orf_name="Pc14g01280"
FT                   /product="Pc14g01280 protein"
FT                   /protein_id="CAP74269.1"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniParc:UPI0001831872"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5V6"
FT                   /transl_table=1
FT                   /translation="MARLSGLQRDVLSLYRKCLREIRNKPEVDIGTIRLRRDIYRAEFQ
FT                   KHLSVNKKDFSTIEYLLRKGHRQLELYATPGIRNIR"
FT   CDS_pept        296963..297577
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000251751" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127586"
FT                   /orf_name="Pc14g01290"
FT                   /product="Pc14g01290 protein"
FT                   /protein_id="CAP74270.1"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniParc:UPI0001831873"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5V7"
FT                   /transl_table=1
FT                   /translation="MAFFSQSGLSPLFLLNDYEAPNQYKPRKCPKSYQCSKLQARSSFA
FT                   PAFDVREFTNAYHLDGELPGVDQSNIEIEFTDPHTLVIKGHTDREYNSNNGNNDATSSR
FT                   SSSPAGWHQATVEDEDAESTSSADTAASKTASASASHTEKTETDKPHFWAKERSVGDFQ
FT                   RTFSFTARVDQDSVRASLKNGVLSVVVPKEPTPTPKKIPIL"
FT   CDS_pept        join(complement(301393..301482),complement(301205..301354),
FT                   complement(300947..301002),complement(298293..300399))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943349"
FT                   /orf_name="Pc14g01300"
FT                   /product="Pc14g01300 protein"
FT                   /protein_id="CAP74271.1"
FT                   /db_xref="UniParc:UPI0001831874"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5V8"
FT                   /transl_table=1
FT                   /translation="MRLEEAIPPYPVSGCRCSAVNAVCQDTGLRKYWKINPILKKRKRE
FT                   RKADCGGPDIEGEEEKQWSCGRLLGVPRGIWYFVDRLVAYTLRLSDSLSTSYVSPRSPR
FT                   RAGEQCSPGCHQALILLVYHSRHLPCTCPVGSGQSKSESTCIASAFEVMGNTHSTKAKD
FT                   ETYRSNRLSKPLTKKFNAGPSSQRPETDLPTLNSGLIGWQNPWVGNSISSAPVEKRGSY
FT                   PKKAEIPPTLFETESSEESPTEDRTLVYEQSPTQRHLTRPSLLSASSSRRTSYQSETCS
FT                   SSQSSPLYEQPPRRASSTRTPLQRHNSAVYETHIGDATSSNTHFLVGNQRFSLTRRRSL
FT                   LTRPGVATRRTASAIRRVPSPIGEPECPIEDPTESTVLQWPLPSTPRSLRLPSPVRPPS
FT                   PMDARYTQLGALKLGSLRVVNGSASPCPSERVPLDGPCAPGSGLGLENIEVVGPSRGST
FT                   LEIPSLPDVKKTDDVPGSPFSFEKSPTITVQPRTKSLSSGDPEDEGIALFDDTRIQLEK
FT                   GVMDAGLTRSTSQSLNKSDSGYSSATSVHSIQRSRTHSSSGSQTSSSCGADSSKNVCTP
FT                   KDSASGRSGDQVQRPLSLQTKPENYSRLYPAAARWYDSSDPNPLAPSRSRRSTLCAPRY
FT                   TEYSSPRESLFEVTSTTVVSAPHQTPKGFTRGPFYGDRLSLGSFDLASSTGSAATGDSQ
FT                   LSRQQSTTEAKERLRRSTSEYQIHEEYNAQLSRSRSRRGSRIWSKKPGVDVPPLPTVAA
FT                   PGYLQDDLDLDAELTPSEPMRGRSRSRNNDHPRRRLTKVRRQTDLCL"
FT   CDS_pept        join(301481..301609,301711..301812,301871..302083,
FT                   302144..302317)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000004746" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127587"
FT                   /orf_name="Pc14g01310"
FT                   /product="Pc14g01310 protein"
FT                   /protein_id="CAP74272.1"
FT                   /db_xref="InterPro:IPR007135"
FT                   /db_xref="UniParc:UPI000159302E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5V9"
FT                   /transl_table=1
FT                   /translation="MAAFCSAFPFLTQSEFEGACQDLADRCTSAQHIDWSAIRLLTKPD
FT                   GTSLRITKRVDVPSPLEAPALDLEESQEDEDPEALVRAKPQPSLQIDYDILLSPTYQVP
FT                   VLYFGLRWHNHGPLGLDEVYQYVVPEQYRQQLKSVGVMGGISMGYHPDSGAPAFFVHPC
FT                   NTADAMANIADAQNVTPGSYLLIWLGLVGHCVNLHVPRELYA"
FT   sig_peptide     301481..301528
FT                   /db_xref="UniProtKB/TrEMBL:B6H5V9 "
FT   mat_peptide     join(301529..301609,301711..301812,301871..302083,
FT                   302144..302314)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5V9 "
FT   CDS_pept        join(complement(304199..304272),complement(303924..304140),
FT                   complement(303591..303866))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181731" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670519"
FT                   /orf_name="Pc14g01320"
FT                   /product="Pc14g01320 protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP74273.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001831875"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5W0"
FT                   /transl_table=1
FT                   /translation="MASKSLPARGGPDSKAVTPGAPNQTLYCTNLPDKRIQKNDLRTAL
FT                   YSLFSTYGTVLDVVAMKTSKMRGQAHIVFKDVQASTQALRALQGFEFFGKQMKIVYAKG
FT                   SSNVISKLRGTYVAPVEAAQAPVITDLQKSIFSGPPGALPPRPTAGANGETHGLKRPRE
FT                   EESDNEEAPMDEDSDVPMEASSDEE"
FT   CDS_pept        join(304533..304755,304820..305406,305458..305695,
FT                   305752..305792)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181752" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127588"
FT                   /orf_name="Pc14g01330"
FT                   /product="Pc14g01330 protein"
FT                   /function="actin binding"
FT                   /biological_process="regulation of actin filament
FT                   polymerization"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="CAP74274.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0030833"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017383"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001831876"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5W1"
FT                   /transl_table=1
FT                   /translation="MAAHQVHHLFHAPIADHSFSSDKKTLAVARENNVELYQQSGNKFA
FT                   LSDELKGHEKTVTSVDIAPNSGRIVTCSQDRNAYVWEQTPTGWKPTLVLLRINRAATFV
FT                   RWSPSEQKFAVGSGARVIAVCYFEEENDWWISKHLKKPIRSTITTLAWHPNSVLLAAGS
FT                   TDSHARVFSSFIKGIDTRPEPSAWGERLPFNTICGEYLNDTAGWIQGVAFSPSGSALAF
FT                   TGHDSSVTVVYPSAPEQPPRAMLNIATRLLPLNSLIWNGETEIIAAGHDCEPFRFCGDE
FT                   NGWQLAGSLENKAGEVRGAREESALNMFRQMDLKGQAQADTKLKSTHQNTVHTIRAHEE
FT                   ANGVVSSFSTSGVDGRVVIWNV"
FT   CDS_pept        join(306186..306407,306480..307478)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181753" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943350"
FT                   /orf_name="Pc14g01340"
FT                   /product="Pc14g01340 protein"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP74275.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI0001831877"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5W2"
FT                   /transl_table=1
FT                   /translation="MASILFLSLLLYISTLSPATALSKTIHVSNELFNSLEELSRIVDI
FT                   SYCVGTTGVHQPFQCLSRCIEFPDLELVTTWNTGLLLSDSCGYIALSHSPSSKQIILAF
FT                   RGTYSITNTIIDLSAYPQAYIPYPDPEENTTTTPNPTSPHCENCTVHAGFMRSWLETRP
FT                   TILPQISILRQKYPDYAITLVGHSLGGAVAALAGLEMRLKGWDITVTTFGEPMIGNGAL
FT                   AAFIDEQFGLGDGISIPPLDPLDGGMRFRRVTHVGDPVPMLPLAEWGYRPHAGEVFIKR
FT                   EGLPPRREDVVHCLGAVDPGCIAGEGVEGVLVELYRDLNVVGLAGSGGEGRRSSDGDGD
FT                   SDGVSEEQAVLGGESSDIAGCEDRLSPLRWDWSHIPARYRLWELFYAHRDYFWRIGLCV
FT                   PGGDPTG"
FT   sig_peptide     306186..306254
FT                   /db_xref="UniProtKB/TrEMBL:B6H5W2 "
FT   mat_peptide     join(306255..306407,306480..307475)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5W2 "
FT   CDS_pept        join(complement(309151..311696),complement(308492..309098),
FT                   complement(307891..308430))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181767" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943351"
FT                   /orf_name="Pc14g01350"
FT                   /product="Pc14g01350 protein"
FT                   /protein_id="CAP74276.1"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI0001831948"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5W3"
FT                   /transl_table=1
FT                   /translation="MSGSSRALHPEELFLNDRPARQESPTVGPLRINKRDSSSPASAAG
FT                   SSPPPNAPLPYPDDRQRPQMRTSSSNDRYHDNVRYGSPPAGPGSGSVSPNEYPTALRPR
FT                   DGREPRVATLAERRGAAPKPLPESPSYDAPDREALAARPYPRPPASQPPGPPEPPANTN
FT                   QYDYRQQYYPPPQRQSSTSAARPPSSLQPPQGPLNRISSTSTTRAQRGSPPPPETPVVG
FT                   PGQQPGSDIEARYAAAGIAGTGTLQGIQSHNVAAQRRAEQYSGQQPTFPPQQQPRPWTP
FT                   TEQPGSQPHGPPTVYQGGEVVSDDNQPAAAHPGQYGSPPPQIPGSYGTPPPQVHPGQYS
FT                   SPPPQAHHSQYNGSPSQSHPAAGLQQQQQQQPGRIPPNALEQDMDRMRLSSSPPPAYSS
FT                   VSGPSAPNGYPNEKQSGAAAAAAATGAAAGAGAALMHPALANQPNPVTKTSSPVPAVSP
FT                   QDHPAFANDQRQQQQIGQSPQASVANDLSGFHHQTVQVTPPGPSAAGPASPPPLPEGWI
FT                   AHMDPSSGQYYYIHLPTQSTQWEFPKGPTPLNLNDTPLSPVGSVYSAHPLVSPGLSAFG
FT                   KPLASPGVPLTPGFESLQSPMVTGFTGPPPSSGVDLYKNTPTNGVYFGPYLRYTNMDIE
FT                   RGIWLGSILLVTDAAQPPTIHMHQSLDLSPNPRQLKAVNIAAHQRWTFYKYEVDLQMDD
FT                   AGPAKWTYAITSHLGCTRYEFLVAGRHETNWRFIATSGNDFSLNVNAGERARLGGVGYM
FT                   WKDIMQKHNEIGGFHAQLCLGGQIYADRMWKEIPSLKQWLTISGKEARKNAPWTAANQQ
FT                   DVSHAYFHYYTSHFDQPHIRESFAQIPYVCQIDDHDIFDGFGSYPEHMQFSNMFKNIGR
FT                   IGIEMYLLFQHHTTLDILRNVSNDMDLFTITGTGWHFVKYLGPGVVVVGPDCRSERNPH
FT                   QVMAGPTYQGLFPKIAMLPPSVQHCLWMVSVPLIYPRLETAEHIVQTVATGKRAVTGAY
FT                   NVLGKVTSSVAGVVGAKEFVGSGFDSVKRAVGKSGLMGGILSPFGEFNSMDELRDQWTH
FT                   ESKDLERTYLIRTLQGIAHQKSIRMTFLSGAVNVCGAGLVHDPSNPSDHKTMYQLIASS
FT                   VVNTPPPSYIIKLLHSHSKPLYVPANGHRSSGQVSDTKEDMMEIFQTDVNGQAREYRKL
FT                   MARRNYVAIVAYDPETVNPSYGHVTPGGVSKLSLAADFMVQGDGALGNVVKFGPVIVPS
FT                   LDHGR"
FT   CDS_pept        312054..313493
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943352"
FT                   /orf_name="Pc14g01360"
FT                   /product="Pc14g01360 protein"
FT                   /protein_id="CAP74277.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001831949"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5W4"
FT                   /transl_table=1
FT                   /translation="MRTLMCADDMAWECAENISHNWLLQFLKLDIKKPIAMFILQRHRG
FT                   DGAEFTILEKGSYNISLRMKYEKNHAVVIRLAQPGAVFFPEEKVVNEVATMRLLTDQTS
FT                   IPVPFILGSGTKKESPLELSPFIMMEYIEHKTNMYDALNTPGCPKKDRGILDPNIDVNT
FT                   LELLYDQLVGVLLQLSKISFPRIGSLTQVDDFTWEVSRRPLSMNMNELVRLGSLPRSKI
FT                   PHTTFSTASCYFEALADLNIEHLVHQRNDAVESADDCRRRFIARQLFRKLAREKRLTDS
FT                   TFEQGPFKIWCDDLRPGNILLHENMQIAGVVDWEFTYAAPVEFSHAPPWWLLIEKPELW
FT                   PNGMDNWEDVFSHRLKTFLRVMRSREDTEIQKGHINENQRLSSHMQWSWDSGNFWIVYA
FT                   ALNSFAFDAIYWKKIDPLFFKAAGSPETAWKERLDLLAEKEIEEMEQLVVRKLEEKETR
FT                   VLKWDPDEYTVEAKAKAAEVG"
FT   CDS_pept        join(complement(316162..316337),complement(316095..316104),
FT                   complement(316003..316012),complement(315909..315940),
FT                   complement(315729..315849),complement(315039..315667),
FT                   complement(314275..314979),complement(313776..314198))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181778" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943353"
FT                   /orf_name="Pc14g01370"
FT                   /product="Pc14g01370 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP74278.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000183194A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5W5"
FT                   /transl_table=1
FT                   /translation="MTASLVQNRRKVSAKPLRLPIIAPKEDPEDLFDVFAKSEKALSAP
FT                   PRIRLPPRSRTGCWTCRSRKVKCDEGHPQCNQCTRLGHTCDYRPRLAFRDDTPRIMGRM
FT                   ADVKTNGHVVWDLTSPSSNDERTDYFFSKDSLPPFSLLTSDEDREKKAEGVSPGTYLVV
FT                   MTPDSFSSLPEYADDAIEKARSNSTSERRSSAASSPASAAKGDDPNVVILKTFEDVTRR
FT                   SPSNGKTLGISPTSEISDPFCNLSLSPNFTSLPSPDVKVEEMAFLDPRLDRQGQDCTIF
FT                   SHFRQVIWRQLFPHDHRLDDSCGSDSHFMTLSMDFLEQEATRFPPLSHAMMAVSALSLS
FT                   HSGTGHNVDALQYYQQAFPSLQVSLRNNDDLVSDGLFLTHFLLLIYEIAAAEPHGSNLW
FT                   SHHISRLLHIAFLRRAKYGQEPHPFILWWVCHIDLYALFSGAGTGEFVRAVIDHQMLPG
FT                   SECLLYPSAPEGYSVIYSDEHESLPVLMRLYHDTFRLAAQLGFLAIRLRHDRRNLPFEE
FT                   FDKRSHELSDLRRAFGRLWESPDVAFVHQHQDNLPRRSREIMQQSATLYHVCQLFSYSS
FT                   MWPGQRVESEYPPDAEIDHHATEILRLAQQTTHTRRADRHFLVFPLFLAGATASASGIK
FT                   LTAMELMTSMEYEEDGLGRNAATTRAILQIVYERQLERLMHMGHTLDVDWSDLMAQEGL
FT                   QMVNFGF"
FT   CDS_pept        join(complement(318357..323264),complement(317983..318259),
FT                   complement(317485..317873))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181789" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670520"
FT                   /orf_name="Pc14g01380"
FT                   /product="Pc14g01380 protein"
FT                   /function="binding"
FT                   /protein_id="CAP74279.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000183194B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5W6"
FT                   /transl_table=1
FT                   /translation="MADSQSPEARELSLIGKVEFRIAMADTDEKLQSLLGTYLPPLLLK
FT                   LGSESVEVRNKIISVCQHINTRVKTPSIQLPVASLLKQFKEQNSQLIRHFDLIYAQQGI
FT                   DRLGSEARVEILLPLLQGISKIGTSPTQGAIVFNLVLRLLPLLKLPAKGSEEDQQLKAR
FT                   LGLSDEDSEFLSFWLAKLLLLTPGPKETSTCPGLSPDEYSFLNKGAPANETWNPSTDGG
FT                   LNLTETKVTALRFIGSGAFKDPQRFLPSLIASADANSRLADLGDETLKRFTADIENPNV
FT                   VQELYDLYFGSGGAPPARPPLQVKLLVFLGKSIKATANPQRVLRLIEDGLLSDSARSSQ
FT                   GLQASKLRTQIFTFTTWVVRMGAPSDLKQIAPIIIAGLRDFIQSQGWPSPAASGQKLPT
FT                   TDLSLRGLAYESIGIMVPKVDFMSQADAVENFEFDLVRWLFASLSADDSSPEIFVSIDQ
FT                   ALGSILNSSLDSHDKTFQDQLRPFLVRQMSMQPGDIDPDTGYRAVRGVQYAAVRFANRF
FT                   LPFGDVVARWIDLIAIARGPERQQEIVEEGRKGLHPYWYRLLNPAKDGKWSASSAAPVQ
FT                   DESWFDFPKFDEATRFLLGSGGQEQHLNVQALSASQLLSGSYKGSFMPAISFLRNTLLW
FT                   EAFSASGVAADLEQDWDYKLEVLLSTSVEARAAVRQYIREAAKESVLAFLSGTLEGLVT
FT                   GEREGLRQCGVHFVEICSLAPNDVVQHLIPRAASLMEPICSNNQDNQGITARAFGILVS
FT                   HPAFSEDQLKSFITQLTATIQSWNTAVGQEVMRVRGAILALSYLLSRLAYRGLASRAPE
FT                   AQTKQFIETLFDILDVSRDTLLQRTAQEAIGQLSLSGVLSLDIITEEGWKKILEKLSRD
FT                   AKTENQIPIRSLGLLTLTFSRSGSDSILFSDFLGSLYSLHEIRSPEVQFTVGEALSNVA
FT                   VGWDSRALIQDFDIDGEFPHSDVPRSVFELICDKVIADCIAPKPSLRKASAIWLLSLVK
FT                   NCGHMQKMQERLRKCQATFSSLLGNRDEVVQETGAHGLSLVYEIGDQSLKDDLVQDLVE
FT                   SFTSTGPNLGGGKIEADTQLFEPGALPTGEGSSVNTYKDIMNLAAEAGDPTLVYRFMSL
FT                   ASNNAIWTNRAAFGRFGISSIFSDSSVDGYLAKNPKIYPKLFRYRFDPNPNVQRSMNTI
FT                   WQALVKDPTVVIDTHFDDIMQDLLKSILAGREWRVRQASCAAVADLIQGRRPEKYAQYL
FT                   DEIYSKGFKLLDDIKESVRTAALKLCQTITNSVIRTLETSGTEKRAGTLLQSAIPFLLS
FT                   DKGLDSSVEEVQGYAIGALISMIKKSPGGLLRPHVPNMLEKFLSALSSLEPQAVNYVHL
FT                   NADKYGLTGQEIDKMRLSSIRTSPMMEVIERYLIDNLDESNLDELAQRLEDVLRSAVGL
FT                   PSKVGCSRVLVLLSMKTLLFRPYADRFIQILTKYVVDRNDTVSASYCSSMGYLLRLASD
FT                   DRVLKTFDFAKNLYLTAEDATPRVISGEILYSASKLSNDRFMAFAASALPFVFVCKHDG
FT                   DEHVKEQFEKTWQDNVGGSRAVSLYIREIVGLVSDNLDSPRWAIKHTAARAIAQAVLSL
FT                   DAEIDLPTAQLVWPVLERALAGKTWEGKEVVLKALVKFSGQAQKLWQDKEELRSLMKTI
FT                   TVREAKRANLLYRPHGLRAMGEIAQARKDLNFMPDALKIIPGVVEEMQDQDQDQMEIDS
FT                   RNGRGSTQDDTLAACVQCLLQCFNPTADSGEALGKYVEQMTGPLAQVLQHGGRQVVSTG
FT                   YDELRAFFTRVDQWIVLPEASGEQLAAPLTGLAEKILTGEVDGSVEAIRKGRAEAILAY
FT                   LRLSPHAQGVPDTLLMRVRAWRASERSEPVQRLLDEALAFPN"
FT   CDS_pept        join(complement(328324..328357),complement(328088..328281),
FT                   complement(324780..328029),complement(324265..324722),
FT                   complement(323675..324202))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181800" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943354"
FT                   /orf_name="Pc14g01390"
FT                   /product="Pc14g01390 protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP74280.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000183194C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5W7"
FT                   /transl_table=1
FT                   /translation="MSVVVEEITLPALTSILILDATLESLYSIFQQCDERPTKRRKTTK
FT                   RGARSLTQENGVSTAGVRLGYIPLARLTMRIRPSNTDTNKYQRPYDPDLSTSRVPILID
FT                   VRSVHFLDEDLDNAPQPDPAEDGPDRMELELSSLDEKGLLIYPCEDLRLFELLGQLQAA
FT                   SKLAHVDNFSKKVPTACYQAHLCTLPDGAGFSLETIVLWKDSIEVPDSNRLGIADLEAF
FT                   TKYVLQEKCVQPSADPRKYRENMLGTRKEWSPRDFYKNVHVPEVTDSPNIKCPDLKCKL
FT                   FPFQQRAVRWLLQREGREVGPNGEIMPMTELPKSDIPASFNSTKDADGRTYYFSHLFMV
FT                   LTTDISLWYDAAANLKGGILAEEMGLGKTVEVTALISLNKREESQIWKADADGLRPTGG
FT                   TLIITPPAILEQWKQELKEHAPTLSVHHYNGIKRSGEATDDMIVDELAEFDVVLTTYNV
FT                   IAKEIHYTGGGPQRALRHEKRFAQRKTPLVRLSWWRVCLDEAQMIESGVSNAAKVARLI
FT                   PREIAWAVTGTPLRRNIDDLFGLLLFLHYEPFCFSAPLWRRLCLCFGPVLAKIINTIAL
FT                   RHRKGQLLEELRLPPQKRIVITTPFTAIEEQKYGQLFEQMCEECGLNASGAPLRGDWDP
FT                   EDPVIVEKMRTWLTRLRETCLRPNVRYRRTLGQGSGPLQTVGQVLEAMTDANESALRTE
FT                   ERTLLLSQLRRGQLLENAKRRQEALALWQKALDHATRLVEDSREQLRLLKTKGATSDKD
FT                   GATLGHINQDVEDDEDEEDEEAGNNSRLGECRLKLRAALEVQHIAVFFTANAYYQIKSD
FT                   PNLTQPESDEFKALEKREEEAYEAAKVIRKEMLTDVARRVERYMRKVKIKARDKEFVHI
FT                   PKMKPHLYSKGVEAYNLLSKFEDFCDALNKNAQQYKEWRDVMVRLVSQSLIDQEEEAKL
FT                   EGDEYERSTKHQDEMYVYMEALRSIYSDRYDALTGYKNTLISHEAKAGIIQAERGEGPS
FT                   PQLFLKIMDIRSQLQPDPSLGSLRGIVSELRKLVASLEWQASSGNSRARAEHEIVEMVL
FT                   KNAGQMIAEQLKVSTRLSREVESFRDIMNNRLEYYRHLQQISDTVAPYDEESAGKPLDE
FT                   SAFNLRLEQEESIEAKIASLRSKARYLIHLRDDSSSDNNPRECIVCQSTFEVGVLTVCG
FT                   HKYCKDCLRLWWTAHQNCPMCKRKLKRNDFHRITYKPQELVVQEEKTPVKSSYEGHSQN
FT                   AIYSDISSGHLNEIKNIDLEESYGSKIDTLVRHILWLREHDPGAKSIIFSQYGSFLSSL
FT                   QAVFGVLEISSTTIDSPDGIEKFKSDPAIECFLLHGKAQASGLNLTVATHVFLCEPLIN
FT                   TAIELQVIARVHRIGQHRPTTVWMYLVSGTVEESIYEISVTRRLTHITEKEKQAKAALS
FT                   TSPADDDGVTEAAIESANSMELQDATLTTLMQRGSEGGEMVKKDDLWQCLFGNTKQKDG
FT                   TNPSAEAEREVGRFLRGEAAEQRRED"
FT   CDS_pept        complement(328910..329449)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943355"
FT                   /orf_name="Pc14g01400"
FT                   /product="Pc14g01400 protein"
FT                   /protein_id="CAP74281.1"
FT                   /db_xref="UniParc:UPI000183194D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5W8"
FT                   /transl_table=1
FT                   /translation="MKDEHPRIVEAMIRSFYGLHYDINQPPQMCPLLFNVKVYAIADKF
FT                   EVEYLKIQAKLTFVTLAQDHWNSDEFLTAAFEAYTTTPKSDRGLRDVVVAVCQKHRKEL
FT                   RENKAFEKLVEETPGLATDIVLLSHRWLPQSASTRVRLVQSFSCLSCFAKWQIQVGLAE
FT                   YFTTCPFCQDDKVGAF"
FT   CDS_pept        complement(330149..331858)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181811" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823299"
FT                   /orf_name="Pc14g01410"
FT                   /product="Pc14g01410 protein"
FT                   /protein_id="CAP74282.1"
FT                   /db_xref="InterPro:IPR021102"
FT                   /db_xref="UniParc:UPI000183194E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5W9"
FT                   /transl_table=1
FT                   /translation="MATAMLRSCSWIMSLAPVTERHLLVRGLESTPTCGLILQLTGNYE
FT                   PPDCGFDTVRINLTVTSRGKQFDRLALMYLRDNEVFRTSTAEPTTNGIVWTYIKEMSQY
FT                   NSLWRSPQKLIFDLGNIINEVYTGSFNATLKAHFSEGQNVKTADIVLPISAKRSASNSP
FT                   SAFQLPTDNTTVMYEIPAAASRAIVSISACGQSEEEFWWSNVFSQDTRDFESTVGGLYG
FT                   YTPFREVQLYIDGILAGLVWPFPIIFTGGVAPGFWRPVVGTDAFDLRQPEIDISPFLPM
FT                   VQDGKQHSFEIRVTGLNVSADGKTTFANTVGSYWVVTGNIFIYLNDNSSDSKVTAARDK
FT                   DGPMVDAPLPVFAVTRNLVRNETGGNDSLSYSVAVKRIFSVRSSLYSWSQTLSFSNHGL
FT                   LNQQGYSQVNRQLTTGNNSITELGDAPISYSITFQYPLVVNATYGITSNGMTIDSWMMR
FT                   GLDFETTGGLGISTYTLSSGPSHLHTRQSGTAQYKSVTGGSSSSWGDTTNVFESQMNGQ
FT                   PYHRSVHAVNGTVVSDTDPGGKVSASSPQDYGDTGRGSVRAIIGKGPGALIN"
FT   mat_peptide     complement(330152..331795)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5W9 "
FT   sig_peptide     complement(331796..331858)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5W9 "
FT   CDS_pept        join(complement(333312..333837),complement(332907..333240),
FT                   complement(332787..332844))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181822" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943356"
FT                   /orf_name="Pc14g01420"
FT                   /product="Pc14g01420 protein"
FT                   /protein_id="CAP74283.1"
FT                   /db_xref="InterPro:IPR012439"
FT                   /db_xref="UniParc:UPI000183194F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5X0"
FT                   /transl_table=1
FT                   /translation="MAPQKHVADVPRNILPRLTWNSSSSRPSVTITHHPALATSQRRPL
FT                   PQGWSPLKRQFHSSTPSQSSQLISPSSRDVISEYLVSRGTSITTPATSTTNRGNPIRHN
FT                   GVYVATYNPARRAFHATPARPRDHHFDTLKFVKRLQAEGFSEEQSVAMMRVLNDIIQES
FT                   IQNLTRTMVLREDSERSTYTQKVDFAKLRSELLNADSTEAQLTRSSHEKIAADLAKLNS
FT                   RLRDEIGRTQASVRLDLNLEKGRIREEANSQEMRIKETETRIEQEVAGLRERVEAVKFS
FT                   TLQWLMGVCTGTAALILGAWRLFM"
FT   CDS_pept        join(complement(335125..335226),complement(335008..335070),
FT                   complement(334641..334957),complement(334502..334576),
FT                   complement(334192..334441))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181843" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943357"
FT                   /orf_name="Pc14g01430"
FT                   /product="Pc14g01430 protein"
FT                   /function="phosphomannomutase activity"
FT                   /biological_process="mannose biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP74284.1"
FT                   /db_xref="GO:0004615"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0019307"
FT                   /db_xref="InterPro:IPR005002"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001831A1D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5X1"
FT                   /transl_table=1
FT                   /translation="MTEAASVYPSLEDRPIKNTVVLFDVDETLTPARRHASPEMLELLS
FT                   RLRHKCAIGFVGGSNLVKQQEQLGSSTIDVTTMFDFCFSENGLTAFRLGESLASNNFIQ
FT                   WLGEDKYQALVDFVLKYIANTKLPRKRGTFVEFRNGMVNISPVGRAASVDERDEFEAYD
FT                   KIHNIRKNLVESLKKEFPDYGLTYSIGGQISFDVFPTGWDKTYCLQHIEAEKGISGIDY
FT                   KTIHFFGDKTFVGGNDYEIYEDPRTIGHSVDGPQDTMDQLKKLFDL"
FT   CDS_pept        join(complement(336595..336601),complement(336532..336543),
FT                   complement(336418..336478),complement(335799..336369))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181844" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943358"
FT                   /orf_name="Pc14g01440"
FT                   /product="Pc14g01440 protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAP74285.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI0001831A1E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5X2"
FT                   /transl_table=1
FT                   /translation="MSSPNYYKTLGIAQDATQQQIRNAYKRESLKSHPDRVPVDSPERP
FT                   SRTRKFQEINDAYYTLSDPARRREYDATRAYQAAEEEAEAEVPPTGGFPWSSFGFGGNR
FT                   DDRDNDQFGSVFEEMLREEGLAEENEGEGGRRTRPTGRFWALVGGVSGGAMGFIVGNLP
FT                   GALAGAVAGNRLGAIRDAKGKSVYEVFLDLPVPDRTRLLGELAARVFQSTMGR"
FT   CDS_pept        337424..337954
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181855" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670521"
FT                   /orf_name="Pc14g01450"
FT                   /product="Pc14g01450 protein"
FT                   /protein_id="CAP74286.1"
FT                   /db_xref="UniParc:UPI0001831A1F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5X3"
FT                   /transl_table=1
FT                   /translation="MGWFDGKSTTVSSAGYVRRRASPTPSSHSTHSRRSKSGYSSTHHT
FT                   RHSAPSFFGLGGSRTGGRSSPSVFSSYSSSSRRARPREGFVQRMIRDIKRLFRDIYRWA
FT                   RRNPMKVFMMVIVPLLTSGVLPRLLAMIGIRLPHAVTSALGGASKTRGGFEGGGGGISE
FT                   NIGSLMNIAKMFA"
FT   CDS_pept        join(complement(340034..340100),complement(339906..339971),
FT                   complement(338776..339797))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181866" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670522"
FT                   /orf_name="Pc14g01460"
FT                   /product="Pc14g01460 protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAP74287.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI0001831A20"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5X4"
FT                   /transl_table=1
FT                   /translation="MKPFAILSLFVFFGLVAAWSKEDYEIFGLQNDVATNEGANVTFYD
FT                   LLEIRPNANQEQITKAYRKKSRTIHPDKVKRAFIANYPKDKNKAKSNKGVNVNKGPTQR
FT                   EIDAAVRDADARSARLNLVANVLRGPNRERYDHFLKNGFPLWKGTGYYYSRFRPGLGSV
FT                   LLGLFLVFGGGAHYAALILGWKRQREFVDRYIRQARRAAWGDEMGVRGISDIDSIAAPP
FT                   PTAPESGDAGAVAVNRRQKRMMDKENKKDKKGGARVSARASGTSTPTEQPASTGERKRV
FT                   VAENGKTLIVDSIGNVFLEELNEAGERQEFLLDIDQIGRPTLRETMVCKLPVWCFNKTV
FT                   GRVLGTSTEEVDSDEAEEPLVEEAETTATSNARSRKRGKRSQRS"
FT   mat_peptide     join(complement(340034..340040),complement(339906..339971),
FT                   complement(338779..339797))
FT                   /db_xref="UniProtKB/TrEMBL:B6H5X4 "
FT   sig_peptide     complement(340041..340100)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5X4 "
FT   CDS_pept        340733..341251
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181878" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976493"
FT                   /orf_name="Pc14g01470"
FT                   /product="Pc14g01470 protein"
FT                   /protein_id="CAP74288.1"
FT                   /db_xref="InterPro:IPR004895"
FT                   /db_xref="UniParc:UPI0001831A21"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5X5"
FT                   /transl_table=1
FT                   /translation="MVSIPIDAITSRFGDRFNNIRSTSLSTRFANLRPISEFLDVKRLS
FT                   KPANFGEAQSRVNYNLSYFSSNYAVVFVMLSIYSLLTNLVLLFDMVFVSCGLYGINMLQ
FT                   GRDLDLGFSRFTTSQLYTGLLIVAVPVGIWASPLTTALWLIGATGVTVFGHAAFLDKPI
FT                   ENAFSEEAV"
FT   CDS_pept        341278..342405
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181889" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976494"
FT                   /orf_name="Pc14g01480"
FT                   /product="Pc14g01480 protein"
FT                   /protein_id="CAP74289.1"
FT                   /db_xref="UniParc:UPI0001831A22"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5X6"
FT                   /transl_table=1
FT                   /translation="MPSWGRPPGARRGRNNRGRAAWEETRLEEVDSEEDAYGRELVRSG
FT                   RYRQLEYGGRGPRRRVDYEDLTDESESVDGGEFDLYDHEDSTVAYAVQLAMRDKEDQLV
FT                   DTALERIRRAQVLGKKNVRLSKRELDALERKRQQTDGLSRRPSASVKVSSRPSSRRSGA
FT                   VAAPEQLPGAYPAFAPDAHSWARGTGTNSRPSSSSSARPRTPTTQSLRPQQSNSPLRPT
FT                   YPPYTPERFAPNGRPQSMQQPPVFQRPLPDDPQWAPSYYNSLQMSPYGEPALYPSQVPT
FT                   DLRAGQQNRMSYPSGPPYPGYQSQSPGKRPQDTPQTREDLAPAPSKLGSEESSEESSED
FT                   EVQIVKVAKVAERKAPPVAVQRRPITGTTRKRTSR"
FT   CDS_pept        join(343435..343489,343551..343632,343691..343960,
FT                   344026..344437)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181900" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823300"
FT                   /orf_name="Pc14g01490"
FT                   /product="Pc14g01490 protein"
FT                   /protein_id="CAP74290.1"
FT                   /db_xref="InterPro:IPR019402"
FT                   /db_xref="UniParc:UPI0001831A23"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5X7"
FT                   /transl_table=1
FT                   /translation="MWIISFWMFPLISACMWVAMLIAMLVTWVNEGRPHYPSMDNGQTI
FT                   AYISDVGAQHLKPLFVGGSVVTVVFLDLAFLSERWLRHSNQLASNKGRLDKTCAILSIF
FT                   FAIAGAAGLILLAVFDTLRHPKMHDGFIALFIAGYVISAILVCIEYLRIGIFYRREHRV
FT                   LLVSFFIKLAFVIIELALAIGFGVCIGSNQSSKQNPGAVLEWTISFVFTGYVLSFVVDL
FT                   LPSVRTRNHVPQGEKYLMTQQGREENVSIEEPLTHDSMGPSTGFYRGQRV"
FT   sig_peptide     join(343435..343489,343551..343591)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5X7 "
FT   mat_peptide     join(343592..343632,343691..343960,344026..344434)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5X7 "
FT   CDS_pept        join(complement(345958..346064),complement(345863..345899),
FT                   complement(345426..345787),complement(344869..345364))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181911" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943359"
FT                   /orf_name="Pc14g01500"
FT                   /product="Pc14g01500 protein"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /protein_id="CAP74291.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="UniParc:UPI0001831A24"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5X8"
FT                   /transl_table=1
FT                   /translation="MSRHNSVDLDSPDRPFDNIINFRDVGRSVNQFCRKEILKEGVFFR
FT                   SARLDDASERDKRRLAEELHIHTVIDLRSQYVPQNQKQKAETNTKNRTEHQMGTRKRRG
FT                   EIAKSESESESEKSNSTEKSPTDPIPSNPDEHLLHIPGSTRALISLTGKGFERALLSKL
FT                   DWFTYLKTIGLATTGYRSDAVRLVCGSVMQPRGLTGLAQDTLDSSMAEIRAVFEILACE
FT                   ESYPTLVHCTQGKDRTGLVVLLMLLLVGGVPTEAIVDDYSRSELELVSEFEERMEEIRA
FT                   IGLGEDYTRCPPGFVGETTGYLEMRYGGVRGYLERVGVGFEMQERIRGKFLV"
FT   CDS_pept        join(complement(349515..349749),complement(348387..349463),
FT                   complement(347830..348331),complement(346642..347776))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181922" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127589"
FT                   /gene_name="lacC"
FT                   /orf_name="Pc14g01510"
FT                   /product="Probable beta-galactosidase C "
FT                   /EC_number="3.2.1.23"
FT                   /function="beta-galactosidase activity"
FT                   /function="cation binding"
FT                   /biological_process="polysaccharide catabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAP74292.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0004565"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR001944"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018954"
FT                   /db_xref="UniParc:UPI0001831A25"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6H5X9"
FT                   /transl_table=1
FT                   /translation="MRLFALLPVLLGLISSHFVSATDNGKTTDVTWDKYSLSVKGERVY
FT                   VFSGEFHYQRLPVPELWLDVFQKLRANGFNAISIYFFWSFHSASEDTFDFENGAHDVQR
FT                   VFDYAKQAGLYVIARAGPYCNAETSAGGFALWASNGQMGSTRTSASSYYDRWYPWIQEI
FT                   GKIIAANQITNGGPVILNQHENELQETIHSADNTVVKYMEQIKAAFSDAGIIVPSTHNE
FT                   KGMRSMSWSTDYQDVGGAVNIYGLDSYPGGLSCTNPNSGFNLVRTYYQWFQNYSSSQPE
FT                   YLPEFEGGWFSAWGGSFYDQCSTELSPEFADVYYKNNIGSRVTLHNIYMVMGATSWGQS
FT                   AAPVVYTSYDYSAPMRETREIRDKLKQTKLIGLFTRVSSGLLQTQMEGNGTGYTSDASI
FT                   YTWALRNPETHAGFYVLAHSTSSSRAVTTTSLNVNTSAGALTIPNIELAGRQSKIIVTD
FT                   YQTGDGSSLLYSSAEVLTYATLDVDVIVFYLNIGQKGEFAFKDAPTHLTFKTYGNSKVS
FT                   SAKSDHGTKYTYCQGDGTTVLKFSHGVLVYLLDKETAWNFFAVPTTSNPRVAPSEQILA
FT                   LGPYLVRTASVSGHTVSLVGDNANATSLEVYTGNSKVTQIKWNGKETPTKKTAYGSLIG
FT                   SAPGAEHAKLSLPTLKSWKAQDTLPEINPDYDDSRWTVCNKTTSVNSVAPLTLPVLYSG
FT                   DYGYHAGTKIYRGRFDGVTATGANITVQNGVAAGWAAWLNGVYVGGAIGDPDLAATSAE
FT                   LEFTSSTLRRKDNVLTVVMDYTGHDQANVKPNGSQNPRGILGATLLGGDFTSWRIQGNA
FT                   GGEANIDPVRGPMNEGGLYGERLGWHLPGYKGSKTATSESPLDGVSGAAGRFYTTTFKL
FT                   DLDSDLDVPIGLQLGASADAPAVVQIFMNGYQFGHYLPHIGPQTRFPFPPGVINNRGEN
FT                   TLAISLWALTEQGARLSQVDLVAYGAYRTGFNFNHDWSYLQPQWENNRGQYV"
FT   mat_peptide     join(complement(349515..349686),complement(348387..349463),
FT                   complement(347830..348331),complement(346645..347776))
FT                   /gene_name="lacC"
FT                   /product="Probable beta-galactosidase C "
FT                   /db_xref="UniProtKB/Swiss-Prot:B6H5X9 "
FT   sig_peptide     complement(349687..349749)
FT                   /gene_name="lacC"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6H5X9 "
FT   CDS_pept        complement(350073..351818)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943360"
FT                   /orf_name="Pc14g01520"
FT                   /product="Pc14g01520 protein"
FT                   /protein_id="CAP74293.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001831A26"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Y0"
FT                   /transl_table=1
FT                   /translation="MAEISLVSLPTELVCEIAAAISVREIICLLECYHNLCQPLLWHCR
FT                   HQREDWELQQGLTQCVKAGDVHGTRLLLSINADIECVKDTLQNQPTRPPGGCCKPTQYW
FT                   SSSSLDLAVKNGYEEIVGDLLAHLNQIKVETPSVKVGSFSRALRYAARNGYFPIMKMLL
FT                   EFEFDSRTLPPGEYIGVLSDAVGEVDYIHLERHCFCQKQEICSGSRKKAVVDHYATVKL
FT                   LLDFGADCNFIGLHYFPDTPVLRALFKCSSFSNGILKLLVERGANVSSKDVLHGFIESS
FT                   NQCSFSNEETARLLVNHGADSSVRAYIGETTLHQNNKKAMIELLVACGLTLDKLNGWHR
FT                   IKETFEDRTELISQLLDLDANIRYRTAFGPTSLQLVIPEGSSPYGCDSDEDELNEVDQF
FT                   RCPISEPEPEKVDNETCVSFIHKSVKLLLSHGECGSIEDSEGQNLLYKPDNVRFVKLIL
FT                   AHGAKVNVVDSYGQTPLHAMAYGATKAMVETIRLLLKHGADIAAKNADDNTPLHLAVLT
FT                   SEWEVVKLLIAHGADRNARNFDGETPMDLLSRRRCYRKLFSFNRNKKGGLMTFKYQDIC
FT                   FAYFL"
FT   CDS_pept        352322..353671
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943361"
FT                   /orf_name="Pc14g01530"
FT                   /product="Pc14g01530 protein"
FT                   /protein_id="CAP74294.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001831A27"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Y1"
FT                   /transl_table=1
FT                   /translation="MSTVDAVVSSVAVFDDFLEATYVGNFALIFPVSNSFSLLPTPSNK
FT                   MSISLLSLSNELLFAILAELEVEDVLSVLETHPDLYQVSYRCLRKRRRHLSLRSYSISG
FT                   NISRVRILLKAGAKADDWSLTFGSSLARAAANGHEEIVKLLLDHGARMDHEGFHHPLQV
FT                   AALKGYFTIVKLMLDYGVDVNTKGPLGHTALTETILYKGRYSYQKGGPWMGRGRCLYRR
FT                   SKTPFSYYDTMKVLLEYGANPSIPKPYGSALHTAMENYPYLQQDTVGLLLEYGADPNAR
FT                   IYGDVTPLHLINPTCTKPNDPRCTEIAKLLLAHGADVNAQNTDGITPIHIAAAANGRGE
FT                   ALTRIYLDHRADVNIADSYGLTPLHRAVARSLNNIPVIELLLKSGANVGAKEAGGNTPL
FT                   HTAVRFEAPNEAIQLLLKYGADMNSSNKEYECDTPLKMMEKWLGETVGLR"
FT   CDS_pept        join(complement(357007..357052),complement(356864..356947),
FT                   complement(355407..356804),complement(354291..355354))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181933" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127590"
FT                   /orf_name="Pc14g01540"
FT                   /product="Pc14g01540 protein"
FT                   /protein_id="CAP74295.1"
FT                   /db_xref="UniParc:UPI0001831A28"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Y2"
FT                   /transl_table=1
FT                   /translation="MATVQMTRQPRLADDAATAALYVTKPERRASLRAPTATNTQQFNT
FT                   RAVGGTPKLSHASAASALAHANRKPVEVWRPPARQPAAEKAALCVKDYSPPQQPQPTSQ
FT                   HSAEGLGAAMLAVREKRASVCQAPTSAAHRRGSSVTDGYNYTAVGGNPRDKAIKAASGA
FT                   YTLSRKRADSAPSEPGLTSELQAPVEEGGPLDHLDPAMEASRIQHAVNTNPKLYTSSPP
FT                   VQSEIEEQNYRNSQHAAAISMAKDMYRVTSTKKESGQSPALIAAQKGQSQLGYRKTVST
FT                   ADGTALRRAIALQEAAQKRAAEKLALMQDEHTDYQRYYGTAPQPQRSRLTTRRKRTSSD
FT                   ADASQTDAEQSRQIRSQMTTLRTKLDQVDEQKTKDRELLMQAARRNVDQTLQDMEAQVY
FT                   ADTGRPPPSVQKEWDEVAQERVRREAEVYEDATTRGNRVNIGGQKYMDMADIDAIARSR
FT                   LQPALDEVTEDAELRRAHDIEARLDAEEEQRHAAVERQREAEVKELEKQEKEASKRDKS
FT                   EGKVPKFFLWRKKGKRARVEKSETEEAQAVSPVSQAPVSQGAVSQGAVSQGAVVEQAPT
FT                   TTADSNISTVTIPEQASVETEDNVSRVTIPEETSIVTETPGPATVVAATSSVPEAQPSK
FT                   PDENDVPAAVPRRPTRSQTEPPQIEQRDAAAAGPTIVHYFTPPVTSPRADTKLKNWFRD
FT                   RLVRRSSGPVPIYPHQPGPESNTDNEPAFQGGATLTGRDEPRRAALGSHPPGVGEPVAT
FT                   HNRSSSYYSNDLDVTKTKSADSVPNSTKQNGNGKKRNRLSRTLLRAVSRSPEQSNDDES
FT                   RHDSGVQSSSKDVGGDIQSLQESSIGQSLPVPPTIGETVNGRRESRFSENL"
FT   tRNA            complement(358534..358621)
FT                   /gene_name="tRNA-Arg (CCT)"
FT   CDS_pept        join(complement(362480..362690),complement(362352..362409),
FT                   complement(362223..362291),complement(362042..362156),
FT                   complement(361690..361981),complement(361521..361625),
FT                   complement(361314..361454),complement(360964..361261),
FT                   complement(359201..360913),complement(359019..359135),
FT                   complement(358853..358967))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000164697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823301"
FT                   /orf_name="Pc14g01550"
FT                   /product="Pc14g01550 protein"
FT                   /function="cation binding"
FT                   /function="chitin binding"
FT                   /function="chitinase activity"
FT                   /biological_process="chitin catabolic process"
FT                   /protein_id="CAP74296.1"
FT                   /db_xref="GO:0004568"
FT                   /db_xref="GO:0006032"
FT                   /db_xref="GO:0008061"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR001002"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018371"
FT                   /db_xref="UniParc:UPI0001831A29"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Y3"
FT                   /transl_table=1
FT                   /translation="MRFLSAAKALALFPLFCDLVLGAKGTSGTCSKDKKCDTGCCSKEG
FT                   YCGFGPNFCGDDVCISNCDAQAECGKYAHVANSTCPLNVCCSEFGFCGTSSDFCGKGCQ
FT                   SGCDDVKQPSCSGTSSKDVYAGYFEAWNYERSCDTMTPSDIDINPWTHLFYSFAAINTD
FT                   DSTIETTYDHDDEYIEELMDLKKKKPSLKTFISVGGWDLGGEPFSDMVRFRGLRKSFID
FT                   SAIEFMEDRGFDGIDIDWEYPTAEDRGGRDEDKENFVTFMKELKEACGSSYSITATLPT
FT                   SYWYLKGFDVKALSEYVDYFNFMSYDIHGTWDGNTKWTESVVNPHTNLTEIKEGLDLLW
FT                   RNDVDPAKVMLGLGFYGRSFTLKDSSCAEPGCAFDKTQDSAGGGKAGKCTETTGILTDY
FT                   EINRVIKEHNPDVVYNEEAAVNWMTWDTNQWVSFDNSKTLKQKADFANSKCLGGLFAWT
FT                   IDEGGPGSSANPNDLDPKDASMEGASTQGNDSGTGDFYVDGSIVESKSDAKSDANVATA
FT                   IAPVNIIVAPSSLATPTTFSVDPLVTPLEVAWTTTKTVTVSGQPTVTTTIARTIQTTTF
FT                   SIPPITASSIPWWNWNITGTDLTRDSQTLFPSFTLDPITFRDRPSPQSSSGGVNGTFMT
FT                   HTGTEDRTFVPPPWPWSTTSLPPHIPTPVVTWTQGGPPAPTCTSNCGSKCKSFCDTPCL
FT                   LDCSDPVANNNWKDPADPTPPSHNPCSGPDCKGKKCEGDLCVKKGCTGPDCDKSSHTCL
FT                   GSDCEPTACIGADCPDSGECDGDDCDTHGCRGGDCNGNGRCTGPDCVSLGCIGPDCNPG
FT                   TGECTGPSCRKVSCSGPHCEDGKCTGEGCESEDDDCESKEADTCTEFITSSKVSSTYST
FT                   ETSTKCQTITACDATATTTTSTISTTMSPQAAWRYNAWSVDDAAITSDASSLDEEFSSV
FT                   YATSTSTSTSTTEATTTTDDTATTTTSNQYTPSESSTTCGHGQTMCHLFVSNLHGFCDV
FT                   AKSYIRGDDIYGTTKGRKSGECYTDGKHASGGCGVFIKGDGCEVKGTTMQAAYDHIFDD
FT                   CDHACGHAYFDNGCEMKVDYVTGCHTSNN"
FT   mat_peptide     join(complement(362480..362624),complement(362352..362409),
FT                   complement(362223..362291),complement(362042..362156),
FT                   complement(361690..361981),complement(361521..361625),
FT                   complement(361314..361454),complement(360964..361261),
FT                   complement(359201..360913),complement(359019..359135),
FT                   complement(358856..358967))
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Y3 "
FT   sig_peptide     complement(362625..362690)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Y3 "
FT   CDS_pept        join(363512..363712,363781..364080)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943362"
FT                   /orf_name="Pc14g01560"
FT                   /product="Pc14g01560 protein"
FT                   /protein_id="CAP74297.1"
FT                   /db_xref="UniParc:UPI0001831A2A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Y4"
FT                   /transl_table=1
FT                   /translation="MKLNTAILAALLAQAANAWKVGDKSTGMTDPGVTSKCIRWANDIG
FT                   SHDSCKALQSKFDIDYLQLHEWNPSLLKDHCVLIEGWSYCVASSSSTNSNAAGMGTEAP
FT                   TLHSSASTGSAPASATTTVTSTASGTTSSASATQSGVATSLTPSQGHAFAVAALFLGAS
FT                   TLL"
FT   sig_peptide     363512..363565
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Y4 "
FT   mat_peptide     join(363566..363712,363781..364077)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Y4 "
FT   CDS_pept        join(complement(365848..365928),complement(365669..365727),
FT                   complement(365194..365449),complement(364864..365129),
FT                   complement(364659..364813),complement(364389..364597))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164686" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127591"
FT                   /orf_name="Pc14g01570"
FT                   /product="Pc14g01570 protein"
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="CAP74298.1"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniParc:UPI0001831AF3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Y5"
FT                   /transl_table=1
FT                   /translation="MEPTWYPSAPAPNYIHFKLHDMYLPRQIDRVGSGSGLVKNSILHA
FT                   RYLPRKHTNNPPSSMMLKSNLLINSLVLGAAAAASQGDWTNGPKATGTKDPNAAVGCDY
FT                   WANDVQSSDTCDALVDFFGITQKQLVSWNPSLKLDYCVLVPGWSYCVSGPAAATSSASG
FT                   AANTPAGTLSYSGTAAPTQSGIAKSCTKYHLVQNGDSCNSIQDKYMTFTLGQFYSWNPS
FT                   ISKGCKGLKNGDFVCVAAKSSSSTSASPTGSSAATTTSSAFPTQTGVVKDCTHWHFVSG
FT                   DDDCTSIRSEYDLTPAQFYHLNPATGSKCTNLWRKTNVCVAGPGKFIQSLLSLMPGPGL
FT                   T"
FT   CDS_pept        join(366507..366767,366862..367039,367103..367213,
FT                   367273..367593,367673..367819,367876..367979)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127592"
FT                   /orf_name="Pc14g01580"
FT                   /product="Putative uncharacterized protein Pc14g01580 "
FT                   /protein_id="CAP74299.1"
FT                   /db_xref="UniParc:UPI0001831AF4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Y6"
FT                   /transl_table=1
FT                   /translation="MVMVFGPPGRALLVIIGHLLFFSDILQLAQGLPFDFNQTTSSIDL
FT                   EKRAPGGRTWTSPGKYTNIRLADSCAGKEKFFETTFDDMSKMVSDAKKTIPTIEKALNK
FT                   DRKKMLPTEKSYVDIYQSLYGMFDLKKKAKVDNAKRKLQILSDFVGKYDQGLSRNQFHF
FT                   DIYCDGTDWQDSGKKSKDGDAIMVLQGDPLAHPTLTENPTDICLEANGDKETLAFVTTS
FT                   TNKSKDYMTICPKAWNEWQGKDTLATKQSKALKSLLGETIDDLVNETPESVLLHELTHA
FT                   QAFFGASVLDDRKVGQEDPDDDDAYEWDLLTKLADEDKDVAQPKGAARNKDIRPLDNAD
FT                   TSMFFLSGERYCGPLKPSPDRWTNAAIHSRSLP"
FT   sig_peptide     366507..366599
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Y6 "
FT   mat_peptide     join(366600..366767,366862..367039,367103..367213,
FT                   367273..367593,367673..367819,367876..367976)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Y6 "
FT   CDS_pept        complement(368472..369620)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217660" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943363"
FT                   /orf_name="Pc14g01590"
FT                   /product="Pc14g01590 protein"
FT                   /protein_id="CAP74300.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001831AF5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Y7"
FT                   /transl_table=1
FT                   /translation="MSILKLPSELLMSIAESLESRDLNALLRCHSYLFKTLNDYLYRLN
FT                   VQHHDASALYWAASSGSDNTLQRLLHAGANVLWDSPYFACSVQKPATRLREFIWEENMK
FT                   EHPISYAAAQGHLNIVEHLLDLGVDINYRDADGLTPLALAAREGHFALVRALLDRGAKQ
FT                   LSKDKMGQYPLAQAASRGHHSIEDYLFEKLRQYPHGKTNPELDLYWMLKYAAERGDDDR
FT                   IRYLLSQGADVNFQLPIESQSPLCGALDLAPLPLSTTKLLLEAGADPNRKPSRSINYQP
FT                   GRPSKSLAPLTLAMHRDDSFSLIKLLIQYGADAEDQSLALRIAIQYRKAPEFRFLVDNG
FT                   ARLDARSRGKRGTSFAWMGINSGYQPIIDICLEHGISPDIRS"
FT   CDS_pept        join(370550..370900,370962..371084,371134..371630,
FT                   371718..371850)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943364"
FT                   /orf_name="Pc14g01600"
FT                   /product="Pc14g01600 protein"
FT                   /protein_id="CAP74301.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001831AF6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Y8"
FT                   /transl_table=1
FT                   /translation="MFSTDRSCPYGQLDPEERDILSRVQVTAPPGNNEKNRSKTEAIID
FT                   EVIQIIEDYSKEYRQAGITIKWSTGEDVDLRKLSRKILNAALSFKDIVSTVVAFDPTHH
FT                   AASAWAVVSLGLTNGSVVLLESAFPSLVRGEAMSLLGLASKAVGIINALQSNLESNMDL
FT                   ECAGLLQDANRFILKNVQVINNAPLQVYCSALVFAPRSSTIRRLFNSQRSSWISVLPQV
FT                   EESWGTEPQILKGHSELVSSVAFSRDGQRIISGSYDKSIKLWDAQTGLGLQTHNYSCPI
FT                   WSVAFSLDGLRIISCYSDDTIKFWDAQTGSEPQTVDGDCGWVEGEKVLWLPREYREYVC
FT                   SAITDDTIVFGYKDGRVFIVKFCAPLG"
FT   CDS_pept        join(complement(374585..374630),complement(374377..374555),
FT                   complement(373911..374300),complement(373389..373847),
FT                   complement(372932..373340),complement(372746..372882),
FT                   complement(372501..372648),complement(372329..372396))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181944" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823302"
FT                   /orf_name="Pc14g01610"
FT                   /product="Pc14g01610 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP74302.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0001831AF7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Y9"
FT                   /transl_table=1
FT                   /translation="MGLGVLEDKKLAHVPDAVKPSVAHDFKPPGTSDIYEQDSDASEQT
FT                   PGASGLKCDLSGKQPIILVPQPSDDPNDPLNWPLWRRDIILAILSFVTILCTTLSSILA
FT                   ANTVTIADYEEITFTDAALLTGYHLCGVGVAGILIVPTARVWGKRHLFLIGHVLMIISC
FT                   IWAGVSGKNHNSLIWARIFQGVALAPFEALVNACVGDLYFVHERGKRMAVSNVALFGAA
FT                   FLTPVVVGKITKSMGWQWSFYFVAIFLGASLPLMFFFVPETAFRRSDYLNTDFKRSGGH
FT                   GESMESHVSLSGISNDDTKELRPGPNESSKTEAATTVPEKDSFAQSLRLFNGRKTDESF
FT                   FKLLLRPFPLFFHPGIFWACLIQGAVIGWAVFVGVVLAIVFLGPPMWFEEDKTGYLYTG
FT                   AFIGSIVGLVLSGLLSDSINKLMIRLNHGKYEPEFRILLVIPQLVFCGIGLYGFGWTAD
FT                   DVMHYGWLLPDVFFAFLIAGMVMGAVAASLYIVDAHREMAIEAFTCMLVFKNMFSFVLT
FT                   FFAYTWFAHGGIKHTMIVIGSIQMSSGSGTGLSLPVMTSLRCFISGNAGNATTLQQFKG
FT                   WEFMILRDMSDRATDGSAHFYSHRIIATTIRLPVS"
FT   CDS_pept        join(complement(375807..375929),complement(375607..375691),
FT                   complement(375389..375503),complement(375280..375324),
FT                   complement(375061..375226))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670523"
FT                   /orf_name="Pc14g01620"
FT                   /product="Putative uncharacterized protein Pc14g01620 "
FT                   /protein_id="CAP74303.1"
FT                   /db_xref="UniParc:UPI0001831AF8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Z0"
FT                   /transl_table=1
FT                   /translation="MRGIAIQGRGFDFNIERDHVVTAVEIMRLPTWGLALEPIDDAKNS
FT                   FKNKATVGPGGTVAVEPVDISPLGLQTSPIALFLAMVHSHTLCLFYDHSGCTAYTLYAV
FT                   PIASGPVPDFLDTEGVLSHDPPAPRPNIGRSSPNVMPRSKLGCADPVLPGQLVRTYVRS
FT                   SAFPAFNSSRPAQY"
FT   CDS_pept        376058..376696
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211832" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943365"
FT                   /orf_name="Pc14g01630"
FT                   /product="Pc14g01630 protein"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP74304.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR003956"
FT                   /db_xref="InterPro:IPR003957"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0001831AF9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Z1"
FT                   /transl_table=1
FT                   /translation="MSSVSPSKEHELDPEAQSGEEQDHLDKDHHDAQGHQGEFEVKEQD
FT                   RWLPIANVARIMKLALPDNAKIAKEAKECMQECVSEYISFITSEASEKCQQEKRKTVNG
FT                   EDILFAMTSLGFENYAEALKIYLSKYRETQSARGDNQRPPSAGYGAGGPVGGSSGAGPG
FT                   LARPTGFPNAEGTNPMSNLNLDPSEQDASAYGYPPIVGQPHNGAGGESY"
FT   CDS_pept        join(377469..377552,377620..377749,377871..378196)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217819" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943366"
FT                   /orf_name="Pc14g01640"
FT                   /product="Pc14g01640 protein"
FT                   /protein_id="CAP74305.1"
FT                   /db_xref="InterPro:IPR008427"
FT                   /db_xref="UniParc:UPI0001831AFA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Z2"
FT                   /transl_table=1
FT                   /translation="MKFTITFALAALLSTAAAQGLGDLPDCSKTCATGSIPDNCGIDFK
FT                   CICEAKSFLDDVACCIADKCSKADQETTIKVAKSICARGGVTDLPTEVVCSSKSGSSSG
FT                   TSTSDSSSSTETGNKSSTETSGATTVTGTNASASASSSASSASAAATSTGVAALTHKDS
FT                   SLVAAAGAAAAFAILV"
FT   sig_peptide     377469..377522
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Z2 "
FT   mat_peptide     join(377523..377552,377620..377749,377871..378193)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Z2 "
FT   CDS_pept        join(complement(379085..379222),complement(378565..378987),
FT                   complement(378421..378492))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181955" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823303"
FT                   /orf_name="Pc14g01650"
FT                   /product="Pc14g01650 protein"
FT                   /protein_id="CAP74306.1"
FT                   /db_xref="InterPro:IPR018815"
FT                   /db_xref="UniParc:UPI0001831AFB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Z3"
FT                   /transl_table=1
FT                   /translation="MVLISSKTLIQAHAVFLVVIAGYLVKNPEVITDSDLVFMMGEALK
FT                   IDFPSLSSPQQSPFTFCAILIFIESLVDLVLLSNIPFHEALDEALPYIRPLRNGNLPAE
FT                   DLQVLQSLPEYITKSLTIYWSVWIAVAACRFAVYAAIAFFIYQGKGDHLASSYTSAAAI
FT                   GGLDRLKNRVVFSFAFFEMMFWFWTFSTLREERQERLTKLLEDTREM"
FT   CDS_pept        join(379613..380101,380163..380208,380255..380592,
FT                   380642..380750,380803..380939)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000180333" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127593"
FT                   /orf_name="Pc14g01660"
FT                   /product="Pc14g01660 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP74307.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniParc:UPI0001831AFC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Z4"
FT                   /transl_table=1
FT                   /translation="MLLGYLTLSGLDVLGVLQSKTTPEERQGYIDWLYHCQVPSGGFRG
FT                   FPGTDFGPGKRNKDNEAWDPANVPATFFALVNLLILGDDLSRVKRRECLEWLPKVQRAD
FT                   GSFGELVGPEGSVGGPRDLRYCCCAAGIRYVLRGRSETGLEGVPDIDVLGFISFIEACQ
FT                   TYDGGMAESPFCESHSGHTYCAIGSLDFLRRTCNDLKPVPLLSAGSNQFEALITWLASR
FT                   QTAQLEEPDEDEDEEQREVTDTGSIDNRVRGLPNVQPIGADTISCAGFNGRCNKYADTC
FT                   YSFWNGATLMMLDQYSVVDEVRNRRYLLEKTQHLVGGFGKGPGDPPDLLHSYFGMVSLA
FT                   FQGEVGLSPVDPTMGSSERTVRHLESLPWWQS"
FT   sig_peptide     379613..379669
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Z4 "
FT   mat_peptide     join(379670..380101,380163..380208,380255..380592,
FT                   380642..380750,380803..380936)
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Z4 "
FT   CDS_pept        join(381718..381768,381870..381898,381962..382079,
FT                   382136..382283,382346..384618)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181966" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823304"
FT                   /orf_name="Pc14g01670"
FT                   /product="Pc14g01670 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP74308.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020658"
FT                   /db_xref="UniParc:UPI0001831AFD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Z5"
FT                   /transl_table=1
FT                   /translation="MPPRTRAGVQSQKQKEKLANSYNELLEEFSSKDLRTVGNYTLGRL
FT                   IGKGSFGKVYLASHKLTNGSKVVLKSSSKEDTNLVREIHHHRQFLHPHIARLYEVVVTE
FT                   SLVWLVLEYCPGDELYNYLLRHGPLPVEKVKRIFTQLVGAVAYVHSKSCVHRDLKLENI
FT                   LLDKQENVKLCDFGFTREYEGKASYLQTFCGTICYSAPEMLKGEKYAGEKVDVWSLGII
FT                   LYALLAGELPYDDDDDQITKKRILSDEPTFNEKFTDDAKALINLLLSKRPLIRPSLDEI
FT                   LAHPFLAEHAPEQLAILKIPRPSPFTTPLEKTTLQRMKSAGVNIDEVIENVLAQRCDPL
FT                   AGWWALLIEKEQRKERKRERKRREREAEAKNLRRLSAASSRLEKRSSALMEVEEEGSGL
FT                   RDRGRRDRRSLPSQLAVPDLPALPEPLPVFPIEATTPPLPLDKDSIRSHNSTLRRPVPP
FT                   PKDRRRSRPSMLHVSASQPELTQHHGIFRRRTSRRHQYPILSQLASLKHWFVESAKRAR
FT                   SPHAKSTNSRKFLSEKLSPAKGQDTGKKPAASSSPAGRVAGEEVVTPTQVKRISTASSL
FT                   APSSASYRQNRHSYPRQPRPLNTSHNSHRNSLSPSPITPRGSYRRSSAGLRGRKSTSSS
FT                   VSSIRSIHHARAHSKASSISSNSMDTISTPTARASKSPHSSVKVLPTTPGASSRFPSNI
FT                   RLVRGPGGAPREIGDHSDPMSSSFNEAVPTPLLYSPSSSLVFARRKRSLFKGPMIHTSN
FT                   LPGSGGLANSPIPGQPVNTSGPDVATGRPAARKSQIIEEEEDIEGIEEETEEVDEFDEP
FT                   GTPAGLVAPSEHPADENGSPSSPRTPFAPIPALETSPLRPPRSSSLRSPTDAADKIGIA
FT                   E"
FT   CDS_pept        join(complement(387615..387749),complement(387459..387559),
FT                   complement(387175..387392),complement(386764..387108),
FT                   complement(386269..386705),complement(385981..386175))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000267862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670524"
FT                   /orf_name="Pc14g01680"
FT                   /product="Pc14g01680 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP74309.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0001831AFE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Z6"
FT                   /transl_table=1
FT                   /translation="MGVKEFLKSRSGLRVDNRATTSAATLTLRQSLWPLTLVTTLFFLW
FT                   GFAYGLLDTLNSHFQKTLHIDRGRSAGLQAAYFGAYPLASLGYANWILRNFGYKTVFIF
FT                   GLCLYGIGALCMWPAGLNQSFGGFCGATFVIGSGLGSLETAANPYLTVCGPPRYSEIRI
FT                   NFAQAFNAIGTVVGPVLGSYVFFTETEDDVAALQRVQWVYLAIGVFVFLLAGVFFLSNI
FT                   PEVTDEDMAFQVAQTHVDEQDKPFWKQYKLFHATLAQFTYTGAQVAIAGYFINYVKDTW
FT                   PGTPDATSAKYLAGAQGAFAVGRFLGSGIMKFVRARWVFLVYLSCTVAFLAASVTQTRQ
FT                   VGVVMLFMTLFFESVCFPTIMALGIRGLGRHYKRGSGFIVGGVCGGAVVPPILGHVADM
FT                   RDNTGFAFIVPTMFMVVAWTYAIAVNFVPAYTNTVDKIGESEVGLEGQRTKDEEAVMGS
FT                   HGIDESVGEKHEAVHVER"
FT   CDS_pept        join(complement(391879..391996),complement(391658..391815),
FT                   complement(389263..391578),complement(388883..389205),
FT                   complement(388719..388824))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000265621" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976495"
FT                   /orf_name="Pc14g01690"
FT                   /product="Pc14g01690 protein"
FT                   /function="ATP binding"
FT                   /function="calcium-transporting ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP74310.1"
FT                   /db_xref="GO:0005388"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005782"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006069"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001831AFF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Z7"
FT                   /transl_table=1
FT                   /translation="MENAFLRTPAESLEHFKVSEQTGLSQNAVLKSRQQYGPNALAEEP
FT                   PTPMWELILEQFKDQLVLILLGSAAVSFVLALFEESDDWTAFVDPAVILTILILNAVVG
FT                   VTQESSAEKAISALQEYSANEAKVVRDGMTRKVKAEELVPGDVIQIAVGDRVPADCRLL
FT                   GIHSNSFRVDQAILTGESESVAKETRAIKDAQAVKQDQLNMLFSGTTVVNGHATALVVL
FT                   TGGSTAIGDIHESITSQISEPTPLKKKLNDFGDMLAKVITIICVLVWVINYENFNDPAF
FT                   GGWTKGAIYYLKIAVSLGVAAIPEGLAVVITTCLALGTRKMAQKNAVVRSLPSVETLGS
FT                   CSVICSDKTGTLTTNQMSVEKIVYLTSSGTGFEEIDVEGTTFTPEGKLTQNGKVVENLA
FT                   VSSSTVAQLAEVTALCNAASLSHDAKSGVFSSIGEPTEGALRTLVEKIGSTDIALNQKL
FT                   YRLPASERLHAASAHYESRLPLKATYEFSRDRKSMSVLVGEGKEQKLLVKGAPESILDR
FT                   CSHVIQGANGSRVSVTKDHLKLLSEEVVEYGNRGLRVMAIASVDNISANPLLKNATTTE
FT                   DYAKLEQNMTLIGLVAMLDPPRPEVANSIKKCHAAGIRVIVITGDNRNTAESICRSIGV
FT                   FGADEDLTGKSYTGREFDALSESEQLKAVQTASLFSRTEPSHKSKLVDLLQSLSHVVAM
FT                   TGDGVNDAPALKKADIGVAMGTGTDVAKMASDMVLADDNFATITVAVEEGRSIYSNTQQ
FT                   FIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALSFNPPDHDVMN
FT                   RPPRRRDEALVGGWLLFRYMVIGIYVGAATVFGYVWWFIYNPDGPGISFWQLSHYHKCS
FT                   AQFPEIGCEMFSNDMSKSASTVSLSILVVIEMLNAMNALSSSESLLTFFLGNNPMLIYA
FT                   ITLSMLLHFAILYIPFLQSLFSILPMDWNEWQAVLVISAPVVLIDEFLKLVERRLYNTK
FT                   AVNPVAQNGTAGKPKRA"
FT   CDS_pept        join(400188..400199,400343..400350,400416..400462,
FT                   400527..400546,400603..400614,400682..400956,
FT                   401029..401116,401194..401571)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000240379" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943367"
FT                   /orf_name="Pc14g01700"
FT                   /product="Pc14g01700 protein"
FT                   /function="protein domain specific binding"
FT                   /protein_id="CAP74311.1"
FT                   /db_xref="GO:0019904"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="UniParc:UPI0001831B00"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Z8"
FT                   /transl_table=1
FT                   /translation="MGSERENKTFLARLCEQAERYDEMVTFMKEVANIGGELTVDERNL
FT                   LSVAYKNVVGTRRASWRIISSIEQKEENKGSDEHVGIIRDYRQKIETELEQVCQDVLDV
FT                   LDEALIPKAETGESKVFYYKMKGDYHRYLAEFASGPKRKGAATAAHEAYKNATDVAQTE
FT                   LTPTHPIRLGLALNFSVFYYEILNSPDRACHLAKQAFDDAIAELDSLSEESYRDSTLIM
FT                   QLLRDNLTLWTSSEGNEGEGAPKEEKPEEETAAPAATEAAAPAEEKPEEAKPAETPA"
FT   CDS_pept        join(402041..402489,402599..402683)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127594"
FT                   /orf_name="Pc14g01710"
FT                   /product="Putative uncharacterized protein Pc14g01710 "
FT                   /protein_id="CAP74312.1"
FT                   /db_xref="UniParc:UPI0001831B01"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5Z9"
FT                   /transl_table=1
FT                   /translation="MRDMSTDVHFYALKLIESQLPFLSSALAYQRYRQLKTHRRLIARK
FT                   RPACHQPPNRRRQRVRQFQTTKQNATESAIRSSTEGAEPPPSGSNMPQAIRRSQERYSN
FT                   ITGGNEAIAILNPTRFLPSKPAISHRSELNRNTSSRQPRATNRNRAAGERQGEIVVHVG
FT                   KWCPEGLMRWSVVP"
FT   CDS_pept        join(403850..404317,404372..404395)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197835" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943368"
FT                   /orf_name="Pc14g01720"
FT                   /product="Pc14g01720 protein"
FT                   /protein_id="CAP74313.1"
FT                   /db_xref="UniParc:UPI0001831B02"
FT                   /db_xref="UniProtKB/TrEMBL:B6H600"
FT                   /transl_table=1
FT                   /translation="MSLPQALALPLEPNTLYILLLDLGGNCLFEWKLYLTSTPTTGQTF
FT                   HITNETGPTSWQHKSEVVYNIASNARVVLALQIGAVGPVLHAALGARLALVPLALYSAR
FT                   FRESLSCRVWVQEALFALDDEGYLGLARSVGDIEQEARQLGMLNKSRGTRSVLWGLWLM
FT                   "
FT   CDS_pept        join(complement(405635..405653),complement(405452..405531),
FT                   complement(404668..405366))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076625" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976496"
FT                   /orf_name="Pc14g01730"
FT                   /product="Pc14g01730 protein"
FT                   /protein_id="CAP74314.1"
FT                   /db_xref="InterPro:IPR013906"
FT                   /db_xref="InterPro:IPR023194"
FT                   /db_xref="UniParc:UPI0001831BCE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H601"
FT                   /transl_table=1
FT                   /translation="MPPSKWDDEEEESSTPPIVAAPRRRFDDEEEEEVLDSWDAAEDSE
FT                   VEREKAKKAEEAEAKAKAAAAANKKTKAQRIEELRQQRQREKGDDESESEDETTRRARL
FT                   RKTEQEADLAHAEDLFGSVDVKPNKGAPKAIVVSDSTDPTKAIDLSAMPLFKPTTKDQF
FT                   TRLSETLVPLLTLHSKKPHYALWAQDFTRKLVKELPSTEIKKIASALTTASNEKMREER
FT                   AADKGNKKSKAAKTKISLNASRDIHADNTNYDDGGDLGDDDFM"
FT   CDS_pept        join(complement(407420..407543),complement(407292..407348),
FT                   complement(406885..407224),complement(406037..406832))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000072174" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127595"
FT                   /orf_name="Pc14g01740"
FT                   /product="Enolase BAC82549-Penicillium chrysogenum "
FT                   /function="magnesium ion binding"
FT                   /function="phosphopyruvate hydratase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="cell surface"
FT                   /cellular_component="phosphopyruvate hydratase complex "
FT                   /protein_id="CAP74315.1"
FT                   /db_xref="GO:0000015"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004634"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0009986"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="UniParc:UPI0001831BCF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H602"
FT                   /transl_table=1
FT                   /translation="MPISKIHARSVYDSRGNPTVEVDVVTETGLHRAIVPSGASTGQHE
FT                   AVELRDGDKTKWGGKGVLNAVKNVNDVIGPALIKENIDVKDQAKVDEFLNKLDGTPNKG
FT                   KLGANAILGVSLAVAKAAAAEKGVPLYAHISDLAGTKKPFVLPVPFQNVLNGGSHAGGR
FT                   LAFQEFMIVPDTAPTFSEGLRQGAEVYQKLKALAKKKYGQSAGNVGDEGGVAPDIQTAE
FT                   EALDLITEAIEQAGYTGQIKIAMDVASSEFYKEDAKKYDLDFKNPESDPTKWLTYEQLA
FT                   DLYKSLAAKYPIVSIEDPFAEDDWEAWSYFYKTSDFQIVGDDLTVTNPLRIKKAIELKS
FT                   CNALLLKVNQIGTLTESIQAAKDSYADGWGVMVSHRSGETEDVTIADIAVGLRAGQIKT
FT                   GAPARSERLAKLNQILRIEEELGANAVYAGEKFRTAVNL"
FT   CDS_pept        join(409417..409624,409689..410075,410137..410593,
FT                   410653..410773)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943369"
FT                   /orf_name="Pc14g01750"
FT                   /product="Pc14g01750 protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP74316.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI0001831BD0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H603"
FT                   /transl_table=1
FT                   /translation="MSDPERSQALEDYKKSLLELREWEAKLKTLRLGIKDLQREFDVSE
FT                   DNIKALQSVGQIIGEVLKQLDEERFIVKASSGPRYVVGCRSKVDKSKMKQGTRVALDMT
FT                   TLTIMRMLPREVDPMVYNMSLEDPGSVNFAGIGGLNDQIRELREVIELPLKNPELFLRV
FT                   GIKPPKGVLLYGPPGTGKTLLARAVASSIETNFLKVVSSAIVDKYIGESARLIREMFGY
FT                   AKEHEPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDYLGKTKIIMATN
FT                   RPDTLDPALLRAGRLDRKIEIPLPNEVGRLEILKIHTSTVQKEGDIDFESVVKMSDGLN
FT                   GADLRNVVTEAGLFAIKDYRDAINQDDFNKAVRKVAEAKKLEGKLEYQKL"
FT   CDS_pept        join(411632..412103,412162..412806,412860..413818)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181987" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127596"
FT                   /orf_name="Pc14g01760"
FT                   /product="Pc14g01760 protein"
FT                   /function="calcium ion binding"
FT                   /function="mannosyl-oligosaccharide 1,2-alpha-mannosidase
FT                   activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP74317.1"
FT                   /db_xref="GO:0004571"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="UniParc:UPI0001831BD1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H604"
FT                   /transl_table=1
FT                   /translation="MAYQPSRSPLPSRSPFAPAQQDGFYGNPRSGLRGYGLSNQPIPLS
FT                   NKVNGYFEKDRTLPLYKDKPFFAPRRTGPRRRWRPFLNMLGACTVLFLLYYNFYLRTWS
FT                   GLQSNDKGVELWKWAQTLEDGKTSGDLSDWTARREKVRDAFIVSWEGYEKNAWGYDQYR
FT                   PVSNVNQEDTSGGLGWMIVDSLDTLMIMNLTSKVHRARQWISTSLNYNQDRDVNTFETT
FT                   IRMLGGLLSAHYLSTQYPDLAPLNDDDVGAAGEDLYIEKAADLSERLLGAFESPSGIPW
FT                   SNVNLNTSEGVVVHFDEGATSISEAGSIQLEFKYLAKLTGEAEYWKLVERTMQLVDLQK
FT                   PQDGLVRSAIHPDSGSFKGDRISLGSRADSYYEYLIKQYLQTSEQEPVYKEMWDEALRG
FT                   IRKHLVSFTKNSQLMIIGERPQGLDQDLSPRMDHLVCFMPGTIALGATGGQPLSQARKS
FT                   PGWTQQREEEILMSKELMKTCWAMHQATATGLATEISHFVLDSPPVMMADKYPDPLTNP
FT                   KRASKPEALRGISQPVEVQSGASAPWRADIDIRRNDRHNLQRPETVESLFYLYRITGDD
FT                   IYRQWGWEIFKSFIKHTAVVEKKSTSRIPTSTNTAPVFRIKGFTSLGNADAVPSYKRDN
FT                   MESYWMAETLKYFYLLFSDRDFISLEDHVFNTEAHPFPRFKPSGDLKTGWERVPRQ"
FT   CDS_pept        complement(414157..415449)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174939" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670525"
FT                   /orf_name="Pc14g01770"
FT                   /product="Pc14g01770 protein"
FT                   /EC_number="4.3.1.19"
FT                   /function="L-threonine ammonia-lyase activity"
FT                   /function="metallopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP74318.1"
FT                   /db_xref="GO:0004794"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniParc:UPI0001831BD2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H605"
FT                   /transl_table=1
FT                   /translation="MSGVQASPHPAPQQQLLGVPSSPSKSSYSQADLDDIINDSPLLSF
FT                   HRDLVEIESISGNEHDVGLFVAQFLEARNFSVVKQEVPPVKGQENTKTRYNIYAVPKSY
FT                   TEPPSIILTSHIDTVPPFIPYSTHQPNTDESTTTFDPEDLIIAGRGSVDAKGSVAAQVF
FT                   ATLETLDTQPDAKLGLLFVVGEEIGGDGMKVFSNSTLNAKDAINTVIFGEPTEAALVAG
FT                   HKGMLGFKVLAHGSAAHSGYPWLGKSAVSAILPALSRIDVLGDIPVEEGGLPASPKYGP
FT                   TTLNIGFIRAGVATNVVPSEALADVAVRLAAGTPAEARKIIQRAVDEAVQDVEAEVSLD
FT                   FVSHGECYPPQDLDVDVDGFDVTTVNYGTDVPNLAVGPGAKRYLYGPGSIFVAHGDNEA
FT                   LSIREIKEAVVGYKKLIEAALDREEKGEVTV"
FT   CDS_pept        join(complement(416660..416668),complement(416443..416612),
FT                   complement(416260..416267),complement(415944..416073),
FT                   complement(415814..415841))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976497"
FT                   /orf_name="Pc14g01780"
FT                   /product="Putative uncharacterized protein Pc14g01780 "
FT                   /protein_id="CAP74319.1"
FT                   /db_xref="UniParc:UPI0001831BD3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H606"
FT                   /transl_table=1
FT                   /translation="MYNIIAYTTLVPPHLGRIPVPKHYYALFSLHNDRIPPCSRNIGAG
FT                   LRWECEQGTSLSQSRDQDVQSNFIEVLHFAPEMKCPTSDIPGLFQSLITLTSFPRYIAG
FT                   ARYGHTPHIS"
FT   CDS_pept        join(416919..417197,417254..417521,417572..419748,
FT                   419866..420258)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205604" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943370"
FT                   /orf_name="Pc14g01790"
FT                   /product="Pc14g01790 protein"
FT                   /function="acyl carrier activity"
FT                   /function="catalytic activity"
FT                   /function="cofactor binding"
FT                   /protein_id="CAP74320.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0001831BD4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H607"
FT                   /transl_table=1
FT                   /translation="MEFHRKRLLATTVDDRAETNPNQRFAVIPQGSEIRHGFQNLSIKD
FT                   LARAVNSMCWWIEGNIGQAQSPETLAYMGSNDVRYFMFMLACQKTGYQALLPSTRNSDE
FT                   AHVHILKATNCTKFFFSEERQTRTREIQRLVSALDIFEVPTMKEILNDESGLHHYSYTK
FT                   SYTDAENDTTCIIHSSGTTGMPKPVYLTNGFFMTFDSISHLAKPAGRQPSMFHDLDQTE
FT                   LVLTTTPFFHLMGLAALVFSVWFEVPTLVGPDKPLSVDHMIELLRTARPAVALCAPSIL
FT                   EDLSYSDKALACLKELKSVYFGGAPLSLETGERLRKSTQIISVIGSSEAGIIPALVPED
FT                   PANWGYFEWNEAYGMDMQDIGEGVFEMVIPRQENARDFKGIFHTYPDLNLYPTNDLYTP
FT                   HPTNPRLWKFHGRKDDVIVLSNGEKFNPVGMETIIEGHPLVGKAVVVGQSRFQAGLLIE
FT                   PSHGGPDMEANFFIEEIWPTVQVANQSIAAHGRVMKNKIRFAMKTKPFKTTPKGSVQRR
FT                   AVLRDYEKEIDAMYAEGLENGLDQCLPETLDHESVTEYIRQITTRVLEKPKIADTQDFY
FT                   SAGLDSLMTIHLSRVLQKGIQLRRPDVKAGAISAQTIYGNPTVDRLSRAVIAILDGKSQ
FT                   AGIPRAEKIQCLVEKYTSDLPAREVYPQNGLNLPSTVILTGSTGSLGTYLLHSLLSSGS
FT                   ITKVYCLNRSDAESRQKRSFEEKGLYLGANDWKDKVEFLQASFGEPRFGLNETKYQELL
FT                   DSVDAIIHNAWKVDFNHSVDSFEDTHIQGVRRFIDFSLSSRSNAHLHFISSISTVGAWT
FT                   AEMGAPIPEEPMADIAVVLPQGYGESKHIAERICVEASRRSHVPTSVYRVGQIAGPTSA
FT                   QGQWNPQEWLPTIIATSKAMGKIPSRLGSAAVDWVPVDTLSNIIVETVNTRQSCSSEGR
FT                   PAVFHLTNPERAPWSSLIPAIQSQYAVEPVAFSAWIAELESITNPSSADIASKPALKLL
FT                   GFYRGLQDEGSALSVALDVRRSKEASATMRTLGPVSASLMQNWLQQWQF"
FT   CDS_pept        join(complement(423420..423512),complement(423173..423244),
FT                   complement(422995..423085),complement(420420..422638))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000117811" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823305"
FT                   /orf_name="Pc14g01800"
FT                   /product="Pc14g01800 protein"
FT                   /function="beta-galactosidase activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="beta-galactosidase complex "
FT                   /protein_id="CAP74321.1"
FT                   /db_xref="GO:0004565"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0009341"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001831BD5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H608"
FT                   /transl_table=1
FT                   /translation="MPQYAPLVTAHSCEKNRTEHCGSATRLAFFQMSATLREGHGILCP
FT                   DPNLSICRERTHNRQTYINRWDYINRNTLKSKSSQPASSIMAPAALAACAVGAVTHRRT
FT                   SGLSEDELSLGPSLDRWPRGTHLAVDYYPSQWPEQMWESDIAQMRDANLSFVRVNEFDW
FT                   SILEPTEGQYNFTLLDKTLELLGRYQLKAIIGTPTATPPNWLTEKYDVSFVDNTNTTLL
FT                   FGSRRGYSTSSTDYRLLSQKITRKLAERYGNHSAVAGWQLDNEFGCHGTVQSYDHNAIR
FT                   RFRTWLQTKYGTIDNFNAAQGRVFWSNQYTSFDVIQPPFLEVYTTQPDHALDWYLFSSD
FT                   MVIEFAREQSEILRQYAPTHFITHNFMMGFTDFDHFKFSREVGLDLTTFDEYPLSGPDS
FT                   FSWLSLEDQAQYLRTGLPDWQALHHALYRGVAGAAYNRTSGPFGVMEMQTGVLNWSPYR
FT                   VSPLSGMVRLWTHETYAGFGDIVSYFRWRQVPYAQEQTLSGLFIPDGAADEGFLELETV
FT                   INEDLPKLRDGLSTGEEQEHQADVALIFDYVSSEVWAIEPYSGEWDPKSSSYLNPAVKY
FT                   MDIVYKFYSALRRLGLSVDVIGPDQPIDGYKLVVVPSLPIIPETFNQALADYNGPVVFG
FT                   PHTGSKTATFSYAPGLNPSKGPLRDRLPMRVTRVETPPSYAGSGVAYGEKKFNISGWEE
FT                   WVVCEREGRTSNVAMTYTSSHRPGQPAACSMDGLHYLGFNPSVDVLVSYLGDVANAARI
FT                   TDFAGRQADSSNDLGPTLRFAKRGALLWVFNYGLEPVSIPVIEGAELLIGGGDSEIASA
FT                   DIAVWRLKNVQN"
FT   CDS_pept        join(426722..427001,427071..428275)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181989" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943371"
FT                   /orf_name="Pc14g01810"
FT                   /product="Pc14g01810 protein"
FT                   /protein_id="CAP74322.1"
FT                   /db_xref="UniParc:UPI0001831BD6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H609"
FT                   /transl_table=1
FT                   /translation="MYKLSQIIDATRESLDADSSTRQPHSSLTINTSAPASPAISLFSA
FT                   GHNRVSSSVSSLVSSSGLGNSMESPSRSHLTGVKEEECTRDSLEDHYFQHFDSGMSAEE
FT                   SYFAPMHNSDSYDLSDTGMETAPSPKKRRSGSESASFKGVSRINSHISTMSARWKNKRS
FT                   SSGAEGDIFPDDLRSRANSAASSALASPITGSMPMSRVDSIPPSPARTIFEERLSESGT
FT                   RPIDITRANSLSQDDNDVQKATTPLLPPFMGDDPTSVVASRVQSPLQSPSVADASEPHF
FT                   NYNVTSDPRFMGILPSPPLSSKPSVASFNRPRASTVRTVSGDATPLVLSDPNDEWANKL
FT                   GHANFTITPEPYDPVVCDIGNFRQMRADWDIARCNFAKHLVRTGEHYGVTSNIYKLTIE
FT                   KWESINREWATQHEAMRDQLSAVDGVALTLTQSNMHPCQQVRIPRLHDNDKFPDMGDED
FT                   IVGPMTVAPATEIAGPCRSEKKRNFFRFFQDLVSRT"
FT   CDS_pept        join(complement(433058..433148),complement(432847..433004),
FT                   complement(432660..432772),complement(432295..432600),
FT                   complement(432112..432239),complement(431887..432023),
FT                   complement(431770..431830),complement(431558..431703),
FT                   complement(431333..431497))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976498"
FT                   /orf_name="Pc14g01820"
FT                   /product="Pc14g01820 protein"
FT                   /protein_id="CAP74323.1"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR006551"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR015636"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001831BD7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H610"
FT                   /transl_table=1
FT                   /translation="MAEGAAKRSASPTRAISPPPLRRKVDSTVTKKSAANFFTPASQKK
FT                   PEPITWRVIGTSVVIGKQITGKAVPPTGKQRRIAGFDLDSTLIKTKSGNVFPKSATDWQ
FT                   WWNAKVPGRLKELNAEGCQVVIFSNQKKISVQKDIKGGRSDSKSLSNFKEKMTAVMTEL
FT                   DFPVSVYAATTDPEYRKPRLGMWHEFLDDYDLDVAGVDLPASVFVGDAAGRPGDHSAVD
FT                   RGFATNIGMPFKTPEEFFLGQITEPASMGFDPMSFVKTDLEEPAKPFTRKHPLELVIFC
FT                   GSPGAGKSTFYWNHLEPLGYERVNQDILKTRPKCLKVAREYLEAKKSVAVDNTNADPET
FT                   RAHWTTLAKELSIPIRCVQFISTPELCRHNNAVRASNKELNPESRTSLPGIAFGDFARR
FT                   FRAPTLDEGFDDIIPVEFQFHGSEEAKGLWGQYWV"
FT   CDS_pept        join(complement(434208..434698),complement(433832..434150))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048522" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823306"
FT                   /orf_name="Pc14g01830"
FT                   /product="Pc14g01830 protein"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAP74324.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="InterPro:IPR019095"
FT                   /db_xref="UniParc:UPI0001831BD8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H611"
FT                   /transl_table=1
FT                   /translation="MHEQSLFASVPVHQHHELLQQLAGLTAMQPRHCLERRLIFKAYRK
FT                   PGMAGRIGASQDLQQGDLQRLNKMLNGNMYYTQVVGPVSESDFGSTAPIDRDTQMAGMD
FT                   DSKPYDSSSPSYDYERQPWKLEFRDIPEAGTRSAVTSRLMSSATLPRGDVVEAMNAWGY
FT                   HFITEYVVEGDMFVLNDIAIFLHRVLHYPGGDESSLPRRQLPALKDMTLFEKSGSYVLQ
FT                   AFIIVQDGSNQETMKTASQHLFGLREQLKSAVLLEQADRLSLDTRAK"
FT   CDS_pept        join(435847..435922,435987..436270)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182011" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976499"
FT                   /orf_name="Pc14g01840"
FT                   /product="Pc14g01840 protein"
FT                   /protein_id="CAP74325.1"
FT                   /db_xref="InterPro:IPR020373"
FT                   /db_xref="UniParc:UPI0001831BD9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H612"
FT                   /transl_table=1
FT                   /translation="MRATSILSGTARTPLIRFVGKRSVPKSIDHSPRVHPASPTGSLPD
FT                   SFATYRAKAQQHGPLGRSSFNSTVGGTAGAALGPVKPQAGEFFDRAELPSRFGRLPWTQ
FT                   AEIDAIETGGASMFA"
FT   CDS_pept        join(436996..437136,437468..437577,437822..438267,
FT                   438348..438392,438465..439238)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127597"
FT                   /orf_name="Pc14g01850"
FT                   /product="Pc14g01850 protein"
FT                   /protein_id="CAP74326.1"
FT                   /db_xref="InterPro:IPR014851"
FT                   /db_xref="UniParc:UPI0001831BDA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H613"
FT                   /transl_table=1
FT                   /translation="GSCIICRLQPSTSSTEHFLVRFAITVRIDDDGPLYHHLLRWMMDH
FT                   RPPSSRFCSLRATSKSKIPWADEDDALNSVEGAETQDTKFVNYRYIVNQPPISLQPFQD
FT                   THTHLFQHHGKQILFHHIASKISTYNGXRTAATFSCNVLALVLIPCTVFSRRCSRITRT
FT                   KPRLXHTVYRSIYSSKTASRWSNFNTRPSXAIFAVISDKEKDEWLQDINEYPPSNHGIP
FT                   YRRGYLFLVAHGILTFALAGLNIYILSHLGPEQNPVFLRLPPX"
FT   CDS_pept        complement(440335..441420)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976500"
FT                   /orf_name="Pc14g01860"
FT                   /product="Pc14g01860 protein"
FT                   /function="signal transducer activity"
FT                   /protein_id="CAP74327.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniParc:UPI0001831BDB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H614"
FT                   /transl_table=1
FT                   /translation="MLKKKTLAPSLFFRNHTPHTPTATPELSPTSSDSDSEEDMESSGS
FT                   RPASLAISSGAFSMRPTLDEVLANIAPPPYTLSAFMAYLSQNHCLETLEFTMEANRYRD
FT                   SYYALAERLGVAALESDCPESQHLRMLWKRLLTAYIFPGSPREINLSSEVRDALLQYKS
FT                   VSAPPVPETLDSAVKRIHDLMEESIFLPFVNSHTTSPSMGPSEPFMGPDDFMSLSSTSL
FT                   DEHPMKRVRSRVSKRTSPQSSTKDLPATGHNRSTMSLGAVHAIGKRTSGALVSTSTSGE
FT                   SAYLSLTDDSGSPQSSPTAEEPMTPPTTPPASEPHLPMQSPRFRTENPWKKMGMKLGFK
FT                   KRSTGGSSGGTRDPKILGLDD"
FT   CDS_pept        join(complement(444963..445123),complement(444595..444716),
FT                   complement(444190..444250),complement(444059..444086))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976501"
FT                   /orf_name="Pc14g01870"
FT                   /product="Putative uncharacterized protein Pc14g01870 "
FT                   /protein_id="CAP74328.1"
FT                   /db_xref="UniParc:UPI0001831BDC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H615"
FT                   /transl_table=1
FT                   /translation="MTMPPLPNPPTLASDEKRTCPGTTANILVTILEALCRFYIRNVPQ
FT                   SVLHKKEPTETEQKEERVNNPLAKRDIVLDAFNPITLVRTKRGENVASQGAIGVGVLLG
FT                   TFCFLLLCIPTSFNGLCSN"
FT   CDS_pept        join(445742..445793,446112..446228,446343..446395,
FT                   446732..446817,446891..447000,447136..447273,
FT                   447342..447484,447766..447897,447981..448069,
FT                   448245..448404,448788..448901)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127598"
FT                   /orf_name="Pc14g01880"
FT                   /product="Putative uncharacterized protein Pc14g01880 "
FT                   /protein_id="CAP74329.1"
FT                   /db_xref="UniParc:UPI0001831CB7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H616"
FT                   /transl_table=1
FT                   /translation="MPRMTSCFSTVSTAIFQDSSDYYLLHKRPGIQFTECSGAIPLDMH
FT                   SGLRSVRSPDLVAYVNVLNTECGVYNIEMQESSKSQPNHEVVNQPIPAKVHTHAQKASH
FT                   AKTKSPSGEGDKCGGKASGWTNAKHLKAYYTTLLYSGIGYGLGFCGCSWVLAGSLGGWC
FT                   ISVFTVISLLSMRMQGHSVDIIVKYGWWDMYIRGVCLCGKGLAYWVMGLIFSLCFRAKG
FT                   IQVVNWDIRVYGTRSGDLRHAITCRGLVILALACHGELQNGYEVGVGGGNGKTMIVHSM
FT                   SYTYRGASIYSARTPDEEIKHIRLRLPIVKSKVISRNQQPITYSHSSRLPIPSIAGSIH
FT                   RQFPGTEDPDDSHQPGPIKRGHPLRCKMPLIQITVARLVDDGKSSVIRAIDHAWSQP"
FT   CDS_pept        join(complement(451609..451737),complement(451486..451555),
FT                   complement(451279..451427),complement(450181..451221))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182055" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976502"
FT                   /orf_name="Pc14g01890"
FT                   /product="Pc14g01890 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP74330.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831CB8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H617"
FT                   /transl_table=1
FT                   /translation="MASSSSNVVGVHYRVGKKIGEGSFGVIFEGTNLLNNQQVAIKFEP
FT                   RKSDAPQLRDEYRTYKILVGCPGIPNVYYFGQEGLHNILVIDLLGPSLEDLFDHCNRRF
FT                   STKTVVMVAKQMLSRVQTIHEKNLIYRDIKPDNFLIGRPSTKAANVIHVVDFGMAKQYR
FT                   DPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDLEALGHVFMYFLRGGLPWQGL
FT                   KAATNKQKYEKIGEKKQTTAIKDLCDSYPGMLSHFYPYPIHLLITPPEEFNKYLSYVRN
FT                   LGFEDTPDYDYLRDILTQALKNAGEVEDGEYDWMKLNNGRGWDYKSYSSQAHLHNQHQG
FT                   SSGRDQHARELRNSQRPGVTADRLNAAQPPPPSPVKVGAGKTRERPSAGGMPPKRQSAG
FT                   VEASTPAASTQAQFQNSNAHLPGRNGSPGNPALSNQQALGGQGAPESPPTFTQKLMKAL
FT                   CCGR"
FT   CDS_pept        join(complement(454630..454732),complement(454205..454546),
FT                   complement(453771..454127),complement(453124..453680))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048523" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670526"
FT                   /orf_name="Pc14g01900"
FT                   /product="Pc14g01900 protein"
FT                   /protein_id="CAP74331.1"
FT                   /db_xref="InterPro:IPR013719"
FT                   /db_xref="UniParc:UPI0001831CB9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H618"
FT                   /transl_table=1
FT                   /translation="MAFASINSTGAPIAVIEEAFATEPLLKKRVYDAIGSTPQHKPLLE
FT                   DLAKYTSSLLARTGNTTLPSRPPAADGPAVKKRKLQNGDSETAQASVDLKDGNAPVQYY
FT                   VQDVSFSTPQRKKLTLEITAGHPYLRARNQATKEIEFGVSMDKIRHALCLPVPEKTQKQ
FT                   FNFCIIPEYADGITPPPEGTAASEAMVFTIADGPAKAAFSGNGKQLGHGPGESAEAFIR
FT                   KILNENMSHTNVVRPDDKQFVSAMPEAHRKGEKAYHVKAFRGSKEGYLFLLSTGILFAF
FT                   KKPLLFFSFATIDSVSYTSVLQRTFNLNVMARPENGSEEDNQEFEFSMIDQDNFSGIDT
FT                   YIKRHGLQDASLAEARRAKVYNVNKAGGEDTAASTGEAAGEDESELQKAQRELEDQEDE
FT                   EEEDYDPGSDDSEGSGSSSEEDDEDDEDAGQDSDEDMVENELGSEAEDISKDH"
FT   CDS_pept        join(complement(455780..456196),complement(455041..455697))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182056" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670527"
FT                   /orf_name="Pc14g01910"
FT                   /product="Pc14g01910 protein"
FT                   /protein_id="CAP74332.1"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014723"
FT                   /db_xref="UniParc:UPI0001831CBA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H619"
FT                   /transl_table=1
FT                   /translation="MQRVIQRTATARRQALKRSQKAHEREELLERVSIRRARKDFGGAL
FT                   SSQFQAARKNRWEDWEKGPLAPMRDSGLQRTTYGGQEASILHPPRLPKQEQRRHVLFAE
FT                   GDRVCVVRGRDQGKINVIQQVNRDSETVLIKDINMADVIIPEWAKDRMGHAGDTQPQPF
FT                   PVSFDDIRHVIPLEDTETGKLQNVIVQHAYAAGPYHDRGQHSKLPSYTRYVSGLDIEIP
FT                   WPLEDDPVITDGDMDTPRMEVEVTTFEPTLKRPPMPRTVIDELRNKYSRFRTRHDPKYL
FT                   EEKMMEDYRKEYRNTVSMMTPQTDAKNMRIARLAEARKAKFDAEGNGILSPDAINFINN
FT                   HLQNAPKTKKSKSKQAA"
FT   CDS_pept        join(456517..456614,456720..456753,456821..456903,
FT                   456949..457074,457619..457723,457851..457991,4
FT                   58040..458100)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976503"
FT                   /orf_name="Pc14g01920"
FT                   /product="Putative uncharacterized protein Pc14g01920 "
FT                   /protein_id="CAP74333.1"
FT                   /db_xref="UniParc:UPI0001831CBB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H620"
FT                   /transl_table=1
FT                   /translation="MKPGNYRQISLRPIKLKSLRICLYKQFSITVYWSITEDLKITDVV
FT                   VNLIDFPNADHRNTLMCNHLRRIKKHKRPWNWGTDAALPRKAQMTTIGGRWNAKVSAGK
FT                   NTLIPNSCWARHNAIIGAGNISTPLSKQRLQECGEVMEARKQVKGKHGIVGDLHLQHSQ
FT                   YMLIAPSKQINAEATEMQGTIGTIFTGRAEDFGDIACRSLHIPAGWYIVREI"
FT   CDS_pept        join(459231..459298,459390..459417,459530..459727,
FT                   459805..459939,459994..460161)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823307"
FT                   /orf_name="Pc14g01930"
FT                   /product="Pc14g01930 protein"
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP74334.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="UniParc:UPI0001831CBC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H621"
FT                   /transl_table=1
FT                   /translation="MAEIRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVAD
FT                   VEVDNKHVELALWDTAGQEDYDRLRPLSYPDSHVILICFAVDSPDSLDNVQEKWISEVL
FT                   HFCQGLPIILVGCKKDLRDDRKTIDELAKTSQRPVSQDQGEEVRKKIGAYKYLECSART
FT                   NEGVREVFEAATRAALLKATKGKGGRKSGKGCLIL"
FT   CDS_pept        join(complement(463351..463584),complement(461890..463182),
FT                   complement(460989..461837))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182067" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943372"
FT                   /orf_name="Pc14g01940"
FT                   /product="Pc14g01940 protein"
FT                   /protein_id="CAP74335.1"
FT                   /db_xref="UniParc:UPI0001831CBD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H622"
FT                   /transl_table=1
FT                   /translation="MPGSDHDSVIPAQLSYLAIYNPTLGPTDETLADQIVFYTSKSSCA
FT                   RRIDGSTTEGEANKCLEDEGNERLRQIGLAQGMVVQITAQITKLTLSQSIDLTRIPADQ
FT                   GQRTSGASDSPAFYYSSREMGPPPLLIQQLRRAHSEFLLHHDFKLDSLLDQVGRSTFCL
FT                   FLERYWEKFAWNWELLLTGNPIVDIYNGIKLSAGGELGIGVGEEEWGSGEREVLEDFVT
FT                   RTDGLVDLAVSRFGDEGSPALAGSNDESRWLGADNDPRPSDGVIFTGVGALSRHSLAQV
FT                   SHWMQCIYRFGDAAYGVGRDPTSLRRRKPRKQRGRQISEDAPQPSTPARSFTPGIPRPL
FT                   VTAAPQPSPEVVEQNQAGTRNEASPLRTEQNSENPGFPTETVMKYLTLGYGSSWSFSPK
FT                   STSTPPESSTPMRDESNSYMSTPRNRPTSAAQSSQAGINHRNSKRNSPSGHFVLGPRDD
FT                   LETLDDLEEGSPEPESENGKPNTRIVHRTLHVHLAEGSDATPTRLRVVIYVHQPFMFAF
FT                   LFDPETPALSSPSLYSSIHHQLGPLQKPLLSSTSPTTAASRIAMSETSPDPNKRFSTRT
FT                   QPVYDLVYDPSNLTIRSSIPNIPSMDITSPSTHLTNSPARSPSPSPSQASTPPPWSRVE
FT                   SLAIHHRLLSTHADTRSRPQELERTSKTHRGWWVLWVRIPHSTAQTPTALSATSSSAAL
FT                   SSIANNDDSFPASQSQTHSTPPPQEAFLVRKASDYISPASQGRVSSGARFFRDLGGASS
FT                   STGLAGPSRATDMAPSKLVEGLGMDARRYIEGLLSLNR"
FT   CDS_pept        join(463765..464023,464078..464148,464200..464327,
FT                   464386..465118)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127599"
FT                   /orf_name="Pc14g01950"
FT                   /product="Pc14g01950 protein"
FT                   /function="hydroxymethyl-, formyl- and related transferase
FT                   activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAP74336.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016742"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR015518"
FT                   /db_xref="UniParc:UPI0001831CBE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H623"
FT                   /transl_table=1
FT                   /translation="MWIIPGPASLRLCKRPLVLRGLVFRSYTTKTSDPLRILFCGSDEF
FT                   SIAHLKALHAYHLKQPERISSIDVVCRPGKRVGRGLKQFREVPLKAAASALSLPIHEID
FT                   TFTGWTPPTSPNGHINLVIAVSFGLFVPPRILNGAKYGGLNVHPSLLPNFRGPAPLHHT
FT                   LLAGETTTGVTVQTLHLKHFDHGVILSQTPPPGLDIPNPETCTVPELVDFVAPKGAQML
FT                   VETIDKGLFVPPIDNVGTEQVRQLKHAPKIVPEDRHINWANWTLADINRRSRVIGPLWS
FT                   KALCSSNPADGPLSFQYKRVIFTDTEEVDPPKGSDSFSILPGLPFTNSAHPVEPKKSRQ
FT                   LYVFTADGKVLRINRMKVEGEQDAEGLRAAIKARMFSDRAFQYEGRELTPFRNSLV"
FT   CDS_pept        join(complement(467813..467902),complement(467155..467757),
FT                   complement(466934..466961),complement(466751..466826),
FT                   complement(466248..466392),complement(466073..466159),
FT                   complement(465794..465901),complement(465659..465710),
FT                   complement(465514..465602),complement(465399..465461),
FT                   complement(465206..465334))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823308"
FT                   /orf_name="Pc14g01960"
FT                   /product="Pc14g01960 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP74337.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013969"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0001831CBF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H624"
FT                   /transl_table=1
FT                   /translation="MPFSFASLSFWGLLLWCAILAITLGAGTLIVLLLSLMISQNITPP
FT                   KRRRRGSPVHLLVVLGSGGHTAEMLYMLERMNLDPQIYTYRTYLVSSGDNFSAEKAKAF
FT                   EAQRGQSSQGHAYSDNYSIASVPRARRVHQSYLTAPFSTLRCFWACLIILGGRHPDQKL
FT                   PKEYSSFYPDLILTNGPATAVCVVAAAKFIRFFQCLTKCAAWCLGLRTFSSFTSAPKLR
FT                   TIYIESWARISQRTRFSPGYGIYNSNPPSRSLTAEKCPGEMVTIGLGALAAEKFASEGS
FT                   NVAINYMSSKEIADKLASDIASKYGVKTVVIQGDAGVKDDCINAVKTTIEKLGGLDIII
FT                   SNACWSVNVKSSLHLFKAALPTFNANPEGGVFLITASIAGIMPSGSSLPYAVSKAASIH
FT                   LMKCLAKTQGAKVRVNAILPGLLLTEWGQRFPSDKIEGWTNATALKKVPEVEDCADMFI
FT                   TLAKNASITGQAVQIGKSLRSSGRAETDNSF"
FT   CDS_pept        join(468223..468348,468411..469268,469321..471000)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182101" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670528"
FT                   /orf_name="Pc14g01970"
FT                   /product="Pc14g01970 protein"
FT                   /protein_id="CAP74338.1"
FT                   /db_xref="InterPro:IPR018617"
FT                   /db_xref="UniParc:UPI0001831CC0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H625"
FT                   /transl_table=1
FT                   /translation="MASLFSKRLTCFYCGQRSAHSHRGPVRNFRCEHCEADNFFDEKGE
FT                   ITDPPAVVTNAEVYAPGASDSPFESTDFSGSQSFCAKCTRNQHLFTSSLASYFPPSDDP
FT                   TDSEYERGYEQFRRNLEDRYPQVCESCEPVVKSRIRRAGYEAKSDHLRRMMDQSRANRE
FT                   SRQARNRSWRSLLLFVGAFAYWASIAGQLAWSLISVATISQSPSNSDYSPDTERPPMTP
FT                   NSVVSCVTQSIRLQRIPSECSPDLAPTAGLALIAGVLSLWWNPKLRMKIDGMPGKFGGL
FT                   AEYYQAQLIVIVARCVFWAIVKDPTASGLEPGLISAFHALMMGFTILSVFFSRYIVSYS
FT                   SRPLVNWSDNSWETQFESLKASSSALPESPLSARITRSGGTPKANIGGLQQRFPIDKLA
FT                   QPQPRSSAEQSLTVAPDLIDNDGMDWSPSITHNLRPTVTRRDQPSVLDGPHPFQGQIPA
FT                   APMPPAWKLRTQTSTKPIEQVIQPNPFHRNPTQPQGQWQQRRADAEPVFKEPKFFPPHD
FT                   HDTSTGLETLFDRAFNFQADAAQGTGWSQQPNQGSHVDDTQSYLFYGCLRLGLLISFIS
FT                   AWTISQNHQVSIPGNYVEIAALGAASLVAGFALITMVKRPLVQWNGMEILISITELAAA
FT                   VHMGAHLPTISLNRDYFDRYGKLLLIFMAAQETMNVVSFYNKARLESQQHPGSVSPQSQ
FT                   PQSPHQSQSGALDWPASQSSSKFTPEPRVSTPPVHRSFESQPSAPPLSFGDTEAASSFS
FT                   SALPSVPQYGLTSSRTVHSFPAANQNTFNQNNRNPHSFTMESLKQIDPVSDYERDSDTE
FT                   TVATTTTAATNFTNRNIRYGNNSGLGSNAFYSPRRNGLGSGMGGLSLDDDPTPRRMTRS
FT                   QTQNGLLGRRPTNYVR"
FT   CDS_pept        join(complement(473442..473537),complement(473301..473377),
FT                   complement(473016..473240),complement(472406..472950),
FT                   complement(472343..472350),complement(471842..472272),
FT                   complement(471708..471781),complement(471517..471647))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943373"
FT                   /orf_name="Pc14g01980"
FT                   /product="Pc14g01980 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP74339.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831CC1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H626"
FT                   /transl_table=1
FT                   /translation="MSWLLKKIVHNEAMKSDPKEIYGWRVFMLACSACFGGMLFGMDTG
FT                   IIGGVLVMPGFKQTYRLENISEVDAANLSANIVSTLQAGCFFGALAASPIAEKWGRRMA
FT                   LMGAAIVSVIGIAMQTAASGHIEAMYIGRLICGFGVGAASMINPLYVSENAPRAIRGGL
FT                   TGLYQLFITMGIMLAFWINYGSLLNIEGPAMYLVPLAMQGLPAVLLFFGMLLCNESPRW
FT                   LAKQDRWEEARATLCRVRNLPADHPYVEEEFAAISTQLEQERALIAGSSFWDLMKEMWL
FT                   VPGNRKRAIISIFLMICQQMTGTNAINYYAPQLFQNLGLTGNATNLFATGVYGIVKVVS
FT                   CGVFLIFVADSLGRRRSLLWTSIAQGLAMLYIGLYVRIAPPVEGAPVIPAGYFALVCIF
FT                   LFASFFQFGWGPVCWIYVSEIPTARLRSLNVSFGAATQWLFNFVVARAVPNMLATVGAN
FT                   GYGTYIIFSCFCFSMCVFVWFFIPETKGLSLEKMDELFGVTQLVEHKNADAERGSIGEG
FT                   DKASQAHVERV"
FT   CDS_pept        join(complement(475972..476336),complement(475471..475829),
FT                   complement(474232..475391))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182122" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943374"
FT                   /orf_name="Pc14g01990"
FT                   /product="Pc14g01990 protein"
FT                   /protein_id="CAP74340.1"
FT                   /db_xref="InterPro:IPR016624"
FT                   /db_xref="UniParc:UPI0001831CC2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H627"
FT                   /transl_table=1
FT                   /translation="MSVHANGRTPSQAFSKSPFRTRSDLQEACRALLDPLVPLFTTGGT
FT                   RVKVGTSTTRFDEGGAQIEGYARPLWGLASLLGGGYEYAEAERWRQGIINGTDPEHPEF
FT                   WGHIEDMDQRMVEMCPIGMVCFWCELNQSANYGGDDYRLWFRVFANLGLRKNGAEYSLS
FT                   RIEADMDHLDTFHVGGGWSNDGPKSHHQMDYYSGSFAIQFLQLLYSKLAGDFDPERAER
FT                   YRQRAREFATDFVHYFDPNGSAIPFGRSMTYRFAMVGFWGALGFADVELPEPLTWGVVR
FT                   GILLRHFRWWSTQEDMFNNDGTLSLGYSYANMYLTENYNSPGSPYWCCLSFTPLALPET
FT                   HPFWSAQEAPYPSSSLPEVVALKYPKHIAIRRGGHSFLLSSGQACHYPLKATQAKYGKF
FT                   AYSSAFGYSVPTGGYQLEQHAPDSMLALSDDGGDIWQTRRLALDARFEEPEPNGQPILV
FT                   SGWKPWPDVDIETILIPPTEETENWHLRAHHVRTGRALQTSEGAFAIYGCHSDNGRTLG
FT                   PMTGDDSEGTMHDGRSGLVVSSAGAVGIVELHSPIGRAGRIVLADPNSNIIHGRTLLPS
FT                   LSVDLVAGQACWFVTAVYAVPHRQRDWKAGWERKPVIPGWLQKRMESTDQS"
FT   CDS_pept        complement(476867..478204)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209616" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943375"
FT                   /orf_name="Pc14g02000"
FT                   /product="Pc14g02000 protein"
FT                   /function="catalytic activity"
FT                   /biological_process="protein modification process "
FT                   /protein_id="CAP74341.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniParc:UPI0001831CC3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H628"
FT                   /transl_table=1
FT                   /translation="MLTLRGCSSSSARWTSPLKHRWIRHNSSYPAHQFAELASRPSSLH
FT                   QIYQSLSTDPYVNLSIEHFLLENAPADSSILFLYANRPCVVIGRNQNPWLETDLRALHN
FT                   DRRNGTTGEDEAAVFVRRRSGGGAVFHDEGNLNYSVICPRTSFTRDKHAEMVVRALHQV
FT                   GATNTSVNERHDIVMARSEGMQNDPNEPLTRKVSGSAFKLTRFRALHHGTCLLDSPNIH
FT                   DLGRYLRSSARGYIQAKGVESVRSPVGNVSTALADSFFSMQSVVESVIEQFAQLYQVHP
FT                   DAVLRARRAHANEPEVFAGDSWVAGTVGEVQGEQVPAIGKGIAELRSLEWKYTQTPRFT
FT                   FSTYPIEEDPRERPPLPSSLPSSTRAFLRLQHGAIVESHISVSPNESTASEQASRVHSA
FT                   LNGQKLHEITLARWTELLKQGLGGTEGVDDTLVKELAHFLGGLLGG"
FT   CDS_pept        join(478439..478473,478526..478887,478947..479782)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000060335" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943376"
FT                   /orf_name="Pc14g02010"
FT                   /product="Pc14g02010 protein"
FT                   /function="chorismate synthase activity"
FT                   /biological_process="aromatic amino acid family
FT                   biosynthetic process"
FT                   /protein_id="CAP74342.1"
FT                   /db_xref="GO:0004107"
FT                   /db_xref="GO:0009073"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="UniParc:UPI0001831D97"
FT                   /db_xref="UniProtKB/TrEMBL:B6H629"
FT                   /transl_table=1
FT                   /translation="MSTWGQYFRVTTYGESHCRSVGCIVDGCPPGLEITEADIQPQMTR
FT                   RRPGQSALTTPRDEKDRVEIQSGTEFGVTLGTPIAMVVRNEDQRPKDYGGSTMDLYPRP
FT                   SHADFTYLEKYGVKASSGGGRSSARETIGRVAAGAIAEKFLSLAHNIEIVAFVSSVGNE
FT                   HLFPPTPEHPSPSTNPEFLKLIETIDRKTVDSFAPIRCPETDAAQRMTKVIEKFRDNHD
FT                   SIGGTVTCVIRNVPVGLGEPCFDKLEAKLGHAMLSIPATKGFEIGSGFGGCEVPGSIHN
FT                   DPFIANSSTSEAGGPRLTTKTNNSGGIQGGISNGASIYFRVAFKPAATIGQAQTTTSYD
FT                   GEEGVLEAKGRHDPCVTPRAVPIVEAMSSLVVMDALMAQYAREGAKNLLPRKPQTIPTH
FT                   PATAPNGTPSS"
FT   CDS_pept        complement(480455..483274)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209627" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943377"
FT                   /orf_name="Pc14g02020"
FT                   /product="Pc14g02020 protein"
FT                   /protein_id="CAP74343.1"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI0001831D98"
FT                   /db_xref="UniProtKB/TrEMBL:B6H630"
FT                   /transl_table=1
FT                   /translation="MKHRKAKALLALALVGPSTAIPYTPSSIFLSPQHNDSIAYILRPS
FT                   STGETEFVSLNLSSSIDAKNPSYQTLLKSTPFYSSDQNSTFISAINDQGLITVYSGNCH
FT                   SASDSPALWQFHPNTKSPIANGTWDRLPVITSDPKTAPNYLAAGFTYSASRHEDESSMY
FT                   AFGGMCPFANSTDETWVSTANYSRSTVAIGPSPYYNTKFTAATTGKRAPPVPEAGMAVV
FT                   PLQPTYAAGSTGKQQDFLFIGGHTRQAFLNMSQLAIFSLPQQSWSFVSAISNSTPETER
FT                   ELTVRDAVSIEPRSGHTAVLSEDGNKVFVFGGWVGDVTVPAEPQFAVLDLAEGFGGTTE
FT                   WIWAAPSAEGLGITKGAGIFGHGAAMLPGGVMMISGGYNIPKPSSKRASATAQPNQQVY
FT                   LYNVTSSSWVTSYSNPAASSSNASPHSSKLSPSQKAGLGVGLGIGCPAALAIVLCGWNY
FT                   HRKRRVKSKRDSQLRELALGAERAHFWDRNCPTQASSIRSSGKSEKRDSPLYPWSANRS
FT                   QTARPDWKDQGEGTAERTGLLMDPPSPVKNNRPPVVPPVSNRPFSYRNSEYRRSDTTGD
FT                   IHPIDEREEDEAFRENLMATIPAGTRPTIKMMEPEDPFSDTPYATPRSTIFGVGLGPFY
FT                   SRRKDIGSVDVESPKTERTATNLSDNSEFSFASSQPIGMVNHARGILVDRPMSWGSGRQ
FT                   SLEYLAETSAHSDPDGVARSEKSVSADSYSTAQTNLSHRKSENESLLFDALDPITPSSP
FT                   SKLPRESKPKASDWVMNTMRRALTMTRRSPDSQFNSGSSTSSTAHRASGIDRRSTLGSG
FT                   QQSTSSGPSTPRRAVSASAELFRRKQGAKDWNARKRVSDDVFNMARSTRDDLFIGAPGY
FT                   LGDEAGFGDDEEDVHDWDLEGAAETRRVQTTFTVPREKLRVVNAAAGDIDSTSERSVSW
FT                   DTGNRRVST"
FT   mat_peptide     complement(480458..483214)
FT                   /db_xref="UniProtKB/TrEMBL:B6H630 "
FT   sig_peptide     complement(483215..483274)
FT                   /db_xref="UniProtKB/TrEMBL:B6H630 "
FT   CDS_pept        join(complement(484294..484419),complement(484110..484238))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201826" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976504"
FT                   /orf_name="Pc14g02030"
FT                   /product="Pc14g02030 protein"
FT                   /protein_id="CAP74344.1"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="UniParc:UPI0001831D99"
FT                   /db_xref="UniProtKB/TrEMBL:B6H631"
FT                   /transl_table=1
FT                   /translation="MVDNPNPGNFHNRPHEEVENIARKGGQSSHHSGFASMDREKQRNI
FT                   ASKGGHASRGKFEPGSPRAKEAGRRGGKAIHHQQEEPEE"
FT   CDS_pept        join(484607..484752,484844..484884,484984..485204)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943378"
FT                   /orf_name="Pc14g02040"
FT                   /product="Putative uncharacterized protein Pc14g02040 "
FT                   /protein_id="CAP74345.1"
FT                   /db_xref="UniParc:UPI0001831D9A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H632"
FT                   /transl_table=1
FT                   /translation="MASRRSVWGSFEEYSNATRCPFHRCDRVTLTSIQPIFASTESFPM
FT                   ASQLFQQHAFSMVLEDRTSPKAAWQWQGEPERRADEAGLVPHIGVYVAFPSRRRNCGLH
FT                   ILNQIRGSPPQSKPVNQSQHIEYICDSTMDQ"
FT   CDS_pept        join(complement(485692..486021),complement(485282..485626))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166324" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943379"
FT                   /orf_name="Pc14g02050"
FT                   /product="Pc14g02050 protein"
FT                   /protein_id="CAP74346.1"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniParc:UPI0001831D9B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H633"
FT                   /transl_table=1
FT                   /translation="MIFALPSSRAPSFSQLVSHLAQRRGVATSPIAMTPRIIDTIKKDH
FT                   REIESYYGKIITSKDPDEQTRFQNMFTWELARHSIGEELVLYPLFEKTLSDGVQMANKD
FT                   RDQHMQVKKQLKAFQSMTPSDTQFVPTIRELMEHLAEHIKEEESDDLPRLEAALTQEDS
FT                   EDCSKTFGRTKMFVPSRSHPSAPDKPPYETAVGLLTAPIDHLADLFRKWPDTTGMPNPT
FT                   TK"
FT   CDS_pept        488099..489313
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076498" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127600"
FT                   /orf_name="Pc14g02060"
FT                   /product="Putative uncharacterized protein Pc14g02060 "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="CAP74347.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="UniParc:UPI0001831D9C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H634"
FT                   /transl_table=1
FT                   /translation="MSSTNFRLELFRPWNPFQDKAQPLRDPSGTCRYPSPVSITATPPS
FT                   SNSSDHGPKKQNILCPKPERHPLPARPPTEVCLDGQNSEVQTTRPGSEGLGQTLSAVSG
FT                   QEPFNFENILQPQNIDGGDDVASPSFADDIYWEREREFLELGLDGSDPVDFARQHPQSV
FT                   DLGIPTQNGELLNFENVDPAILDDHESPVAEQAETTMDIASIVTPPEECPAVSIRPQNK
FT                   VSTLHRRRNSKGMVDSDRQPTKIKKGSGTGKGDTRIGSTRPKKSSGRQSTSFTTVRAQF
FT                   SALSVEDRLQFLSWLFEGALTHCASAVASPSIQCDGRSDNRVHTSLNTDATDAQHASSR
FT                   KGLKWSAEEDHLLRKLRDEQTLAWSEVVKQFSREFPGRSEGSIKVYYSTTLKKRRPSSP
FT                   IVLIA"
FT   CDS_pept        489988..490998
FT                   /pseudo
FT                   /gene_family="HOG000234603" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(493285..493788,493819..494653,494702..494872,
FT                   494922..494959)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076626" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943380"
FT                   /orf_name="Pc14g02080"
FT                   /product="Pc14g02080 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP74349.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831D9D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H635"
FT                   /transl_table=1
FT                   /translation="MSLRPCQPCRHSRIRCSREVPHCQTCVKRGRYSLCVYETKVSDQK
FT                   PALPEPRSKQQKQKQERASDEYHFRRRAFEPQSEQFSRYETSTNEEMQHAMEPANEEHI
FT                   KHMSQRYSEQGSLSPHETPPKGIAAAKAEKASIFQPKHVEDTSERPRSTPVPQPTELYA
FT                   QMIPPTTTLTVNKASLPPRPNFDLTISGRHICGPHTAHQLLLVLNYLFISSMLPADIGA
FT                   LWKVICRRHHDWEESFVLQHEQLQRWLISVRNILTNSDGLHTVTLEDIERQTRYILFIL
FT                   GENTSPHSSFIFECFRSEEPPYRPFGVRASIALICHAFGGIQADELEGYEAKEIWTRDQ
FT                   NFLSTMAFRLKESPLFGAEVSVNHLQSMILGLQKAFQCEEIRVSGMEFQTLRIESELEV
FT                   LGYYRRAFLAFNPILLPKILASLREANDLTTLLWHYQLINMERNLDRTNLALRLANIFM
FT                   SLAPERLDAAFQNTREIQLSKADRVVAMEMMHVKSFEEAYKLNPTKPTTVRVFHVSP"
FT   CDS_pept        join(complement(496983..497073),complement(496654..496926),
FT                   complement(496052..496598),complement(495919..495973))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15943381"
FT                   /orf_name="Pc14g02090"
FT                   /product="Pc14g02090 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP74350.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001831D9E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H636"
FT                   /transl_table=1
FT                   /translation="MQEDMEMKSGSAVRSVPAGSGNDAYESATFRQKQQLERYLNFFSS
FT                   VAFSTCLLATWESAGGSMLAGLYNGGPAAIVYGIILSTVGNLAIACSLAELASLYVQKX
FT                   SLCDCADLKTDRHPTAGAQYQWSYILAPRGRRFISFCQALVCIAPFLIGTQIQGMIVLA
FT                   HPDYELVRWRGTLLMWAVAIVPIIINIFARRVLGGIEVAAGIMHVVFLPVTIAVFVILA
FT                   PRNPDPFVWDTFVGGLSGWKDSGVVFSIGLLGVITPLAGVDGVIHMAEEVKNASVVVPR
FT                   SMIYGTLINGTLAFSYLTAILYCMGDYTEAVTSPTGYPIITIAYQATGSKAATFVLMAM
FT                   GMLPGWIALFNGLASVTRLTWAFARDNGLPYSDFFAVVDPTYKIPLRALFLVASCIFAL
FT                   SFIQIGSTAAFNAILSLSTLGLYISYLIPLVLLVLKRFTAPQDIPRGTFSLGKLGLPMN
FT                   LLAILFATYFVIFLPFPATVPVTAENMNYAGPVLGVVILFACVDWIVRGRHKWEGPKMR
FT                   SYARNE"
FT   CDS_pept        join(497670..497726,497789..497872,498212..499114)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976505"
FT                   /orf_name="Pc14g02100"
FT                   /product="Putative uncharacterized protein Pc14g02100 "
FT                   /protein_id="CAP74351.1"
FT                   /db_xref="InterPro:IPR001370"
FT                   /db_xref="UniParc:UPI0001831D9F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H637"
FT                   /transl_table=1
FT                   /translation="MTPRDMDRYGDGSGGAGGGKPAFNVCDEVFLVRAGIGLEGPYFVG
FT                   EVHQDARAGWKPKPLSALRRPSSLLKSSNPANPTAPPGRTNPHSNPLHQIPITYSTITA
FT                   RALSFHRQVLFNATPLQLAQNGLYCKPPSSIGGSACCFACGSTKPLYTLQKNPIEEMQQ
FT                   LHLTDCIWQIICRDLKPTFEKPNIVAHSATASPSPQQPLPETTPASLLPDEPSTMIIHT
FT                   ATEQSTTIPGPWLQQSQSTCASEISQPPPPQPPQPPQSLHSPFPAPPTHQTNNLPMPQF
FT                   CNAPDLFYRNRLPKPTNLYLPLNAHSQSKTFTTVSTTNHRHSSTTRKPARAQLDELATK
FT                   THLLHSL"
FT   CDS_pept        join(499713..499741,499791..500370,500445..500837)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976506"
FT                   /orf_name="Pc14g02110"
FT                   /product="Pc14g02110 protein"
FT                   /protein_id="CAP74352.1"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="UniParc:UPI0001831DA0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H638"
FT                   /transl_table=1
FT                   /translation="MSATPMHLSKSLFEDVPIQLKVGNQGKILYVHPRAFMPFNSSAIF
FT                   ARVYGSWKNRGQEALDLTDFDERTIVCFLSYVYTGDYHPFPPAPEPGLELAEQIKTVDL
FT                   KSTVQNDRVLDGEGLFSLLFNSTNITKISRILNPLDTTSDDPAAGGLYTRPLTPIEDLM
FT                   LPEKPAMFQSATKKPGLVEDHNELLALEILTHSKVYCFAHQINMSSHLIEAIRLIYSKT
FT                   PDSHPNHARNLLSQFVALKFTALLGDRLGILMSEGGCFAVDVSHKLGRRLLVNPLEDQI
FT                   EQLHLKVSALESECSEMEKDLNRSKEEVREWEQWDKNLPSKRQRWPGRYYDL"
FT   CDS_pept        complement(501607..502971)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976507"
FT                   /orf_name="Pc14g02120"
FT                   /product="Pc14g02120 protein"
FT                   /protein_id="CAP74353.1"
FT                   /db_xref="UniParc:UPI0001831DA1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H639"
FT                   /transl_table=1
FT                   /translation="MTQSYFAEDAAHSRMIDPWEYAPTPGNFGSTPATLYSPSPAPYRA
FT                   TEQPLSDQLDFLPSAEWEEGGEYDEEPPKYVCYTIEWKVILNRKAVGRVTEENLVVAPS
FT                   EYWDETLKAAVGGMLQMKKKRHQRVRSEGTDITIKSNDRSQRKIEKFYDSTNIDWKPVE
FT                   KQLRKWSNLLRIGKKLTIVIAFNYRSEDDDQSTSASRRVDKRPRVSATSRMAAEREAHI
FT                   ATEEERTGRTATWSLVYDRMRCNVRSCPLRSDWCWEDPTDKKHYKLRTPHLERLIEHVD
FT                   DGGNLDCHDDVPSDIRRDLVLESQIGRKSKKTDTTSTGPPYPPTIINVLPAQAATASTL
FT                   TSFLPKHTPNEPLVIPGSREAAVRDYCGWLESRATDEEYKADFRKVCQVTLENHLDLEL
FT                   ILEEPDAGFFVQQGVRIGTARRFLRDINEWATVIKSSMILEQDAREILDHCEQFS"
FT   CDS_pept        join(503618..503909,503973..504077,504136..504248)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170953" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127601"
FT                   /orf_name="Pc14g02130"
FT                   /product="Pc14g02130 protein"
FT                   /protein_id="CAP74354.1"
FT                   /db_xref="UniParc:UPI0001831DA2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H640"
FT                   /transl_table=1
FT                   /translation="MKTLTYLFILAASAIITPVAGTSSPEHFRLKSISATNQEHNNPYV
FT                   YAYHTGAGLNDAVLTKDVNTASSVYLNGTNAFFDFHTELLWGVVATGDNKYTSWQPILI
FT                   NAGRGSNGFSVKDDSFIWSEASGFGGWLVCNWYHNAPQLFYLNRNYNATIPSSCSKIQL
FT                   KAEYIN"
FT   sig_peptide     503618..503680
FT                   /db_xref="UniProtKB/TrEMBL:B6H640 "
FT   mat_peptide     join(503681..503909,503973..504077,504136..504245)
FT                   /db_xref="UniProtKB/TrEMBL:B6H640 "
FT   CDS_pept        505102..505560
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076499" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944392"
FT                   /orf_name="Pc14g02140"
FT                   /product="Putative uncharacterized protein Pc14g02140 "
FT                   /protein_id="CAP74355.1"
FT                   /db_xref="UniParc:UPI0001831DA3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H641"
FT                   /transl_table=1
FT                   /translation="MKFLAFLFMLATFAIAAPIASLSSKHFRLSRQQAEHLKIKEYMIA
FT                   THDMVLYTVIHDTGFEVAQVLLLHDHINVNIKSRWLEDILIVVPKGRHFPDADGFVVDG
FT                   RRNVGNLKRPLYPARSHCLRRAIESTMEHHNYHQYSLAPSPKGRLGGL"
FT   sig_peptide     505102..505149
FT                   /db_xref="UniProtKB/TrEMBL:B6H641 "
FT   mat_peptide     505150..505557
FT                   /db_xref="UniProtKB/TrEMBL:B6H641 "
FT   CDS_pept        join(complement(507602..508153),complement(507459..507558),
FT                   complement(507197..507411),complement(506977..507033))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217227" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976750"
FT                   /orf_name="Pc14g02150"
FT                   /product="Pc14g02150 protein"
FT                   /protein_id="CAP74356.1"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001831DA4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H642"
FT                   /transl_table=1
FT                   /translation="MSSNLPKDNMICDLGTIKVQSQLPISMSAPTTRESHTAATTRLTE
FT                   PHRRGRSKVVTGPPKSLCLPHLCGLENIASVLIVRQESPWDTYRKVITYENAGKVTIAT
FT                   RRTRPSRMVAIRTYGKENARRLIYRFGRLENRNVLSLHECYMHEDLAFFLVDDLPLTLT
FT                   HVVAFPSVYPSETELGSIICQILDGACYLSSFGLAHQSLACGDILFGIDGIIKIASLDL
FT                   YIDCTPKQSEIAYIAALPSIMMRLMQKNGKDQGVVGVNDLERWPIDSAAVEFLSATETA
FT                   ESIKSLRNGQRSGAPLSDICGFSSWS"
FT   CDS_pept        join(complement(510208..510289),complement(509538..510145))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076627" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944393"
FT                   /orf_name="Pc14g02160"
FT                   /product="Putative uncharacterized protein Pc14g02160 "
FT                   /protein_id="CAP74357.1"
FT                   /db_xref="UniParc:UPI0001831DA5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H643"
FT                   /transl_table=1
FT                   /translation="MDHNLSQVPKKSNTPDTEGHNGRTCQTGNELAENFRRVNGLFIHG
FT                   NRSHTSQVLQPPVGQSTGPVATEAVTSVGTSLGSSRAPTWSPSVIRAENQDLPPLNVKK
FT                   RAAESSIVPRKRRRDSYSTSQIPGHPQLAYQKRPPCLIKISRKMVNDTIQYLQMLSDRI
FT                   LICDTISPREWATMHLATQLLQSRYEEIIVRKEMETDAVPDFDSPPTQPEEKCRKCDAA
FT                   DEERLYD"
FT   CDS_pept        join(complement(511409..511527),complement(510619..510805))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823570"
FT                   /orf_name="Pc14g02170"
FT                   /product="Putative uncharacterized protein Pc14g02170 "
FT                   /protein_id="CAP74358.1"
FT                   /db_xref="UniParc:UPI0001831DA6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H644"
FT                   /transl_table=1
FT                   /translation="MTQLILSCATCVLTTWCLSGSQNRLWLDKKCSKLKHYSYASAQYQ
FT                   RIMTKKLKSPELLEAQNRPSPVGSLSWQRGAAEPSPSNNPQVVRNGTPFHTPYEQQ"
FT   mat_peptide     join(complement(511409..511470),complement(510622..510805))
FT                   /db_xref="UniProtKB/TrEMBL:B6H644 "
FT   sig_peptide     complement(511471..511527)
FT                   /db_xref="UniProtKB/TrEMBL:B6H644 "
FT   CDS_pept        join(511870..511985,512093..512301,512492..512549,
FT                   512733..512790,512838..512996,513065..513162,
FT                   513262..513423,513529..513562)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944394"
FT                   /orf_name="Pc14g02180"
FT                   /product="Putative uncharacterized protein Pc14g02180 "
FT                   /protein_id="CAP74359.1"
FT                   /db_xref="UniParc:UPI0001831DA7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H645"
FT                   /transl_table=1
FT                   /translation="MDDVVDGTVIAALVSALFSIFGLILVVYPKWLQEKCAARDHIPYY
FT                   KLIYYGSIGQAASGIFTGHFVVCALCRTRLTWSLAKYAHRAYNTVKVRVPTAYRSRAMK
FT                   NGSAAGRYWPTLEQYYEWLDVKDSPGNACLRPGSSLAPGNFSAEARRNFWGLLPPLRGA
FT                   KAMFLLAASPTPGTSSVVPGAMAYPSGSGRMSQFCAEKYGPRSATAPRTNQYVPRASVY
FT                   SVRNVEQRSQGVNILIPRVNLTSTGVCQGRSPARDVLSSANSLRLDATRTTEIIHVYSS
FT                   LATTVSTCKDEKVARF"
FT   CDS_pept        join(complement(514122..514894),complement(513755..514070))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976751"
FT                   /orf_name="Pc14g02190"
FT                   /product="Putative uncharacterized protein Pc14g02190 "
FT                   /protein_id="CAP74360.1"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001831DA8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H646"
FT                   /transl_table=1
FT                   /translation="MPWNPFAVCGIPHGGPVSCCGVTKKGQPCKNSVKFQDTKIGHERL
FT                   TTLAREPFDLSTLQSKLCDIARVFLCARWHRQQQADQVGQRWYEAAIRNQARVPHGSRV
FT                   AAPSIAHPGQRQMSSVSRSRPAPGNTDRSPHGLRQDPPVPLSTNSEPVQPFNPFVTSTM
FT                   LRTNSVPWHVSLAQPAILTSVANVWAGVQSLTLKDLTLSDEFDDIHCVFCLAEDDDLAN
FT                   ESVILRCQCKALSHLACAEEWLEKRSAGFGTSCCVCRNEGPLDALVRPLRVQSSDAETR
FT                   HIHTATESSPERELATIRNSSQNDPSRSQLRQRSVGPQGRSVERSVENGPRRSARLGAH
FT                   LPRGPSTSAPPRRSARLNSTRR"
FT   CDS_pept        join(515023..515207,515347..515473)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944395"
FT                   /orf_name="Pc14g02200"
FT                   /product="Putative uncharacterized protein Pc14g02200 "
FT                   /protein_id="CAP74361.1"
FT                   /db_xref="UniParc:UPI0001831DA9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H647"
FT                   /transl_table=1
FT                   /translation="MAAGRATSSLKQLVRRRMHVDAVCAGIGRPVACEKGYHFTSLLPK
FT                   SAALVAVGCGDHALANRLYSDARVIDNYQEQLWCSQELESKDSRLNIVVKNLMLPHDC"
FT   CDS_pept        join(515627..515629,515682..516105,516319..517286)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944396"
FT                   /orf_name="Pc14g02210"
FT                   /product="Pc14g02210 protein"
FT                   /protein_id="CAP74362.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001831E7B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H648"
FT                   /transl_table=1
FT                   /translation="MPNIRDLPNELLLCIMSHLDGSALFALAKSCKDLDFRLQPSIWKY
FT                   NIRFQNSNLLHLAVKYDNVGLADALLQHDANINAFYRGKTPLMRALKYSSAAVRELLLS
FT                   HRDLDINIQNQARDSALSYAIHYGSSSIVKSVLEHRAASARNAQDSELPLHEAVLHGSI
FT                   DAVKWRLRQKDLNLDIQDRKGYTPLHLAVQSRRLEVVDLILGHPLANVNCKDKDGNTPL
FT                   WLSTYSSCDEIAERLLAEKDIDVNFVGGRGRLEAPSTSLHHAATRLDIILLRRLLAVPG
FT                   IALNLCVAGHSPISVAAYHGHVKTVACLLSMEGVEINGRGLRDPPICRAVSHGHLDVVM
FT                   LLVQQGARLNVNESTVATHDTALCIAARGGDLDMVRELLRHGRIDVNLRNQWFEDPLML
FT                   AVRGGHFSIVDALVANPRLTHFSLRRSLDLAKDYCIQKAIRSRICDDNTTKKLLKRSPR
FT                   RIFDRL"
FT   CDS_pept        join(517738..517875,517928..518273,518365..518397,
FT                   518689..519194)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944397"
FT                   /orf_name="Pc14g02220"
FT                   /product="Putative uncharacterized protein Pc14g02220 "
FT                   /protein_id="CAP74363.1"
FT                   /db_xref="UniParc:UPI0001831E7C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H649"
FT                   /transl_table=1
FT                   /translation="MDHPTSPSPIDRSAKRQCRVSHAPEDELKLENQPQQVTNGTTIEP
FT                   KIPVRTRGTLTAEFMKVLNLNDSLATPVLKLLDLYFCLWHCYVVKSAQKIRLEEEQRQL
FT                   QASNDLLASDSDILLQLCNVQASILWERKRAVQALCNGVVSALEASDLQACSAEEPEDK
FT                   AYTAGELSLDYDLDIDLHAIWHESSGIPTPPPCLATDPNDVWQDLLGKVEPAGYETQGP
FT                   SLIERLFYPNPDSLSGFKWTGPDPLSNSTQASDIFLHMSALLFPKEVHWIEFRFVRFDR
FT                   VSGETIGEDLFFLSRVETALGNLCRFRRQLLDTIIWHAVPLASYGISAVFESLDTFSVD
FT                   "
FT   CDS_pept        join(complement(519926..520045),complement(519476..519879),
FT                   complement(519330..519426))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976752"
FT                   /orf_name="Pc14g02230"
FT                   /product="Putative uncharacterized protein Pc14g02230 "
FT                   /protein_id="CAP74364.1"
FT                   /db_xref="UniParc:UPI0001831E7D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H650"
FT                   /transl_table=1
FT                   /translation="MDSPNSSPDQEKQGEQQPNELPILNDKDHNLEFSDHVPPLPSPSQ
FT                   HEEVTRHTLATEPFQPILKVLADLERDDPKFAFPAARLVGFYRRLWESCVSKHIDVQKI
FT                   DQSNEILKEAGTYLRKEKDGLQLHHEKQLARLRFFGQALESSRERLISLLDDWNYPYSP
FT                   NLAGLSDVAREANTTSGDAVQGKLHRMQSRLYIPEAFNKKGTK"
FT   CDS_pept        join(520869..520959,521125..521163,521384..521479,
FT                   521526..521688,521854..522190,522277..522303)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076631" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670794"
FT                   /orf_name="Pc14g02240"
FT                   /product="Putative uncharacterized protein Pc14g02240 "
FT                   /protein_id="CAP74365.1"
FT                   /db_xref="UniParc:UPI0001831E7E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H651"
FT                   /transl_table=1
FT                   /translation="MSLQIVAVKEDVGFNRPQLRNVSFNASNQVVYIVDQQTRQFLYYA
FT                   GQPDPFEHNAPEQGPQLLVVSSSLVLTIRKLNLWELTRVALITLHYRQCSTQSHGLHTV
FT                   PSPVASNNAACPRWKIANQDSESTTGGTPSSTVKYTVASGLFRQIEDKTKVAADERAPS
FT                   RLPPSSPPPSHYCGVLNLWHRDTFIHHRSAMSIASGFLTRVYCLNKLSCAPQRGFFEAS
FT                   ADCDELECDVAWLVTALQRVVRYDNSSN"
FT   CDS_pept        <524603..525220
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944398"
FT                   /orf_name="Pc14g02250"
FT                   /product="Pc14g02250 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP74366.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001831E7F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H652"
FT                   /transl_table=1
FT                   /translation="MARSSPETDTYSVSNLLAKYQSAGKSTAVLSIRQVHSPSTEPSKF
FT                   IPAIIFATPDKIRPEAINIISQLQKRHVDVFMCTGDNQTTAHAVADMLDIPRSKVMANV
FT                   LPAEKASFVRQIQNHSSNTTPADGETTPSSNPPRPIVAFVGDGVDDSPALAAADVSIAM
FT                   ASGSDVATNSASFILLKSGLSTILQLVLLSRRVFNRARMNFG"
FT   CDS_pept        join(525599..525883,525952..526165,526221..526732,
FT                   526793..527020,527068..527854)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944399"
FT                   /orf_name="Pc14g02260"
FT                   /product="Pc14g02260 protein"
FT                   /protein_id="CAP74367.1"
FT                   /db_xref="UniParc:UPI0001831E80"
FT                   /db_xref="UniProtKB/TrEMBL:B6H653"
FT                   /transl_table=1
FT                   /translation="MXAYLQYGAIRVSVRTQLDQTPEQYILPYHXKRGXMYQWGRIFGI
FT                   HSSANYLKHLXSGNLIDRQPRYSHGQLAHIFDXNGEKDFLRPXNFTLGTRIRATQVVSA
FT                   LAFVVSASPSIQSAVLSKSSVSYRVSEVVASLFTAIFSXDLLLDRWYX"
FT   CDS_pept        complement(528224..528621)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(<528905..>529472)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000218208" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127856"
FT                   /orf_name="Pc14g02280"
FT                   /product="Pc14g02280 protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="CAP74369.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI0001831E81"
FT                   /db_xref="UniProtKB/TrEMBL:B6H654"
FT                   /transl_table=1
FT                   /translation="IVVGARFLSPNTTPSLLLPKHHLTLYSSANTISIPSNRTALAIPM
FT                   TQKQALRAXAQSQNPRLSQSXCSSWFERAYRRSISQSSILSILSKQFDYLDSGPASNLS
FT                   RQPQWPLLETPLCEXLASQEPGPTPSADVIITKAREIAMGPRVQVDAHSNALRRSARLK
FT                   KASLRSRX"
FT   CDS_pept        <530207..>530544
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(530787..530919,530982..531307)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076632" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944400"
FT                   /orf_name="Pc14g02300"
FT                   /product="Pc14g02300 protein"
FT                   /protein_id="CAP74371.1"
FT                   /db_xref="UniParc:UPI0001831E82"
FT                   /db_xref="UniProtKB/TrEMBL:B6H655"
FT                   /transl_table=1
FT                   /translation="MSVVTLSRVDNHCGAPHLAMSNQSRNGGPHHSKLANKLDPRVDSG
FT                   SQNAPDAHLGYAHNYGKGGKGGLHNNGIANTLDPRVSSDQDSSHRENVAASNPFMPQAG
FT                   KPAGIHNPGADKPEQRIESHPDNNRRGNIAGSTHFIPQAGKPTGNSSL"
FT   CDS_pept        join(complement(534234..534436),complement(533848..534078),
FT                   complement(533537..533670),complement(533337..533425),
FT                   complement(533193..533198),complement(532942..533089),
FT                   complement(532655..532704))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944401"
FT                   /orf_name="Pc14g02310"
FT                   /product="Putative uncharacterized protein Pc14g02310 "
FT                   /protein_id="CAP74372.1"
FT                   /db_xref="UniParc:UPI0001831E83"
FT                   /db_xref="UniProtKB/TrEMBL:B6H656"
FT                   /transl_table=1
FT                   /translation="MCAVGRDRRKISHLGARRHVQIRSYYPRPAARGTVYLVIEPSYDV
FT                   YVTLHIFVKLPLHSTQSACIWWKSNTSNFTGQFLSGASANRRSRADVVAKELLPERAID
FT                   LQGIGICSSCQPYAQQPYHSELYSSILFNLSIQAIPALQGRLERSLNWTGDGSEGGMNV
FT                   ASVCVKAAAGYQIYLRAYYYGVYRAYRLEEGNFAERGAYIRAISGSCGEDASGRYKEVT
FT                   LRNPRAPSHRKQPHLGGIERDLNAGLNEVLLSVDFRTLLTERRPEMLKGTHLIDGLPEI
FT                   WGPDA"
FT   CDS_pept        join(535187..535198,535356..535742)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944402"
FT                   /orf_name="Pc14g02320"
FT                   /product="Pc14g02320 protein"
FT                   /protein_id="CAP74373.1"
FT                   /db_xref="UniParc:UPI0001831E84"
FT                   /db_xref="UniProtKB/TrEMBL:B6H657"
FT                   /transl_table=1
FT                   /translation="MNTLGCSLGYDSTIKFSREPPLTIQHGASLTVSVVVMFGESNRLS
FT                   SASTQAFAVNVFLVDEYGTRTSGGLQGSLTSNIQFPSNQHAHGLALFNDLAIYQTGRRR
FT                   LRVLRGSFSAAGMTIEARADSDIFHISK"
FT   CDS_pept        join(complement(538119..538174),complement(538027..538078),
FT                   complement(537352..537921))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076510" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944403"
FT                   /orf_name="Pc14g02330"
FT                   /product="Putative uncharacterized protein Pc14g02330 "
FT                   /protein_id="CAP74374.1"
FT                   /db_xref="UniParc:UPI0001831E85"
FT                   /db_xref="UniProtKB/TrEMBL:B6H658"
FT                   /transl_table=1
FT                   /translation="MAKEHKPYCHNETRDWQGMSKAERNPLKAVGNHKGLGHSTAKSTR
FT                   KKDHEATHRKCLDVMDQIQKEVQLALEEIDEERAHDSQSMQRLHAEKAQDTSKLQEAIT
FT                   ARDKALGENQRLERELCQLQQAQESSHATMQGLVSWHDIQPVLHQTHGELVSATTRFWN
FT                   TIDALQNRRLASYLPSSGGINGSWPEQDGPLGTLGHNALPQFSAPGDYALVNQEAPVSS
FT                   NQY"
FT   CDS_pept        540387..541490
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076511" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944404"
FT                   /orf_name="Pc14g02340"
FT                   /product="Pc14g02340 protein"
FT                   /protein_id="CAP74375.1"
FT                   /db_xref="UniParc:UPI0001831E86"
FT                   /db_xref="UniProtKB/TrEMBL:B6H659"
FT                   /transl_table=1
FT                   /translation="MDTLMTSLPPNVGAILMENISIIQIVSMFSIGAYNALETGIVTFD
FT                   TFKRYRGLYFWSMQFASWGILLHAVPAMARFVSQASNLSTSIPFMIGWYAMVTGQAVVL
FT                   YSRLHLVISDMRKLRWVLWMIITNACILHIPMTVFFFGLNRGDARFARPAAIFDRIQST
FT                   GFCVQDFIICGIYIYEAVRAFKVIITIRGRDGRNAIIHLFCINILVVILNVLLLLAEYK
FT                   LHYIQVSFKTVVYSIKLKLEFSVLNRLRLLTSTNPCICQRGPEDSHRSNDKHIFGMASS
FT                   RPVIAPDVSSQSGATQTDMPRSLRPSIYGYDEALRETSSENMMPPGDGSYLATLSEDHL
FT                   NNLPGGSSETLPALELSLSQFSPKFDV"
FT   CDS_pept        complement(542333..542674)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076633" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944405"
FT                   /orf_name="Pc14g02350"
FT                   /product="Pc14g02350 protein"
FT                   /protein_id="CAP74376.1"
FT                   /db_xref="UniParc:UPI0001831E87"
FT                   /db_xref="UniProtKB/TrEMBL:B6H660"
FT                   /transl_table=1
FT                   /translation="MDVQPKLRTNPADAVNQKARRRRKSLFRKASQYSSECDADIHLVL
FT                   RMKKSGKIFVLASNTKDWPLSQHQLVSSLGHRFCCEKGINLITRGLITLHPFKCLQATQ
FT                   GPSRESPPY"
FT   CDS_pept        543297..544136
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178107" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944406"
FT                   /orf_name="Pc14g02360"
FT                   /product="Pc14g02360 protein"
FT                   /protein_id="CAP74377.1"
FT                   /db_xref="UniParc:UPI0001831E88"
FT                   /db_xref="UniProtKB/TrEMBL:B6H661"
FT                   /transl_table=1
FT                   /translation="MAYAKKIHKVAEDVRVLGRFGGKRASTLVSNAVRIMTSEQTERLF
FT                   QVYQNFLCDIRTASGPLGRNMVVLCSATIGKTKAITLNETDRIKLVQYIATTSIRLDSE
FT                   HLSSLAAQYNIPSNNEPQKQLTHSLGGLDPQTGPSSQELNENNVLNVQAHPVHGTMKVK
FT                   REEGPVGNGPRGFSNASVAVVLAYSKYGAGEFGYAPIHQGKCSVAKNSATGIHLVINIL
FT                   STIMLGASNYCMQCLAAPSRSEVDEAHQKRAWLAIGTPDIAHLVFACAGRRRWLGIVLL
FT                   ATSFPIHLMISTSPAFYSLTSSSYNAAAYYLMQPQKYGVSVFHDIRALESLESTHLKLG
FT                   YGACFDKYTGMNASELQHVIRYERYERLNKKDCIDSCDASTLRDNMDDLAVEAYHWFPV
FT                   QLLDDLDGFHLRKRADTESEGNVECTAAAATMEMQLPTFTVDHCLNIPAEESCQLVFLP
FT                   AVCLVVFCNIIKLVCMVPTARDDREEVFLNIGDAIASFLTRPDPATESAGLLSKDAVKK
FT                   GTQGWHKTSLIYSPIPPTEFPLPHPNIYHRASAGHKPSANPAGSGQSPCKSPFHHTRSP
FT                   IFNRLTYLTSFVLILIPVSYLLSLGIENVTTRYTSSTWTQGLGQPRSGTIITGITSHAH
FT                   NVLALTLLSNTPQLLLSCAYFPYNACLTCMLAAVEYDSYSMNRKYLRVSXPRGRQRSTY
FT                   YLTLPYRYSLPLLVASALHWLVSQSFFYVEIIGVSMDGWKDEFVTCGFSPVAIIFAIIL
FT                   GVSLLFVAAVLGARRFSSHMPIIGYCSAAIGAACHPETEGNHAMKPIQWGEVLSESGTS
FT                   GSAEDDDDYGIADRADRGGDRNWNPRDCLLEEIEMGSLESRVYHCSFTSGEVAGPSSAR
FT                   LYI"
FT   sig_peptide     543297..543356
FT                   /db_xref="UniProtKB/TrEMBL:B6H661 "
FT   mat_peptide     543357..545918
FT   mat_peptide     543357..544133
FT   CDS_pept        join(complement(545660..545801),complement(545282..545547),
FT                   complement(545132..545231),complement(544899..545080),
FT                   complement(544748..544855))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076512" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823571"
FT                   /orf_name="Pc14g02370"
FT                   /product="Pc14g02370 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP74378.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831E89"
FT                   /db_xref="UniProtKB/TrEMBL:B6H662"
FT                   /transl_table=1
FT                   /translation="MNRAKTKHSRPSTVWLDESAFCNEQLSPNSTASPHIPPPTIQKTA
FT                   NRDRSLIFARNKSEKGKLVHIQQLEKQFSPATGFLELMEQVGHPSFLKLLECYHHDASC
FT                   TLIWEPTEVSVSHILAXSCSITTDELVGIVKPVLEGIQYLRGLGRALATLGPETILLTQ
FT                   SGDVKIMGVENSCEIKESEMNPATXKLCALADVVTKLMLKNRTYEWEAEIQNLPCQLES
FT                   ISVEEILQNEMFTRDSCEGELKLLVSVANKTAYHGIKSYYARC"
FT   CDS_pept        join(complement(548057..548442),complement(547697..547928))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944407"
FT                   /orf_name="Pc14g02380"
FT                   /product="Pc14g02380 protein"
FT                   /protein_id="CAP74379.1"
FT                   /db_xref="UniParc:UPI0001831E8A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H663"
FT                   /transl_table=1
FT                   /translation="MPAKMGSEKTPLREIDPVLVPPRSAADVTPGLCRANQIHYADETN
FT                   YARMLREEAEMDMRFSITVGAANWALLAGYLVIPGTFTSLQTSNQVEKTLQTNEAGRTV
FT                   LHMIQNPPLLAIACLLFVSGIAALIPLCLHAAAGLLTTVINVCTSQGGDWSVMAIXTTA
FT                   VTGATLLSCSALLALYKFYKLERVRKEDEDIRRSRASTTLDT"
FT   CDS_pept        join(548919..549909,549971..550495,550561..550638,
FT                   550721..550967,551113..>551707)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976753"
FT                   /orf_name="Pc14g02390"
FT                   /product="Pc14g02390 protein"
FT                   /function="zinc ion binding"
FT                   /biological_process="metabolic process"
FT                   /protein_id="CAP74380.1"
FT                   /db_xref="GO:0008152"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI0001831E8B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H664"
FT                   /transl_table=1
FT                   /translation="MAAWLDLVKENEAWDLVDTNRLEQLVQELPNPKYQYPSXLYFYGN
FT                   SNRNKALRALFPYNNITRKGPAGLIRLHLSTKTAHTQNPILFAESGLCLEXSLGDSKWL
FT                   KNXTTKHQTFSLGGADGTLTPARLQQXVKRQLVLPWTQILCLFLDSVPXIQAATXLLQR
FT                   PRRQLTIGDEVVPAPLQVVIVLTNSQHVTEAFAQECAQLQKLDTGTVTILDLRPRHGLS
FT                   DSVVFQPLQTLXVKQLSIVQAERISNCRRFSASHLSAFWSTGVQSHERLLHAPPFDLLE
FT                   RARRDYVRNKTMDDCLREVMQTCIGYSKEXFDDLVASAFLMDAYPPQMHGFSPTVVFAA
FT                   LYEKRCLSIWDNEFKYHIAGVSSRFVHHFVQLSAVKXSAAIRKETLCRLYRRWGGLRST
FT                   TTCLVCLSRPPEHMLPCKHAICDTCVVIFGKPSRLGEYHFEVAQCPICEERSDVTVRQL
FT                   PPTKPPVILTLDGGGVRGLIQLGLLRVLESRIGISDRIFAGPVHWNQCALTAIDVFLNQ
FT                   SSVTQXFDAFPHLAHGLYDSEGLSKILKAAVDPSRRMFDVATANPAGCRIAIVASRTSD
FT                   GKACVLANYRGTSPRSTNTAYEFLTPHNDRQNPSLLDAYFQPKELPGLCLQDGGVRANN
FT                   PLAIALRESSIIWPMAKRHDLLLSVGTGFSTFPPSRPTGILGRIWEGPLPRLFRAMMSS
FT                   PSMDGKQGFLEALNYLPHLSTPDIFRLDQAIDGTLPELDDVCSLEAMSNMDFAVPAELV
FT                   RTILASALFFFELDETPIQGKASFHCRGSVLFSRPNPAEILQRVLVEFPGARFKSGQDL
FT                   "
XX
SQ   Sequence 551708 BP; 139648 A; 135503 C; 137019 G; 139506 T; 32 other;
     gccctagaaa ggagtgttcg acttcgaagc tacgttgaat agcgaccaaa gtaggtaaga        60
     aagtaatcaa aagcgctgca atctaggtga tgcctcaata gtcgtcgcca cggctgatca       120
     cttccttgca tgattctcgc aacagaatag tctagaaagt tttagtatcg cgggatgtct       180
     catgaagaag gttttacaaa catgttcgaa ctgcgcagaa tacgatcctc taacgtccat       240
     caaaggctgg tagacctcga catacccgtt agatacaagg ttgttcatct gtcctttgta       300
     agcagatgat ttctatagta gaacgaggga cactcacacc agccaggtaa ctttcaacgc       360
     caagccgttc aagatagcgg cgacagaaga caagtgatcc gaaattttca ttgattttct       420
     gatagaggga tttggcgctg gcaaggtgcg atgtgatccg tttcggtgcg gatgggtctt       480
     taccataacc atagacccca ggctaaagaa ttccgtgaat atgtgacgac tgcagggaac       540
     gaggataaaa cataccccgt caaaaagata gccacggcca gttgtcccga atgtctcaat       600
     ggcaaatatc tctccctctt ccatcttggt gttgtcattg ttcttgacaa atggtataga       660
     tttcccagcg tgaatgcgat attgctcgat gttgtgtcca gtgatgttgc gcacagcctt       720
     gacaggaaac gtccgaccat tgatgtcaac ctcatagctt tccatggctt cttgtatggc       780
     agcgctgaca tcgctaatac ggacatcgac ccccgcattc taagagtggt cagcggtaag       840
     tctagcataa aaaacaagaa ttgcttacct tgatgccggt atttgtagcg tccttgacag       900
     cagcaagcag attatcatag gttgggtcga atgacattgt gaaagcactg tccacaatcc       960
     agccgtttat gtgaacgcca aaatcgactt tcatcacatc gcttgagtcg aggaccacct      1020
     ccctttggcc cgggttcggt gtatagtgtg caacacaatt gttgagtgac agtcccgtag      1080
     ggaagcccaa tccggatatg aggccttgcc cagtatctag gccggcatta tcgagcaacg      1140
     ctctaacgcc atcctcgatt cccatagcaa tctccgtgag ggtctggcca ggacgcacgc      1200
     tctcttgggt ccatcgtcgg acttggcggt gtacctctgc agccttccga tagtcattca      1260
     aaaaggtgtc atcttcgata tgatgacggg agtggtgtcg gacttcatcg gcggttgtgc      1320
     gggccacatt ttcgagtccc ggctcataga cttgagcctc gccatgtgga tactgatgat      1380
     cagggaatag atcggcaaga gggattcgtg gaggtgaaga ttgcttcaac gcagatgtct      1440
     tcttcttggg cctctttttt ctcttcttcg aatttgtcga gggggctgtt tgcggattca      1500
     acggcacggc aggagcgcag gatgtattgt cgccatcggc atcatcatct ccttctcctt      1560
     ctccaagtgt gccatcacca tcccgggacc aatgggcgcc ccgtggttcc ccaccagtgg      1620
     cagtcgcctt ggttgagctg ggaggagcat ctgctaaacg tcagtcgact tcgtcagacg      1680
     attgttgtgt gacttactac cacctccttg gctctcattc tcagctgtct tagagcccat      1740
     atcgacatga ataaaagtga cttaaggaca attgactgta aagattatct atgaagcaaa      1800
     gttcgggtcc gcgggtgtcc ccacagtgtg attattgctg gtttgactgg tttgactggt      1860
     ttgactggtt tggctggttt gactggtttg actggttcgc tagatttgct gtgtttgcca      1920
     ttgtcgctgg gcccctgaac ggaacgcggt atacaacata aggggctatt cttttctttt      1980
     ttgttttttt tttctccaaa acaaaaaaag acacccgcct agaagcctta ggaaggctgt      2040
     ggcgacttgg acgctactgt tcatgcctag gtggagatat acgattcctg gaggagtcat      2100
     caggtggacg ataacaacct tagaaagaat cgatacaccg ttggaatact aaaagactca      2160
     cagcgaaagg cagagaaaag cagatagtga aaagtacata gatacataat gtattcttca      2220
     tgtacgcaac attcaagtat ttgccctcat atgctacgta catttcgatg ttaaccttcc      2280
     ccgcattttc tgcgattcgc aattcgacat gcatgtcccg ccatcacatt aaccgatggg      2340
     ccgaaacttc caaggttcct ctcaatgttc attacactga attggtgagt ccctcatatg      2400
     agttcaaaca ataaaacatt gcgatcacgg ttcggtgagt aatcctgtcc atgtgtagaa      2460
     ttcagaactc cacgcttggc cacttcgcta acttgtgcag gctgtcgcac ctgtcgtgcc      2520
     cgaaaagtga gaagccatct tcccgctcta gaggtcctga tagtctaaaa cataacacaa      2580
     ttacacaggt caaatgcgac gaaacaccag acgaatgcgg caactgtgct cgattgcggc      2640
     tggtttgttc cggctacaca acacctgtga ggtctcaaac aacagggggt gaaatagatc      2700
     tgcgacattc tacgagagta aaaaggacat atcgctcctg cacggcatgt cgtgcttcga      2760
     aaaccaaatg ctccggtgag cgcccatgcc aacgatgccg ctggaaatgt tcaaccgaat      2820
     gtgtttacgc cgagtctact cagcccgctt gggtgcgcag agtcaacatg acccagacag      2880
     gcagcccaga cttctctcta tcccgaccct ctatgtctga acagtctttc gaggagaccc      2940
     cacccaggca agccaatccg cctagcctaa tggatacgcc atctacgcca caggctttcc      3000
     ctgggagttc gtcatctcca cttgactggt gagctgtgaa gatcttcgct aatttatccc      3060
     atctgttgga cttctgctca ctcgctatag gttgactacc gattaccttc ccagctcacc      3120
     aagaattgtg atgctggtcg aagagtactt caacaatatc caccctctcc gtgcctttgc      3180
     ttttatacac aagccgtctt tcctacaacg attggatgga gacgttttag agaaccatca      3240
     caaccatgct cttttacata ttatctgtgc attaggagcc cagtaagccc aattgacttc      3300
     tcgaaggcag agtcttatgc ttagtggttt taggttttat gctctgtcat acagcgagac      3360
     tacagctcca cttgagccca aattcgtcct tcttgcaggc actcaatggg ccaaaatctc      3420
     ccaacgactc atccttgaca ccatagatcg tgtgactatt gaaagtctaa tggtgcgccc      3480
     tgcaacccaa gcccctatat actgcaacta acgatatggg aaggcttccg ttctgcttca      3540
     tgattatgca gttcgattgg ggaacttcgc aaacgcgttt atgctgagtg gacttactac      3600
     acgaatgacc caggccctcc agatcaatct tgaatacaac accgacatcc tctgccagaa      3660
     tactaataac ggtcttcctg tcactgcaaa agagtctcgt cggcggttga tgtggagctg      3720
     ctatataatg gatgcgcttg ttggcagcgg agtagaccag ctgacgctga tggatgaaag      3780
     agatgtcaaa atccagcttc catgcaatga acgcaacttc actcagcaag tcccctgcct      3840
     taccgagact ttatatcctg gaagttggct caagatccta ccggatgatt tagatacaaa      3900
     gactctgtcc cccaacatgg gaataatggc gtatttcatt cgacatatct caatccgcaa      3960
     aagggttcta aggtattctc cccatgggat cttatattcc ttttcttgaa acttactgtt      4020
     gaacaagata tatcaagcat ttgggagacg ctatggttcc gtgggaccct gcatcggaat      4080
     ttgcgcttct agatgcagat tgccgggcat ggtacgactc tctaccagca agtctacaat      4140
     tcacacccga tgcaatgtac attcgcaaag aaacatatca attaggagcc ctatgtttgc      4200
     tccattgtgc gcactatcaa actgtctgcg acctatatcg actaggtgcc cctgcgcttt      4260
     acaaactccg agctgctttc gacttccctc ctgaacaagc ggacttcctt cagcatctcc      4320
     agcaagtgct ctttgatgca gctcgggctt tggcaaccat tattggacag gcagctttgc      4380
     atggtcctca aactttggca gactcctggc ttcccaccat cgcatatgac agctgccgga      4440
     tcatggtata tcatttgact cagatccttg atccacgctc cgagaatgca aaggcgcttg      4500
     cgctagccac cattcccctc ctacacagca atatcaacgc attgaagtca atgggatcac      4560
     tcaatgcaat cgccagcaca ctcgtcagtc ctttgtaggc ttttatttta atgggactcg      4620
     ttgctaatct acctgccagt cctctgcagc agaaacaatg cttgatcgtt ctggtattga      4680
     gtccgaggtt gtcaggcaga acatcatacc cgatgacccc tatcaatcaa ctgaggagga      4740
     agacacgagg taaagatggc tgtttcttga aaatgctatt tacttgctaa aggtggatta      4800
     tagtaccaat cttcgaggat ccccagttca aagtgcgccg gattacgtcc tcaatccgct      4860
     gacgattttc cgaatggcac gcaaatctat accagagcga catgccccgg aaagggcgag      4920
     cactacgtcg gcacctaata gtgtcctttc tgagaatagg gtttctcctt gcgagcttgc      4980
     tggctcctcc aggacagatc aacctgagtt aggagttgac caatcgagcc ttgaggagct      5040
     acaaacttta ttcatgtccg atctcggatg ggcgtggcag cccgcagaca cggcagtcgg      5100
     atcaggaaca gagggagctg gactcttgcc atgggcaggt ggatatcccg tcgctcaaac      5160
     acaaccctgg ttgcctgtgt ttccattccc ccagcagggc tgacagcgtc cggggtatat      5220
     tttcccttta tagatgatag catctttgat atggtccttt gaaagaacgt ctaatccatg      5280
     atgagcacaa cacccatcgg agcagtaggc gttggaataa caagtataat ttcagacaca      5340
     ataggttgta cttgacacag caatctacac attcactcag cgtccaaggg acagacagga      5400
     ggagtgtcat taacctggat acctccgcgc ttcttctcca aagtatcgtg gtatgggagt      5460
     ttccatcctc cttctgattc cggagccgaa agccaaagtc gcatcaaatg ccgtcgtcgg      5520
     gcaggccgac catcctcatc aaccgcccca ggtggatgat cggtgtaggc agttcgtgca      5580
     tggaagacat gtgtattact caagaattga atatcacctg gagctaggat catgtgtagt      5640
     gatagctcag cgcaggtgtt ctcaaatacc tctaaggcat gtttctgtct gtctgacaaa      5700
     gggggtatgc atgcatcagg ccctgagttg aaacgtgcta atgatgtcac gttcatagga      5760
     tcgaaccttg cgtagactcg tgggctgggg ctgctggtgt cgttttcgag gtaaaggatg      5820
     ctacctcgaa tccactcttc ctcaccttcg gatgtttcgc ccttccggtc aaaataccag      5880
     ttgggctcac atagtgttcg taccacatca ggatgtctct cctgtagtac gttgaataca      5940
     tgatgcgtgg aggcaatgtc tgactccccg ccagagagcg atttggcgat acaaaggagg      6000
     ccaacaagat cggctccatc cgtgtgaaag tattgactaa taaattaaca tttgatccat      6060
     aaccagtatg agtagttacg taccgagcat ttgttcggta gattcgaact ctgtcagttt      6120
     tggtcggatc ttctcccaag tccttgacat gacccagtac atgccctcgg ccgttttgac      6180
     tgacgaagta gcctaggtat gttccaaggc ccatatacgc tgttgcgcac ttctgaagat      6240
     cccattcctg tacaggaagt cctctaaaaa ggaagaatcc tttgccatta attagatctt      6300
     gtcgaagcgc ttccagccgc ccggacaaat tgggcaaagg gaaatttgcc tatggacaag      6360
     ttagtttcgg tcgtatgcgt catattctcg cggataatca caccttcgat attccagtca      6420
     aaggaccccc accctggatg aactgatctg tagcatggct gatctccgca acctcatctg      6480
     cgttgaagcg atgagtccaa agttcagggc gctcgcgata atcttcgggt ttccacactg      6540
     taggccctgt atgaatcttt gggaaatctg catagggccg aacctgtgaa tacaccgggg      6600
     ggtgctggcc ggatgttttg aacccatctg ggaacacaga gagcttgact gggcgcgaca      6660
     gagtctgtga gccagtagct tccacaagtc cgggggccat gattcaatga gatatgacgt      6720
     gaatgaatga taatagtaat tcttacttca ggaatctgtt tgccagtcag tgtccttgaa      6780
     tgaagaggtt gatccgtcat cagaaatcga cgttgctata tatactctca ctccgcggtt      6840
     tctcggctcg tcgtcccgat cggcttcggc ctatcgcttc attgctggta cctcgtccct      6900
     tgcgatttgc aagtccatgt cgaagttatt aacgatgggg agaatttgat tacagcacta      6960
     tgtaatctga tccaatcaag acccaaggcc atgtgcattt aatggacaac ccgaactcca      7020
     atgcttgctt gacggcctgt cggccaacaa gccgagatat gccaaactgg cgtcacgcaa      7080
     tataacccca tgtaatcgaa agatttggcg aattagagag ttgataaagg aaatctcgac      7140
     gctgtggcat tcatatcgga atttgaaaag tagtattatg tatgtatgct tcaatgaaca      7200
     tatactccga gttcctcaca gtattgctcc aatttaatgc ccagaatgga cccgtcatta      7260
     acttatcatt aattctactc tttcatatgt cggttccggt catcaaagcc tgcagccgat      7320
     gtctcaatat ccggtcgctt agtgccagct cggcctgagc atgacgctga cttcagtgag      7380
     ttactctgag ttctctcctc gccatacaaa ggtagagtat ttaggtcgac aaggtacata      7440
     taccaataaa aagttcctat agtttgcatt agtctaggtg ctttattcgt gagaatgagt      7500
     gatactgacc acaaaataca ccgccgccga tgatatttcc taataaggct gggatgatac      7560
     ctttccagat gtaaaagccg attgtaatct gtggcgcccc aagccaaatg cccaatggaa      7620
     tgaatgtcat gtttgcaacg acgtggtcga agcccaggga aacaaaagcg aatgtgggca      7680
     accagattcc aatgattttg gaggccagat cacggccttg gataccaaaa aagcaagcta      7740
     agcatactag ccagttacat ccaatgccac gcaggaatat catgtggaaa tcaggggtga      7800
     cctgcttttt tatggcaaag gaaataacag cggacctgaa tggctctgcg gaaaaagcat      7860
     ttccatctat agaacattag tcatattgtt ttacaatagg gaagcgaaat ccgtacagcc      7920
     gaagataata gccacgataa ataaagatcc ggcgaggttg ccaatgaatg tcacagccca      7980
     gtgaatcagc attcttgacc aagttaggcg ccgatggagc actgctaatg tagtaaacta      8040
     gtacatgtta gtcgcccgca acagtctgat ttgtgcgtag acataccata aatgatccag      8100
     tgcaaaggtc tgcacttgtt aggaggatca tacacagccc gtaaggaaac accagggcgc      8160
     cgattgttcg tatcaaaccc ggtgcattgt cttgaaacca tggtgtggca gtggtactaa      8220
     gggtagtccc acaagcgaat gcaagtaaac aaccagctga tactgcacta aaaaacacct      8280
     tgtccagccg catattccct ttatgtgccc ccgttcctga gacggcttca gtcacctctc      8340
     gaggcgagag tgcatcgaag gtcattttga tcagagacaa tgtcagtttg gcgataatgg      8400
     cttgattctc gtgaatgttt taactccaga gagctaggga agatatatca ttgtggcaag      8460
     agaattctct gcgatgaatg gcttatctct cacccagcgg aatcccgaat attccctacc      8520
     ctcggcatgc ttcaaatcta gacttaacga gattattgaa ctcagataag agttttgaca      8580
     ttgttgaaac gatgactggt tagagagcaa gttcacaaag tagagatcat cgagttaaaa      8640
     gggaatgagt tatcagagtc aggggtcttg gcaagataag ggttgtcctc gagatcctac      8700
     atctccgcgg atgtagttaa tggaaaatac cctatgcctg ctaattcgta ctagtagagt      8760
     actatacggc gtatcatccc aaatgttaga tggctacaac attgggttgc accttttaca      8820
     tttatgtaaa gcctccggat gtactccgta catgtagcca ctgtacatac tagcctcatt      8880
     atcgcggtat actgacccgg aaataccttt gtgcttccat gtgtgaccag ccaggtctac      8940
     aggcaaagca tgaagctaaa gcaagagagt gctattgttc aagtaactaa agacagagaa      9000
     gaaagaagga aggagagcaa agtctggcga gctgtcgaaa gcttaatcaa accaggctat      9060
     gcaaacgatg caaactcttt cctctctcgc taaacgagca aacaatcaag aagagcaaac      9120
     aaaggaaact aatctatcat ctgacatgtg ataatgcaga tcgtcacacc atgtgacctg      9180
     ctgaacttca ataaatccac aacagcgaaa tcaatcctac tcgtcactcg tcgctcgtac      9240
     catcaggccg aaaacccagt attcattttt catcaggaca caccttggat tgggtggttc      9300
     tggggagagt acctaggtag gtattggtca tgaaatgtca gagtagtggc cgatgcattg      9360
     tgcggatcca taagcacgat cccacaagcc gtccgactat agtgatcaag acattgacca      9420
     catgtgtcac gtgcaccaca agcacccatt aagcacaagg aagccaagca tgacacgaga      9480
     agcaagatgt tgccggccgc gtaagaactt catgatgtca ctccaagtat ggtctatggt      9540
     cttcccgcaa tatcgcaggt gacaaaacgt ggagacatcg agactctttc tagaaggaaa      9600
     atgactagtc atgctttatg ataatggaca cggtatttat aaagtggcga catagtagcg      9660
     aagtgatttg cgccgaatga tggggaactg gaaccagttg accccaatat aagtgaagtg      9720
     acctcgggag acgcgtcggt tgatttgctt atcttgtgga ttgcctcggt gcctcagcat      9780
     aaataataat cctcaaccaa cttgcccatt cattcattcg tcttctctga attgcatttt      9840
     gataatgctt tggactatag cgtgttaata atttggctga gaaagaaggg gggactcatc      9900
     tggattgttt tcgttttctt ggtctgcctt ttcggtcctt acctaggtag aagctaagaa      9960
     aggggcttag ggactataca tatgtatata atagaccaaa gcatattatg taggtatcta     10020
     tatctacatt acctagccct tagatttctc tattctagag aagctgatct agatcatctt     10080
     tagaaatgtg agacatgtgg tcttcctcgc gagaatatgc cgattatatt cggatacatt     10140
     ttcggccagt ccgcagcagc ttgccctaca attctctcca tccccgactg tcagatgaaa     10200
     aaggctacat aacactaccc tcttatcccc agttacgggt tcacccccac ggcccccgag     10260
     tttcggttgg tctcggtaat aacgggagtt ccgaatggga tctcctccgt cgaaggaaac     10320
     aaggatatcc taacagcgct aatccatata aggtaaggct tgctagcgaa atgtcttggc     10380
     tagcgtatgg tgcgtttaca ctctcgtggg ggggggggga actttggaat gcggagacgt     10440
     gggggaacac ggggaaacat ggggaaaccc aggaatagag ttgatgacgt ggggtggtgc     10500
     aatggaccct acaggatata tatatatctc ggtatattct atatggcttg agacgggagg     10560
     ccaaggtaaa cagattctcc tatgcaagac cccaccatgt ccaaaccaga tgttgttcac     10620
     aatgaagcgg cagatcacca gaaggaggac aagctggtgg acagtagtgg cattgtacgc     10680
     gtccccttga ccgaagaaga cagcaagcgc atctgccgca agaccgaccg aactattctt     10740
     gttgtgctcg tctgggtcta cttcctgcag attctcgata agacagtcct gggatacggt     10800
     gcaacattcg gtttacagga agacacaggc cttaccggca acgaatattc actcgttggc     10860
     tctatcgcac ccatcgcaca acttgcctgg cagccctttt cttcatacct gattgtcaag     10920
     gttccccaca agatccttat gccagtgcta tgccttggat ggggtattgc acagacatgc     10980
     atggcagcat gccacaactt cggcaccttg atggcggctc gattttttct cggtctgttt     11040
     gaggcggggt gtctccctct ctttggtgtc atcacaagtc aatggtaccg ccgtgcagag     11100
     caaccgatac ggatcgctgc gtggtatagt acaaatggcc tagcaactat cgtcgcagct     11160
     gctttatcgt atggattggc acagatagag tcgcacgttc tcgattcatg gcagatgtaa     11220
     gatgtcaacc cgtcccatcc ccaagagtgg tacattctaa ctgcgtctta gcatatttct     11280
     cgtggttggc ttgataactg tcgcatctgc cccaatcgtc tactggcgct tggacaccga     11340
     tatatccacc gctcgcttcc tcagtgagga ggagaaagcc caagggatgg agcgcttgcg     11400
     agctaaccag actggaaccg gaaataccga gttcaagttc ggtcacgtcc tcgaggcctg     11460
     cttagagccc aaaacgtatc tctggatcgg aatggcaatg ctcctcaaca ttggtgccag     11520
     cgtgaccaat gtcttcggtc cgctgatttt aagcggcctt ggctacgata aatacaggac     11580
     aactctgctg accatgccat ttggcgcgtt gcaattcgtc atcattctgc tggcaagtta     11640
     tcttgcccaa agcgctcgtg tgaagggcgt catcatcgcg gctttcatgc tgcccgtgat     11700
     agccggtcta gcaattctgt atgcagtgcc tcggactaag tctgtgcagg gccagttact     11760
     tgctggctac tatctactcg cattcctatt tgggggcaat ccattgattg tgacctggat     11820
     catcggtaac acggcaggca ccactaagaa gtccgttatc atgagtttct tcaacgcagc     11880
     aacctcggca ggaaatatcg ttggcccgtt gctcttcaat gagaaagaca agccagccta     11940
     ccacccaggc ctgcgggcat gcctgggaat tttctgtacc ttggccgctg ttgtttttat     12000
     tcagtgggga aatctatggt tccttaacaa acaacaagcc cgccgacgtg tacagaatgg     12060
     caagagagct gagataatcg acctttcgat gcaaaataat tatcaagaca cgcagaataa     12120
     cctggaggag accggacatg agactgtgca aattggggat aatgcgttcc aagatctgac     12180
     cgatcgggaa aatgatgagt ttgtatatat ctattgaggc tagtcaccgt tagctgtcca     12240
     atatatgcca gttcccgcat actatcgcca agtgagtagt gtctcattct tgggtggact     12300
     gaacttgagg cctcaggcca catttagtgc ctgagtcacc agaacacgac ctcagtaccg     12360
     gtgcatgtgg acttctttcc cttccctcgt ttctcttgcc cactacttct atttccccgc     12420
     gttctctgtg cgctccgtct ccatcaagtt gagccttcga agttttattt tcaccctgcc     12480
     tatcctgatc tcagctgcat tccctagaca gggtaggata ggggagattt tcatctcctg     12540
     cctagacggg atgggatata tttcacccct gccgggatga gatatattcc cacctcttgc     12600
     ccatcctgac ccctgctgca ttttctaggg agtgtgggat atggatatct tcaggtttgg     12660
     tgtattctca tttgcctaca aagggataga gaagcaaaca atccaaaccg tccagaccac     12720
     atcagtttac cgcgtgttga ccgttcaaac tacaatatgt agcttggagt cggacattac     12780
     cagttgagga tcgaatgcct tcgaggctag cactcaaatt gaataagact catagcacat     12840
     ggaaatttgg tcgagaactg aagcgtgggc atgatccggg aaaacagggt tatatattgg     12900
     aacccaggct aggtatgtag tctatctcgc agtttaacca ttgtgataaa cttcccgact     12960
     gctgacttgt taggagtatt gttattgagg tatcatacat cttttattgg agtctttttg     13020
     cgcaatacga ccatatagtg gacatcatcg gccataagaa aaattcttac gaaccctgcg     13080
     cgcacgtttg attctcttgg tggggtctcg aacatgcaaa tgcgacaggg cgatgacttt     13140
     cggactcgga ctcggctctc agatttcaaa ttagccggac tcgaaacccc tggaagacta     13200
     ggatcttagg atctctagat tcccagagta acatgaagtg agcaaataca ggaagattct     13260
     ctccacacat ggggagaact ggtgaatcac atacctttgc catgatttgt ctggtttcat     13320
     atcacaaacc tggagacagg tctcggagtc ggaaccagct gaaaacaacg acaagctgac     13380
     ccgagattgg atgtccgaac tgtcctaatc tgacaaagaa agcgagcctc ggcacattga     13440
     tatgtaccgg tccccgtcgc tgctaactgg agtatgaatt ttgcggagaa aatcttgtcc     13500
     cgattgttca ggagtgatac cctatagacc cctatagacc cttcattgca atccgcgaag     13560
     tcacacattg gttgtaccag cctgtataga gccagtgaaa cccgaactgc acaatgacag     13620
     gtgatcttca gcacaccggg gagccgattg ccattgtggg aagtgcttgc cgctttcctg     13680
     gtgatgcaac aacaccttcc aagctatggg atctgctaag agcacctcga gatgttctga     13740
     gagaaatccc agaaactcgc tttagcacca aagcgtttta ccaccccgat gggcttcacc     13800
     atggcacaac gaatgttcgg cattcctatc tattgtccga cgatcatcga ctgtttgacg     13860
     cccaattctt tggaaccaaa ccagtggaag caaactcgat tgatccgcaa caaaggctgt     13920
     tgctagagac cgtttacgag gggcttgaaa cgtcgggcat ccctatggaa aagctacaag     13980
     ggtcaaacac cggtgtatat gttggtttga tgaccaatga ctacgccgat atgttgggtc     14040
     gggatgtgca gaactttccc acttatttcg catcgggaac tgctcgaagc atcctatcca     14100
     accgagtctc ctactttttc gactggcgcg ggccttccat gaccatcgac acggcgtgtt     14160
     cctcgagtct gattgcccta caccaggctg tacagagcct acgaagtggc gaaactgacg     14220
     ttgcagtggc agcaggcacc aaccttctgc tgggaccaga gcaatacatc gcagagagca     14280
     agctgaagat gctttccccg acgggccgct cgcgcatgtg ggataaaggc gcagatggat     14340
     acgcgcgtgg tgatggaatt gctgccgtca tactcaaacc attgagtgca gcattggcca     14400
     atggtgatca cgtcgaatgc atcgttcggg agacaggcgc caatcaagac ggtcgcacca     14460
     aaggaattac gatgcccaac ccggtcgccc aagcagacct tattaggact acgtacgctc     14520
     gagctggact cgatctttcc aagcccactg accgacccca atatttcgaa gcccatggta     14580
     ctggtaagta gtcgaattat gcttagggtc agggatttta ggcgctaaca aaatcaggaa     14640
     ctccagcagg tgatccagtc gaggcggagg ccatcagcac tgcattcttt ggacaagcag     14700
     ccaattatca acgcgacggc aaccaggagg accccttgta tgttgggtcc attaaaacag     14760
     tgattggtca caccgaggga acggcgggat tagcagccgt cctcaaagca tcacttgctt     14820
     tacaacatgc cgtcataccg ccaaacctgt tgctcaacga gctgagctcc acggttctcc     14880
     ccttctataa tgaccttgaa atccttcaag ttgcgaaaga atggtcacag cttccgcata     14940
     acacgcctcg tcgtgctagt gtcaatagct ttggctttgg tggtgcaaat gcccatgcaa     15000
     ttttggaagc cttcgatgcg cgtctactgg accgcgctca caccggccca gatggcagct     15060
     ccacagcggt gtcacccttc aatttctccg cctcatccga aaagtcgctt cttgccaatg     15120
     ttgcagcgta ctcgacatat ttgcgaaata atccggatat caatatgcgt gatttgtcat     15180
     ggacattgaa ctgtcggcgt tccacactcc cagtacggtt gtccgtgtct gcatcaagcc     15240
     cagtagagct tgctgcaagg ctggatgaag cagtagcgtc ctcagcagta acaccaagca     15300
     cgcaaacggg aaatattcgc gaaccgaaac tccttggagt gttcacaggc caaggagcac     15360
     agtgggcaag gatgggtgct ggattgctcg aaacatcacc catggtaagt gattgcatcg     15420
     ctcgtctcga tcggtctttg caggaactac ccactgagca tcgcccggtt tggtcgctga     15480
     gggatgagct tcttaaagac aagtcctatt ctcgcattgg cgaggcggcg ttttcgcaac     15540
     ctctttgtac cgcgattcag attgcactgg tccagcttct ccgggcagcc aatctgagac     15600
     tcactgcagt cgttggccat tcttctgggg agattgccgc agcgtatgcc gcgggatatc     15660
     tcaacgaaca ggatgctatc cgcattgcct attaccgtgg atggtctctt caatatgcaa     15720
     ccgaccaagg aggacaagaa ggggcaatga tggctgcggg aacatcgttt gaagatgcaa     15780
     tggagctttg cgagatgccg tcactcgaga acagaatttg cgtggcggct agcaactcct     15840
     ccgccagcgt cacactttcc ggagacgccg atgccatcaa cgaggccaag gaaatccttg     15900
     aagacgagaa gaaatttgct cgcttgttga aagttgacaa agcttatcac tcacatcaca     15960
     tgctttcctg cgcagctcct tatatcgcag cgatccgaaa atgtggtgta actatccagc     16020
     gtccaccgag cggtagtgct acttgggtgt ccagcgtaca tggcgagaat attgatgacg     16080
     tggatgacag ccttgtcgac acttactgga gcaacaacat ggtcaagccc gtactattct     16140
     cccaggccgt cacttacgca gttggtgcag cgggaccatt cgacatggct ttggagattg     16200
     gtcctcaccc atcattgaaa gggcccgcaa tggaaacaat ccaagaagtg tctggtgaga     16260
     cagtgcctta cgccgggact ttgaaccgtg gccgaaatga cagcgaggct ttctcatccg     16320
     ctctgggtgc cctatgggtt gcattgggtg agagtgttgt ggacttcgca gggtttggaa     16380
     tgaaagcaac gcaaaagcaa aacactcgaa ccccaaagct catcaagggc cttccatcgt     16440
     attcttggga ccatgatcgt atttattggc acgagtctcg atcatctacc gcaatgcgca     16500
     ctgaaaggga accgtttcac cctttactgg gtgtaaagtg ccctgacggg acagacaatg     16560
     agttgcgctg gcggaactat ctacacccta gggaagttcc ttggctgggt catcaccagg     16620
     tccaaggtca aatggtattc cctgcggctg gctatatatc ggcagcggct gagtctgtca     16680
     tccaaaagta tggcctgggt tctgtgcaac tgatcgactt ccatgacgtg atcatcggac     16740
     aagcgttggt gctcgaagag gacggagggg tggaaacaat attcagactt tcaatcgatc     16800
     aagttcaacc gaatcgcgtc tttgcgtcct ttacctgtca ttccgccgcc aataaggggt     16860
     catccaacat gtctcttcac gcatctgcca ccctgcaaat tgttttgggc gaccccaaac     16920
     acgatatact gccaccatac tcccagccgc gaggttcatt tctggatctg gaagccgacc     16980
     ggttctacaa gtcagtttca gggcttgggt ttggctacac cggccccttc caggcccttt     17040
     ccaacttgcg cagaaagatg gacgaggcat cgggtttgat cgctgtccca gtacatcccg     17100
     acacggaacg accattgatc attcacccag cctctcttga tggagccatt cagtccatta     17160
     tgcttgctta ttccttccca ggcgacggac gtctacggac cctttacctt cccactcgaa     17220
     tcgacaggct ccgcctcaac ccgaccgcct gcgtcgctct cggtgcccct ggtgcacatc     17280
     tgccctttta ttctgcggtc accgatgccc gcttcgccga tctctctggc gatgttgaca     17340
     ttctttccgc agacgggagc cacactttgc ttcaattgga aggacttcat accacaccgt     17400
     tgagtccatt gacatcagca aatgatgttc cctttttcac cgaagtgatc tgggatgttg     17460
     ataggccggg gcagttaaag aaaggcgaag gcatgcacga ccattccatg gccatggatc     17520
     tcgaacgcgt cgcgcatttt tacttcagaa aactccaaaa ttcactccag cactccgatc     17580
     gtgcaaatgc ttcatggaat catacgcacc ttctctcata tgtggaacac tgtacgaagt     17640
     ctgttgccaa tgggaaacat agattcgcaa agcaggaatg ggccaatgac accatagccg     17700
     atattgctcc aattctggat cggtgagaat tatttgccct ggccgacatt gaagcacact     17760
     gactgattta cgtagccatt ccgacagtgc cgacatcaaa gcgctgtgtg cagttggcga     17820
     aaaccttgct gctgtcattg cgggagatat gaatttgctt gaaattctgg tgcaagacaa     17880
     tatattagcg gaattctacg ccaaaacact tgggataggc gcatatctgg atgctgttgc     17940
     tcaagcagct cggcagatca gccacaggta tccccatgtt aacgttttgg agatcggtta     18000
     gtccacgcac attttccaaa atgtgttcca tactaatgta ttataggagc cggcgctggt     18060
     gttacttcaa atagggtcat tcgtgcaatg ggcccttcct ttgcatcata cacatacacc     18120
     gatatcttgg attcgcagtt tgatgacgca cgcgaaagat tctcggatta tcaatccagg     18180
     atggctttca aggtgttgga catcgagaag gatatcgggg aacaaggcta cgaagaggct     18240
     tgtttcgacc ttgttgttgc tccactcgcc ctgtatgcca ctagaaagct tgaagccacc     18300
     ctcacaaatg tacgccggct gctcaagcct ggtgggtacc tggttatgct cgaactcacc     18360
     gaccctgatg tcatgcgctt cgggctcgtt ctcggtggcc taccgggctg gtggttaggc     18420
     tacgaggaag gaagaacatt atcaccatgt gtatcggagg acaaatggga aggactgatg     18480
     cagaaggctg gattttctag gttcgaagcc ctggtatcgc cttccagaac gtcgcctctg     18540
     ccattttgtg tcatggtcac ccaagctgtc gatcaccgtg tggacttcct tcgtgatcca     18600
     ctggcggcga atcacatacc actggatgtg gactcgttga caatcatcgg agggaaaaca     18660
     tccttgactg ccgatatggt agccgatatc aaaactgctg tgcgtcccca ctacagcaat     18720
     atctacacag ccagttcttt agatgatctt gtctcagcaa gcttgcccgt gatggggtca     18780
     gtgattagtc tgattgaatt ggatgcacca gtcctcaaaa acatgtctcc agagaatctg     18840
     aagtcattcc aggagctctt caagcaaagc aagaatgttc tatggctggg acacggtgcc     18900
     caaggagaaa acccctatgg caacatgttt tcaggagtcc aacgtacctt ggccatggag     18960
     atgactcacc tccatatcca cttcctcaac ctccattccc tccacgacgc tgatgtgaat     19020
     ataattgcga caaagctcct ccatttggaa gctgccgaaa tttgggatca aagtggacag     19080
     ctcgatggga tattgtggtc taacgagagg gagctgttgc tggagaatgg acacttcaaa     19140
     attcctcgat tccgcctcaa ttctgctcgg aatgatcgat acaattcgtc aaggcgtctc     19200
     atcattaaag aggtcgaacc cgccggctcc gtggtcacca ttcatccaac tgaaattgga     19260
     tatcaaattg aagaaaagga ccctcaatcc tcgccctctt tcccggatga tgtgcatatc     19320
     gacgtgactc actctatgct ccgtgccgtg cgcattactg catctgacaa ttgtttcttg     19380
     gtggttggga agaataggtg gaatgatgag cgtgtgattg ccctgtcgca cactctggac     19440
     tctcaaatcc atgtgccgcg tgctctggcg gtgccatgtg gagattccga tgacctagct     19500
     atgcgatcga tgttcaccct ctatttccat ttccttgctc tctctatgct ggaacagctt     19560
     cgatcgggaa cgacattggc tgtgttggac cctgatttct ccctgtcacc cgtccttacg     19620
     aaatacgcta gcgaaaaggg tgtccaactt gtgcttttga caacaaggga aggtcattgc     19680
     tcgtggccgt gggtccgaat ccacccgaac gccacccggc gtgaagtgtt aagcaagtta     19740
     cctggcaata tttcacgtct tgtcaatatg agtggcggcg tcgatgtgac tgccctcctg     19800
     aagacatgct tgccgacaga ctgtcatttc gcaagcgaga gtactctgac tgcgagatgc     19860
     tcccaatctc agtacacctc ggatagaggc caattggctg tgcaactgca gaatacctgg     19920
     tcgagagcac aatacgacct gatgccagtc cgcaagtttg ctcatctagg actcgaggac     19980
     ctgattcgcg cacaatcgcc gcttgcagag cagtctttaa ttgcatgggg tcaatcgcag     20040
     cttgctgtcc aggttcgccc tgctaccaaa caagtcggat tctcaaaaga caaaacctac     20100
     tggctagttg gactgacagg tgggctcggt ctgtcacttt gtcagtggat gatcggacag     20160
     ggagcacgct acatcgcgct atcaagtcga aatccaaaca ttgatgacca atggctgcag     20220
     agaatggcta ctaatggctg cactgtgcgg gtcttttcca agtaagctct tctgttttac     20280
     attagtcgcg ctcgctaaca gatccagtga cataacgaac agggaatccg ttcaggcaac     20340
     gtatcgcaat atcagtgaaa cgatgcctcc catcgctggt gttgcacaag gtgccatggt     20400
     ccttcaggac acaatgttta ttgatttaga tctccctcgc ctcgagaagg ttctccgtcc     20460
     taaagttgaa ggtagtttat tactagacga gttgttccca gaggatacgt tggatttcat     20520
     ggttttcttt tcatccatgg ctgcgatgac cggaaacccc ggtcaggttg cgtacaatgc     20580
     cgcgaatatg tttatggcga gtcttgcagc ccaacgccga aaccgtggct tggcagcaca     20640
     tgcgattaac atcggcgcga ttgttggtaa cggctatgtg accagagagc tgaacatggg     20700
     ccaacaatct tatctttacc gagtcggcca ttcctggatg tctgagcaag acttccatga     20760
     ggtgtttgcc gagggtgtac tgtcttgcat ggagcgggta ggaagcgctg aattgtgctg     20820
     tggactcaga attgacgatg atgagtcaaa gagttgggct tctaacccaa tgtttcaaca     20880
     cctggtctat aagtctagca atcttgtggt ggcagacaag aaagggaaac ctggcgtgtt     20940
     gataaaaaca cgtttgttcg aggcaacttc gcatgaggaa gccatggaga tcttgcaagg     21000
     tacgggcatc gcaaattcta catccagttg aaactaattc tttagatggc tttgtgttga     21060
     agctccagtc agcacttcag gctgatccca acaagcccat gttagacatg agtccagatg     21120
     atcttggtgt tgattcattg atcgccgttg accttcgatc gtggttcctc aaggagttgg     21180
     gggtcgacat gccggtgcta aaaatattca acgcggcttc cattcgtgag ctcttggtca     21240
     ctgcggctgg agttgtgcca gaagctttga ttcccaattt ggtttccggc gaacagactg     21300
     taaagtcgct ggttcatccg cccattcctc cggtgcctgc accagcttcc cctgcagact     21360
     tgcccgtgga tataatattc ccagagacca gagccagttc cgtggaacca aagattgctc     21420
     ttccggacgc gacaaatgct tacagtggca gctcggcaac gtctttaatc actggagact     21480
     cgaattctga caacaacgac gacacttcct cttccatttt tactgacgac agcgaaatcg     21540
     gattcccgaa acgtgaaatc caaagaacgg tcccaatgtc ctacggacag tcgcgctttt     21600
     ggttcctaga gcatctggtc gaggacaagg cagcattcaa cattacaccg acgtttgagt     21660
     tgtctggtca tctaaacatt gcggaatttg cgcatgctgt gcaagccgcg ggacaacatc     21720
     acgaagcctt acgtactttc ttcttcactg acaatgagcg gaaccatatg caaggagtct     21780
     ggacgagatc ctccttgcaa ttggagcacg ttgcaatctc ggacgagaga gaagttgaag     21840
     aggcctcgaa gcagatggag gcacatgtgt tcaatctctc tgatggcgag gtcatgcgtg     21900
     ttcggctgct ttcgctcaac ccagaaaaac actggataat attcggcttc caccacatca     21960
     acatggatgg cattagcttc gaagtatttt ggtcagacgt ggaaaaggca tatcaaggcc     22020
     aacccctttc cgaagatgga cttcaatatc cagacttcac cctgcggcag cttcgcgaat     22080
     acgaagaggg cacctgggca ggggatctcg cctattggcg ggcacaatat acagagattc     22140
     aacccgcaat tccccttctt ccgtttgctc tacaacccat gcgtcccaag gttgctcaat     22200
     tcgggtctca tactgcccag attcgtctcg acgtcagctt gacggattca attgaccggt     22260
     gttgccggat gttcaaatca acacccttcc acttccattt ggcagtctgg aagactcttc     22320
     ttctacggtt cttcgatatg aacgatgtct gcatcggcct cggagatgga aatcgtacag     22380
     aagccgatat cctgcggagc atggggctct tcttgaacct ccttcctgtg aagttttctc     22440
     aacagccggg ccaatcattt ggggaatctc tcaaagaggt ccggaatgtc acgcaggctg     22500
     cattttccca ctcgcgtgtg ccgttcgatg tgatattgac ggaactcaac gttccgcggt     22560
     ccgcatcaca caatccacta tgccaaacgc tcttcaacta tcgacccaag gtcgaacaat     22620
     cacggagctt ctgtggttgc gtggccaatg gcgcactctt gggtggcggc gagacttctt     22680
     tcgacctggg tctagatgtt ggcaacgtcg gtgccggtga gacgctaatt cacctgtctg     22740
     ttcagaagag cttgtatggc atggagcatg cggaaattct tctcagttcc tatgtcaaca     22800
     tcctccggtc ttttcttcga aacccagcga ctcgggtgac ctggccggag ttacattcca     22860
     aagatgacat ccagagggca ctggctgcgg gccgaggcaa gttaattacc ccttggtcgt     22920
     tgtaggtctt ttgctaaata tagtgttata caggacctga gctccgagag gaatggtctg     22980
     tgactatagt ccaccgactg gatgaggttg ccttgcgcta tccggaccgt gtcgcactga     23040
     aggaccccca tggggggtcc ttgacttatg ttgaagtcca gtgtcggatc aatgttatcg     23100
     ccaacgaact tctacgcaac ggagttggtt caacaacccg ggttggggtt ttccagtccc     23160
     caagtgcaga cttgatatgt tctctcatgg ccatcttgcg cgtcggcggt gcttatattc     23220
     cattggacaa aaaggtgggg atggacaggc tcgcgatgat catgaaagaa acgcaagcat     23280
     cgatggtatt gcttgataca aactccatgt ccgactacgc ccttttgcgc accacggcga     23340
     aacccatcga cgtatctacc ctaaacggct ctacggcacg tgccgttcca aatatggctg     23400
     ttccaagcca gacagcagta atcatgtata ccagtggatc aactggcgtc ccaaagggga     23460
     ttatgattgc ccattcagca tatgctcatc acatccagtc atccagtgtg gtctggaaac     23520
     ttaaggaggg aaacgagacc atcctgcatc aatcatcgta tgcgtgggat gcgtctttgt     23580
     ggcagatcat ggtctctcta tgctctggtg cgacccttgt gattgcatct gaactgacgc     23640
     gaggcgaccc cgttgctctc acaagactcg tcgcatcgga gaatgtgaca tgcacccttg     23700
     ccacgcccac ggaatatctc ctttggctgc gtcatggtcg ctcccacctg actaactctc     23760
     gtttgtcaac ggctctatcc ggtggtgaat acataccaag tggcctgatc aaagagatca     23820
     aaagtcttcg gcgaccggac ctcagactga tcaatgctta tgggccggcg gagatcagcg     23880
     ttgcgtgctc gagcagcgaa gttcggtaca atctagattc tacatcgaca tctctttata     23940
     ctctaccaaa ctactctgtt tacattgtag acacaaactt gaaccctgtt cctatcggag     24000
     ttcctggtga agtggtcgtt ggtggcgcag gagttgccca gggttatctt gacggcacta     24060
     aaacaactga acggtttaca aatgatcggt acgcgagcaa gcttttccag gagaagaact     24120
     ggactacaat ccaccgcact ggggaccgcg gaaagctcaa tcgtgatggt ggccttattc     24180
     tcctcgggcg catggacggg gataaccaaa tcaaactaag gggaatgcgg atgaatattg     24240
     aagaaatcga ggcggcaatc gtcaattctt cggctggggc tatcacacaa gctgtggtat     24300
     ctgttcgttc agacgcgact gatcaattcc ttgttgcctt tgccataatg gccaacgcac     24360
     acgaaaatgc ccttcaattt ctcacccgcc tttcccaaga actgccattg ccggctcata     24420
     tgaaacccgc tgctatcatt ccagtcgaaa ctattcccca aaatacttca ggcaaaactg     24480
     atcgcgtcgc agtcagttcg tttcccattc cgttagtttc ttcccagctg ccggacgaca     24540
     gcaccctgac ggcgtttgaa cagtcactgc gtcagctctg gcaacaggca ctgccacagg     24600
     aacttagaag ctttcactca atcaattccc aatctgactt tttccacgtt ggtggaagct     24660
     ccctcgccct tgtcaacctg caggctctga tcaaggagaa ctttggtgtg tctatggcat     24720
     tatatcaact ttttgaggcc agcagtctac gtggaatggc ggccaggatt caagatatat     24780
     ctggtaccgc acttgaacat gcggtgaatt ggcatgcaga agttgaagtc gcctccaaca     24840
     tcgcttcacc gctcaattat ggcggcactc acatcgtcgc ctcgggggtc acgacagtgg     24900
     tgcttaccgg ggccacgggt ttccttggca aggaaatact ccgaggactc ttagaagatg     24960
     aaaaggtctc atccgtccat tgtcttgctg tcagaagacg atcctctggt ttatctgaac     25020
     tattttccca tccgaaagtt catttacatt atggtgatct cggggctcct cgactaggac     25080
     tatctgaatc tgagacaaga tcgatatttt cctgtgcaga cattgttatt cacaatggcg     25140
     cagacgtgtc gttcatgaaa acatatcaga ccctcaagct gatcaatgtg gcgtctacaa     25200
     aggaactcgt caaacttgca ctgccccggc gtattccgtt ccatttcgtc tcgtcggctg     25260
     gggttgcacg acttgctgcg caagaaagct ttggggaggt gtctgtatcg ccctatcctc     25320
     ctccatcccg accaacagat gggtatatcg ctgcaaagtg ggtgagcgaa gtctatctcg     25380
     agcgcgtcaa ctgccaattt ggtctgccgg tgtggataca ccgcccatcg agcatcaccg     25440
     gtaccgatgc gcctgaactt gatctcatgg gtaatgtcat gcggttcatc aaagaaattc     25500
     agaaagtgcc agactcgagc tcatggtccg gggggttcga tctcatttcc gtccagtcgg     25560
     ccgcaagcca attgctcgaa gccgttcacc aatccggtac tgccgaagcc ggagagactg     25620
     tgacttatct ttatgaatcc ggcgagatga agattggacg tgatgaggtt atgcccttaa     25680
     tggaatcggg ctcgggccaa cagtttcaaa ttgtttcgct tggcgagtgg gtggatgctg     25740
     ctgaacaagc aggaatgagt gtgttgctag gagagtattt gcgccgggcc cccgagggcc     25800
     aagtgctcct tcccaggttg attaaaagta atggatttcc cgaggatgaa tgaggatgaa     25860
     tgaggatgaa tggggatgga tcaggatgga tgaagctgaa cgggaatagc tagaaattta     25920
     caaagcgaat ccattaacct tccacggcgc acaaaatttc taaacgccta ttcccgatat     25980
     ttgcccaagt caaaggcgtc tcctggctct ccagtttcat gtcctaatat tctccagcta     26040
     ttctgcagca gaacaggtac tcccatgacc cggatcaagt atttgtgcat acttaatttc     26100
     cagacaaagc attatcattc tctacgcagc ccctcctcct ttcatacgaa aaggtaagaa     26160
     ggatacactt ggttgatgca catatatcaa cgtcaacatc aatggatggt acctatctaa     26220
     ttatgtaggc caagtcctac ctagggatac acacttaggt gatcaggggc cataaaagtc     26280
     actccttata gaggggtctt catcagatct acttcatttc tctatcccct gaaacccaat     26340
     atcaatacct gactatgcgg tcagtttgga catttgaaag gtattttgat ttcagccacc     26400
     aagccaaggt attggtgtct cagggttggt tgttgcccaa ttgttcgaaa ttggaagaac     26460
     ttgttttttt tttatcttgt aatttcaatg aacaggtcgg atttacaaag ctataagaaa     26520
     gtgatcaggt ttcctttctg caaatccaga gtcaatatct tccctctaca ccagccaatg     26580
     tgataacttg caatgacagc atatagaatc gcattaccct agtgatacgt ctacaatatg     26640
     tgaatgcagc ctagattgga ctgctctcct gtaatacaac ataggggaca cagcacatta     26700
     tatgcagaag gtgtaatatc caactgtatc ggcgctaatc ttgcatttgt agggtgttac     26760
     gattcatagc gctggaataa ccccttcaga ttaactgtaa atcagctagc attctcagta     26820
     aatagtaagc cctgcgttct catcgggacc ctgagagtga ttgttccaat gtatatgttt     26880
     agaaaagaca gcgattgcaa ctttgactag aatcgccaat tttaaacccg ccatggcatg     26940
     cccaggaaag gcactgtttc tgttaatttc ttttttttct tttcttcctt ccttgttttt     27000
     cttggctttt cctggtgttt ttgcgattat tattcttttc gttgtacggc gaggaggcac     27060
     gctggacttt atataaacga gcctccccaa attcacacgt acaattccac tagctttcat     27120
     tttacaacaa gatggcatct cacgatcaat taccctcgaa ccagaccggc atcattcagc     27180
     atgaaggtgg tattcttcaa atcactcatg gtctgcctat cccagaactt ggcccccacc     27240
     aaatgttggt gaagactgct gctgtggccc ttaatccatg tgattataag atgccactga     27300
     ggttcccgac cccaggtctc tgggatgggt gtgacttttc aggcacggtg gttgctctag     27360
     gaagtgaggt tgctgcgcag ggacgattcc atcttggaga taaggctttt ggtgccgttc     27420
     aaggctcaaa tatgtcagat ccgatgtctg gatcatattg cgagtacatt agaaccgaac     27480
     caggtcttac tttccatgtt cctaaaggaa tggaccttgt cgctgcaccc tccctttcgg     27540
     ggaccgcaat tgccactctc ggggttgccc ttttttggtc acttcagctg cccggaacat     27600
     tacacacccc agcatccaag tccgaggatg tcctggtata cggcggaagt agcaccatag     27660
     gcctacttgc aatccagatg gtgaagctgt aagtagtcca gttcccttct gtggctttat     27720
     attcccaact aattcatatt gcttagctgc ggccaccggg taatcaccac atgttccccc     27780
     cacaacagcg acttggtgac ttcatacggg gcagatcttg tcttcgatta ccactctcca     27840
     acctgtgctg aggatattcg agcggccaca aagaacaccc tgcgctatgc ccttgatccc     27900
     tttgcggaag ccaagactct gcggctgtgc catgcagcca ttggtcgtac tggaggaaga     27960
     tactgtgcac ttgagcagta tcaagaaagt ctttgctcgc gcaagacaat caagcatgaa     28020
     ctagtcatgg gaggtgctat ctccggacga ggtgtggagc tccctgaccc atacggtatt     28080
     ccaccgcaac ccgagattgg agtctgggct cagtcgtggt acctagaact ccaacaattg     28140
     atagacgatg ggaagcttaa accctgtcca actcaaatca ttccaggcaa atttgcaggg     28200
     atcttggaag ggttagacat gctgcgaaat ggaagggttt cggggaagaa gctcgtcgtc     28260
     catatgacca cgaaatgaaa gcctgtaata agttggcttg gagcatggcc cagtacccaa     28320
     gtatttaaga gaatgtacct tttgatggac cgttggaatt ccgtgtcacg tcatagtcta     28380
     ggaaatggtt gtcgtatcag gtgtctatat ctttgttcct ttcagctatg gttactgctt     28440
     agtgtgctgt gctttggacg gagagagctc gctattagcg actaactcaa gtagaaagta     28500
     accaccttat tagaatcaga actaggtgtt cacttaagga cgtgagatgt tgctaagaat     28560
     gccgtttgta gtggtgatat gcgtatttaa agattcgatt tgcgttgaac gaaactatca     28620
     acatagacag taggtgaact aatttgacta atttggtcca tcataaacca tcttagcaat     28680
     caccttcttc tcgtccttgg tcgtgctaat gttccgtgtc atacatttct ttccctcgag     28740
     ctcttcaaat ccccaaatca cttccgcttc ccatcccttt gaagcattgt gggccaattc     28800
     ttgaatgacc ttgtcgctca agctggccac ctccaggatt tgacggatgg gatcttccag     28860
     tatatcaggt ctgtcaataa atcgcagttg catctgaaca tctccgaaga taggcagcga     28920
     aacgtcttgc cgacttccgt cgaccgagta acttccttcg ctgtcaaagc cccctgggtg     28980
     gacagtttgt gtcatatgaa gagttgtgac tggtttcagg ttgtcggcca aatcagaact     29040
     tttggagctt gcgcccatgc atgtgctttc cttggatagt gaagtggtct ggtggatttg     29100
     caatgaaagc cgggcgtgtc gcaagacctt tcggacaacc caaggtacgc cttgctaatt     29160
     tttttttctt agcaaagaaa tgccagcaca tcaatttact attgctctta ccaagacgaa     29220
     aagttcatct ggatcggttg aaagctctcg gttctagtca tcatgttagc ccatacgata     29280
     ggcaagtcat caactgaacg taccaatacc caggttccag taagatcagg aacatcttcg     29340
     aaatcaggta cagccatcct ccgggattta aatttggaaa tcagttgaga agatctgttt     29400
     ccttgtccct ttggggatgt atctctccgt ggtaaggcgg cgaatggtcc cttttaaggg     29460
     tgtagttgaa taatcactcc atccagcagg atcgatatga gttctaaatc cagatcggac     29520
     tcggactcgg tgtccgaata tgcaaggaat gtcgcagcta ttcattcgac tgcaatgacc     29580
     catgaatgcc atgaccttgt attgaaaaga acccagcgcg gcgtgattcc catctgagat     29640
     caataggtct ttgcttcgca gggaggaacc gtacatcagc ctttgcttac ctggttcggt     29700
     gatatttctt atctggtttt taggtgattt gctcttcttc ttgcttgtta ctttgcgatt     29760
     tttgtttaaa ctacgccagg tcatgaaagc aaacgggaac aagtaaaacc ttttgaatat     29820
     tgaagatcat aaaggaccat attaagcaac cactgggtct ttaacacgtt gccgcaaaca     29880
     ctccattatt tccatcaaag acatttcaca aggatcctgt tcttgtgcca gcacaatgtc     29940
     gcggattgag cttgaccaat ctttctggac tgtatcagat gaatcgaact ctcgatcctc     30000
     ttgcggttgg gccgggcctg accgcaattt aagggctcgg tcaagctttc ccatcattgc     30060
     agagctgaaa tcaaccaatg attgcacttg ggcaatgaga tttccatcca aataaaactg     30120
     cccgaaccgc acctttggta atagcagaat cgtagctgca tcagtgggag gaatgatgag     30180
     aaacagctgg tacaaccgca tgaagacagc gcgatatatt cgaacaagtg agcaatgtgc     30240
     ctccaatatc ccaagccaca gtgctatatc acatttcggg attgtgggag ttgtcgttcc     30300
     atccggagat gtcgttgtgg tatgatatcc ggaatcatgc ggggatactg tggtaacatc     30360
     ttcatccaag ctattgccag cgtctgggag gataaacaaa gggtcgtcgt atccgctgct     30420
     ctccgatcca aatcgttgtg tagatgtaac atccaagctc tcttccgtac cgcacgacga     30480
     tcgaacaatt tccaaaagcc aagaggagta attaaggaga cggtatattg gaaggtcgag     30540
     tgtttcaatt gataaattag aacttccgta gaaaatggat gaggattcca ggagcatcga     30600
     tccggtctca aatagctcca gatcctctac aagtcccatc ttcaatctta gcagactctt     30660
     gcagatgccg ttcgtagagg gcagaccctc ttggcttgtt gtcgccgagg gaggcttgtt     30720
     tatagttgca atatctgggt gattcatcca cgcaggatct gggcggtcct ttattgcaaa     30780
     gggcaattcg ctatcgccat agttgaagca cctattttga aaaggctcgg aaattgccat     30840
     ttcggtggct tggctggcgc ctggtggagc gccactggta aaagtaaagg gaaagcaaga     30900
     atttgcctcg caaggataca cttgatttga cggcacccta gcaggaggct atagtggttg     30960
     atagtcagta gatgactgct gtgtgtcttt agttccaact tactaggtta taggcatcgg     31020
     tggaccaatt caaatgagga ttacaccatt gctcagcagg aggtatgata ttcccaaaat     31080
     ccaagggcat attaaaccca atgtccgctg agggcaaata taagctacct ccgggaagag     31140
     ctggcattga cccgcctcct ccccagtagt ggtcttgcat attgagcctc cccgagtttg     31200
     gaaagggatc atgtatcttc ttcactctgg gagcggatga tttgtgaagg acagacattg     31260
     atccatgccg ttgattgaat ctttcgctct ggtggtcttc tcgggcaagt agattctgac     31320
     catggtttga gggtaatatg atcggtgcag gctggttcat actggtagta catatttctt     31380
     gggcttttag gcatctctca caagacatgc cgttcaaatg atcgcgctca caccgcaact     31440
     tttgcccgcg gcaacgatca caagcagacc gtcgagagtg ccgataattg tgcgttgtat     31500
     gcattgtgag gaataaaagg ggaaaaaaaa aaagtagaaa cacgaaacac gaaacaagat     31560
     cccctatggc ggccgacaat tgcagagata gaccatcgat agataggaag ctaccaaggg     31620
     caaatatgta tctcgttctc gctccactga aatccgatgc aatataggaa tcaatttctt     31680
     tcattctcca tcacctcatc gaaacagtct tcagactcga ggaaagatgg ttctattcaa     31740
     aattaaagcg cgtgggttgg tatcaccgcg cctgtatacc tctcccttgg aacatgatcc     31800
     acaacattct tgaacaccct ccatggtgat tcgttggaca ctcccaaact ttccatgccc     31860
     aattctcagg tgtgacaagt tctcaggtca taacaaccta gccctttcac agcatgtgta     31920
     tagacatgcg aacatgcaga cagaagttta agggcatctc catcgcatcc atgaattgaa     31980
     ggctgacccc agagtcctgg tacgaggtgc atcaatattc atggaagatg ttacaccatg     32040
     ctcaaatgag accaatgtat gagcgagcag atctgttgtg atacgataaa ggtgaatatt     32100
     gtctcacatc gcgccgcatc tgaaacttgg actccttttt atggagggcc aagaggttga     32160
     gacagcttca acagcccttg ggcccgagtc gaagagatcg gatgaaatgt tgatggcctg     32220
     cttctgagat caaatagaaa atattacgta catagtctca aacaacaggc catctcacct     32280
     acgatgccca aagtcagccg gttgatcata gatattactc tatactgcct ccgttgtagg     32340
     tattggaggc ggacttgacg tcactgagcc aaatgtctga cctatattca ataattagac     32400
     atagactacc ttaatacggg gtagataact cagatttgga agatcgcagt tcacgttggg     32460
     cccaggccac atcgaagttc ggagaattaa agtcatccta ggagctgaga attttccggc     32520
     atgacagttt gggcccgatg ctttcttttg ctttttttcc cttggatgtc atattttacc     32580
     tccccatcct gaaatccact gattacggag cattctggta ccaactgtcg aggggtggag     32640
     aatgcaaagt aaggggttga aagcccaact aagcccctgg ccagagagcg gctgggttac     32700
     caacactggg aatgtcaatc gattatagaa aggcaaaaga tatatcaagt ataattcaag     32760
     gacagacata tctactttcc tttttggatc tgtcgtgtag aaccccgtgc gttgaccttc     32820
     aggtcaagat gcccatgata tgtatgtatt atctacgttg agaccgtgag ccgcttatat     32880
     cccgggtttg cgcctaatat ccgccaaacc agccccagat gagaaaagcc ctttggaatg     32940
     ttttgggaat ttgggtgaca tctgttataa tcagcaccgc tagtagagtt acttcttcgt     33000
     ggagccccct tataagcaca agcttcattc actaatagag gacaaagtca aaaggccctt     33060
     tatgaggttg cactctgccg agggtgtcca ttgcagtccc tgatcacaac gcgaactccc     33120
     tgacttcctt ttcgcgggag accattgaac atgtctcgca caatttgaac gtcatctact     33180
     gtagtctcgt atagctccat atcaaattcc cggaaaatgg tggcgatggc taaaagaatc     33240
     tccgcccgcg cgaggctggt caacagatgt tagtagacca tgtggactaa aatgaaacaa     33300
     ctgaagaata atcacatacg gaattccgat acactgtctt gatcccttac taaaagcaac     33360
     caggtacttc tcgagctttt ttctctgctc tgggtccatc catcgctccg gaatgaagct     33420
     ttgcgagttt gggaaaatat cttcgttgtg gtgcataaat atgctggtca tccccacagg     33480
     tgtctgatgt actttgtcaa aagaaggcct aggcaaacac aaaaaggggg gtgcagatat     33540
     cgtaccccag gaggaatgac ccagtccttg tatatcatga cttgatctgg gcagcttcgt     33600
     tgaagccgtg ttgccacagc gttggtgatt cttcatgagg gtcaagtaag gaaattgtaa     33660
     agtcgtgcca gggggaggta aaaacagaaa ggctttacat accttaggcc ctccagcatc     33720
     acagatgtct actatattgt cagatgtctt ggtactccat agatctggat tttgcgaatg     33780
     atcaactcac aaggtacggc atggcttcgt actctaccaa acttgcggtt ccatcggggt     33840
     cgagtcggtt gagctcgtcc cgtagccttt gtagtttgtc tgggttgttc agtagatgga     33900
     aggtgagtgt cgtcaaattc ttcgcagttg tttctcctcc ggccgagatg acggtgaaaa     33960
     cctcttgact caagcgatca ggggccttct cctccggggg aagcttgctg tctagcagcg     34020
     catgaaacaa tgtacctttc ggcacattaa ccttatcatc tgcagggttc ccctcggcag     34080
     tttggctatc gatgaccgtt ttcgccagtc gcaaactttc cagtttttgg tcaattaccg     34140
     ggccgatgtg agggttgata ctcacgacta gccaccgtgg aaacagttcg aacaagctga     34200
     acacccagcg aaactgttta aattgaacgc caacttgcac aattgcttcg atcgtctttg     34260
     accactgcgg tgtgaaatca gggtcctcca aataatggaa tgattcaccc atcgaatact     34320
     ccacaaccac gtctgtcgtg tacgcattaa acgcatgata aacatgcagc ggtgtttgtc     34380
     tctccttcca gtctcgcatt cctttgcaca gcttattgat cattttccga agcatgggct     34440
     ccaactgtcg aattcgctgc tgggagaaga atgggttcat aggttgtcga cgtatccgat     34500
     ggcggcggtg atcgactgag ccgaaagccg aggccggtgc cccaaacata ccagtcaaat     34560
     gtaaggattt gttcctcggt ttgtctcgag agtataagat ttcatagtac tctgggtcgt     34620
     cgatgtgcag ttcaaaggga ctaattctca caattgggcc gtatttgcga tgcatctcag     34680
     caattcggaa ggtgtattgg ccttctagga aagaatcgta atagaactca taccacattg     34740
     tcagagcggc cagttttggc ccgggaaaat gggcgagtgg tgagagccat aaccgatatg     34800
     ttgccaacca caccccatag gtcactccga tcaccccgag tgccactatg ggctgtgcgg     34860
     taatggcatt ccaccaatcc atggtccctg gattcaaaga gagaggagaa acacgtcgac     34920
     aaggaaagat gcaaatgctg attttccagt gctccgtccc tttttatttt gggattgttg     34980
     ccccacagac ctgtcaagaa ggacactatc ccactcggct gaaaaatgga taccggacga     35040
     tgattggaat ccatactgtc ggtaacctcg agcgtcgtac ggagtccact tgtggatggg     35100
     gaaagggagc aaagcaagaa tatctggggc gtggaatatc ttctgcaacc tatgacagca     35160
     catccgtgcc aatagaaatg acggatcata tggagggtag gtcatgttgt ctgaataatg     35220
     tgtctagaga ttaggatcat caatttcact ccttctaaga ggttcggatt aatcactttt     35280
     aatccccgtg cccttgcacg gggcctcggt ggaaccttca tggacaaagc gttgaaactg     35340
     aagaatcacg agaataataa ccatagtggc atatactccg tagttccaag actaattttc     35400
     gcctctcgtt cccagttggt acttgacttc gtttcttttg cccttcagag ggaggtagac     35460
     atatacatat gtagaggata gacatgcctg gtgaagttcc agggtctccc attcgggaat     35520
     agccgaggtg tcgggggaaa aaagggcccc cacagacaac gccattgttc aaaagtccct     35580
     gagacatcta tacctgggta ctttagaagg tgtcgagatc attactccgt atgcctagac     35640
     gtaaaggtta gaacacaaca tggccgtaaa atagggaccc ttcggtatcc atttatattg     35700
     tcttatcaca tatgtatgaa gcaactcgta tttccaaggt tgatcctttg aatttggtaa     35760
     gccgtcactc atgcccaggt gcagggtagg gggcgagagg cgctgaaatc gagggaatga     35820
     aatttcagcc cccaccgctt ccatacctgt ctaacaacat taggggcctt tcccccggga     35880
     ttttctgatt tcctcggagt aaaatataga agtctcctgt cactaaatta gagatttaga     35940
     gatgcattaa tgcatactcg ggtattaaaa tgggatgcat agtcgccgag gtccgaatgc     36000
     ggggaaacag cccaatatat atctgtacat ctagactgag ttgcatatac agcaatacat     36060
     gagttattgc taacatgaaa atgaatttcg acttgccagc agatctcaaa actcatttag     36120
     agtctataga ttcatttatc cactcaacta ttctcccact gcagcattcc aatgacaata     36180
     accgcttctt cgaccaccgt cgtgagtatg aacggaccga ctgggaaaac aatgggaatc     36240
     cacgaaagga atgggaagag ctattaggtc cgttgaacaa aaattaagaa cgagcggaac     36300
     tgatactcgg taggtgaggc gcgcactctg gctgattcct cgggtcttta ccgattcgcc     36360
     ctcccccgag tctatggggg ccagtcacat ccggacgtga acttatggat gtccgccatt     36420
     cgctatcact tgtcctcgaa tgctgtgtac ggtggtggtt tggggctggc gaatgattta     36480
     caaaatgagc attgtatcgt tgggaacttc ccggatgttt tgatgctcca tcattttggc     36540
     aatgaacaac aaaggaatac cttgatccct gcacgtctgc gaggggagtt ccggacaaca     36600
     ttcggtctta ctgaacccga ccacgggagt gatgcaacat tcatgtctac taccgcccgt     36660
     ccaactcggg gagggtttga aatcaagggg gcaaagaagt ggcagacagg agcgcatcac     36720
     tgtacccact ttctcatctt tgcgcgtact tctggcaaag ccggatcagc acaaggcatt     36780
     actgcattct tagttccgcg tgacacgaga ggggttcgca tcgtcagtta cgagtggacg     36840
     ctgaacatgc cgaccgacca cgcaacggta gaactgaata gtgtatgggt gcctgaatcg     36900
     gcggttttgg gatcgatcga ccaggggcta gccatcgccc aaacattcgt gcacgagaat     36960
     agaattcgtc aagcagccag ctcctgcggg gctgcacgat actgcctgga ccgaagcatc     37020
     gatcgcgcac gggcgcggaa gatatgggga gaggggaaat cactggctga taatcaggct     37080
     attcaattcc cagtggtcga gttgatgaca caggtggaga tgttgcgact gttcatattg     37140
     aagacaagtt gggagatgga tcgtatcgtg gcggagtgtc agtcgtccaa ggctcagcgc     37200
     gcgccgtggg ttgaaattga gggccgtctc tccgaccagg tggccatgtg taacttctgg     37260
     gcaaatcgat tatgctgtca agctgccgac cgagcgattc aggtaatgtc cacaccggct     37320
     gattgttgcg acatggctga cgggtcagat tcacgggggt gatggatact ctcgccacta     37380
     cccctttgaa cacatatatc gtcatttccg tcggtatcga atcacggaag gtgcggagga     37440
     gattcaaatg cgcaagattg gggcatacat atttggattt gctggcccaa agaagaggga     37500
     gatgaaacat gagcattcta aggcccgaat ctgattctga cccccccgaa gcaggtactt     37560
     tagggaccag gccattctga tagaagtacg aatctgcgtg gatatcttag tcaggttaag     37620
     tgcgtatgtg gtagtactgt atgaaacacg gctttttcag gaatttccat tattttgctt     37680
     acaataacac atcaatttca accttggaac cttccaaggt tgatccgtgg atgtcaactt     37740
     gagagttggg attttccatg ctttatgtgg cctggtattt caggcattag atcgcgtgac     37800
     tattttggcc ttgttgcctg atttctgagt atgcaaactt taaatcttcc gaggttctcc     37860
     cgagatgcag gtttattgtc gatggaagta ctccgtacgt gacctacata taccaggatg     37920
     caaaaatagg tatagtatac atgcaaggtt tagtgtatgc gtatatatgt tctcggagta     37980
     gcattttttt ggagtttttc aaatgtttta ttaagtaact tggagatgtc cattgtactc     38040
     tccatgtagt tgttcacata tcgaacatat gttgaacata cctacatacc taggtaggta     38100
     gctacctatg tacctgcata tatgttaaat aggtacaaca tatgaacttg atagcaaact     38160
     ctccccgtcc ttccctccag ggctccaggg cttccgagtg gtcttaccta aaccatttaa     38220
     gacttttttt actccacatg tctgctcgga accccaccca gtccaagcct ttgcagaaaa     38280
     ttctctttac tctctctgat atcatttgaa tgctgtaacc tcagctcgtc ttattcaatt     38340
     tcaattggag ccgtggtggc cctgccattt ccgaaatggt ctctcccgat gcctccgtcc     38400
     acgatgatac caaaacctct gcaaatgcag tctctgcaga gtcggataat gtctttcaag     38460
     ataccaagga gcctgatgcc gagcagaatc atggtgacac ctccaacaat aaggaactga     38520
     agcgcaagct gaaaagcagg cacctgcaga tgattgcgat tggtaagtct ttggctttct     38580
     ctgatcaaat ttggtaccgg agattctaac acagttctgt cgcaggtgga actatcggca     38640
     caggtatatt ttcttgccct caattctcca gctcgacgaa acccgaaatc taacctccgc     38700
     aggactcttc atttccagcg gcacagccat cgccgaatcc ggtccagctg gcgccttgat     38760
     cgcctatatc ttcgtcggct ccattgtcta ttcggtcatg agctccttgg gcgaagttgc     38820
     aacctacatc ccaatccctg gtgccttcac ctcatatgca gcccggctga tcgacccaag     38880
     cctcggattt tccatgggtt ggatctattg gttcaactgg gcctccacgt ttgctgtcga     38940
     attaaccgcc accggtacca tcatccaata ttgggattct agcctaaata ttgccatttt     39000
     catcggagta ttttgggtgt taatcacggc tatgaacttt ctcccggtca atttctacgg     39060
     tgaagtcgag ttttggttct caactatcaa agtggccact gtcattggct tcatcatttt     39120
     cgccatttgc atcgatgtcg gggtggggca gcagggatac ctgggtttcc gctactggag     39180
     cacgccgggt gcttttgcct catacagtcc cgacttacca gtgtctgtag gcaagttcgt     39240
     cggcttctgg gcggtgctta tccaagccgg attttcctac caaggcacag agcttgtcgg     39300
     tgtggcggct ggagaaaccg aaaacccaca aaagacagtt ccatcggcta tccgcaagac     39360
     atttgttcga attcttctct tctttgtctt gacgatcttc ttcatcgggc tggtggtccc     39420
     ctataccaac aaccgcctca ccactgcgga gaccaacgca tcgtcctcgc ctatggttat     39480
     cgccgccgat ttggccggag ttaaggtcct tccaagcttg atcaatgctg tgctcttgtc     39540
     cgtggtctta tcagctgcaa actccaatgt gtatagcggc agtcgagtcc tgactggatt     39600
     ggcacatgaa ggattcgccc cggcctgttt cggttgggtg accaagcacg gtgttcccta     39660
     tgtcagtgtc acattcaccg ctctgtttgg tttgttgggt ttcatgaacg tttccaatga     39720
     cgccggacaa gtctttactt ggctcgtgaa cctttctagt gttgcgggct ttgtgacctg     39780
     ggcctcgatc aatgcgtgcc acatcgcgtt catgcgtgta ttggccaacc gcggcatttc     39840
     tcgtgacacc cttccataca aggccatctt gcaaccatat ctcgcttggt acggcctctt     39900
     cttcaacatt ctgatcgccc tcacccaggg tttcacttct ttcatccctc atttccgagt     39960
     gaccgacttc ttcgttgcct acatctgccc catcgttttc gtagtgctct acctcgggca     40020
     caagataatt ttccgtccgt catttatccg tgccgccgat gccgatattg acacgggtcg     40080
     cttgcactac gaaaaggaag tcgatgcccc caagccatgg tactcgaggg tctggggctg     40140
     ggtcgccaag taatacggca cagttatcaa tgttcgataa cttgtatatg tgatttgttt     40200
     agcgcgaggt gtctgcacac ctgggcatgg ttgctgccat ccatggatgt tcacagtacc     40260
     cttatgtaac atcatttttt tatatatata tcaagccatt ctagaaatca tgcatttttt     40320
     atcctttttc tcctcttttg aatgatcatt taagacaggt gtcctcagtt ttcacggaac     40380
     atcccttaat cacaacatca tcggctcaca ggccatggtt gtacctaggt atgtcgccac     40440
     aactttttat atccacttta aataccgggc cataacagag aagccaccga tcaatgcagt     40500
     tgcaccggtg caaacgacta gtgtcccgta tccagttcca tatgcaccca acgcatggcc     40560
     tcgccagttg tctgccttga gcagagcctc acttagggga ccacttgcca cattgcctat     40620
     tccgcgccct gtttccatga atgggaaaat gacagtggca tctgccaatg gattggcctt     40680
     ctggacctcg tgggagaccc ccgcccatgt ggaggagaac ccacccgcga gcagaccata     40740
     ggcaatacaa aagacatata aaggggggat agtggcagcg aaaccccaaa caaaaaagac     40800
     cgagataacg gtaccgacag tcgacatcag gatgcaggtg gtgatgtgat atcggtcgga     40860
     aaggaatccc atgatgacag atccaaagac tgtgaacaaa ttgacgagga ttactgtgag     40920
     agacgccatg tagtcgctcg cgcctaggct gcgcgcgtat gtcggaaggt agatggtcgg     40980
     caggaagaat ccgattgctt ccagagtgtt gcccagctgg taaattatga agactttgtt     41040
     gtacaagaaa cgaaaattca gacggtgata cgcgatttct gtcgtatgca gcctcggtcg     41100
     atgaaagtag agaaaaggca cagcaagaat gaacaatgcc actgatgata tttgaagcgt     41160
     ggcttcaata ccatactggt tcaaaagcca ctggatggca agtgggaaga ttatcccgga     41220
     cagcccggat ccgccctaat gataattatc agttcggctt gtcataatga gtctgtagtg     41280
     tagaggattc tttataactc acccagacaa taccaaaggc aagccctttt cgtttctcga     41340
     accactccga catgaatagg atggtgggag tgtaggcaaa acatccgcca attccaaagc     41400
     caattccttg cgacaaaata agatgcatga cgttggtgga aaaggaactc agtgccaaag     41460
     acaaacacat gataacgacg cctatggtag acacccagcg agcaatttta ggcactaaaa     41520
     tcatcaaaac gattgccaac ggggcaatca ggtatgcgag accctttatg ttgtgttagc     41580
     gagagcaggg cgaccttgga tttcctgact aaccatcgca caagtaccga taactgcaat     41640
     gttttcagat ccttcaaaag gcttgtgtgt actataatag tcttgaaata taccgaaggc     41700
     gaaggcataa cctgctcgca tgttaggctc aacaacaatc tttgactgaa gaaccaatga     41760
     ccacgtaccc caaactagag cttcgagcat tgcagaagcc ataaggaaca accatgcttg     41820
     aactcctcca tcgaccggcg gcaacttctc atcgtctaga atgattctgc tgtcggactc     41880
     ttggtcgaat ggtatgaagg atgtactgcg gctggtgaaa ctgggaggat actccttagg     41940
     ctccatggtg caaaatacct cacgactgtg accacaggtg tgagggctat atggaagtac     42000
     aacaggtttg cgagcggaag ccacggggag accctccttt gaaaaaggtt tatgttcaat     42060
     gcggtcgttt gaaaaagaaa ggcaggattg gcctgggaaa aggaaataag ctaatggaag     42120
     ctaggcgcat gatgaaataa atctccttga caaggcaagg atccatccaa tcggcgtacc     42180
     aggaagatag ggcaaaagca catacctgga atccaggtag gccggggtcc cagcaatgtg     42240
     atgttgaacc cctacatgtc tgatatggtc agtttcataa gtcacgccca aacagaccgt     42300
     actgctgtga ttcctcagtt tcctaagcct tcatctaatg ctagacaccc tcaaccaggt     42360
     gtttcttctc tgtcgttctt cactggttgt cgacacatta agaagagcgt tgcgatctgc     42420
     tgcaactcga ggtcgccgat cgggtgcggg atctgccccg gaaataatcc gagagtcatg     42480
     acaatggcct ttaggcttga ctcgctgtgt acgtgcacga accgccccgc tctgcagata     42540
     aaacgggaaa tggaatgttg atcgggaaca ctgcatagca gagttggtgg gctcggagaa     42600
     ttccatgtcg ataacaggtg tccgactcgc cgtcattggc agggataaga accacaggag     42660
     agtcagcttt ccctgatgga tgaagcttcg tggctgggta gatccaatca ggatacaggg     42720
     tgtcatgtat ggacgcaatt tagcagtctt tgcaggcatc aagctcgtcc gatgctaccg     42780
     agtgacataa ctgtcagaat agcatgtctt tgataagata tgatcggtgg atgggacaat     42840
     atgcagtata cagtgtcatg cctcttcaaa cgatgtgcgg agagagattt agcaacattc     42900
     cagccaacag aattaaccca agtttattca tcaagctaga caggatgatc tcctgccgtt     42960
     acgtgttggg aatccactct atcatagtcg aggaagttca tgttcgtcaa tctttgacaa     43020
     accggatctt gtgataacct gaggttatga ggttatggtc atcgagcgtt ttgtctcggt     43080
     actttgttga ttcgggaaac cggttcaaac atgtttttca tgttcataga ggctccgtat     43140
     ctgccttgtc ataccttggc tggtcagatt cacattttat agatgatgtg agaggttatg     43200
     cacctgccca ggtgagcagg tggacgagat cttgaggttt gtttatgtaa tcgggtgatt     43260
     ccgggaaggt gccaggggca cgggtggccc cgggatgtcc tgctctcagc ccagtatcaa     43320
     gtccaagtta cttactctat gttagttaac gacttttctg aaatatctta agttgtagaa     43380
     gagtgggtgc gtcatttcac caatatattc gtgaccaagt gtgggtatta tattttcatt     43440
     atcattatca ttgaatccaa ttgagctagg agttccggac tgcgactatt caagagattt     43500
     gggatctaaa agtccgccgc gtccggcaac ttctctggag tatcacttcg gaagctgttc     43560
     gtgaccaggt tcccgaagga aggcgaccag tccacgcgcg gggatagact atctagtccc     43620
     cagagctcag aaacgaattt gaggatcgaa gtatgcgtga actcattccc atcgctaggc     43680
     ttatgctgga ccaagccttt ggagacccag ggagagatca acactgtagg aacacggatt     43740
     cccaggcgat caaagtggaa agtgtatggc tcaccgtccc gagcggtctc cgtataggtc     43800
     aggctgtcgc cagcaggaac atcagttggg ggcgaaacgt gatcagcgaa gccaccatgt     43860
     tcatcccagg tcagaatgaa gagggtctca ttccactgcg gcgagttgcg tacagcctcg     43920
     tagatgctct tgacgaagtt ctcgcccata ttgattgggg acggaggatg cattgacata     43980
     aaggagcagc actcggggtt gatccaagtg aattgtggca acgccccagc tttggcatca     44040
     ctatagaact gggaaatcgg aacgacgttc tctttgccat tcttagcggt ccattcatag     44100
     aacatagcat cgggcaagaa tgagggtttt gactgggtcg agttctcata gttcttccaa     44160
     gtgattccct tctctgatag ctgctcgaaa attgattttt gtggcagcgc agagttgagg     44220
     aaatcatcgt cattgtggcc atggccatgc gaagtgccag aggtcaagta ggcacggttg     44280
     gggttggtag gaccggggac agcagcaaac caccgatcga acaagacaaa gttctgagcg     44340
     atggtgtcga agacggggat atgctctggg gtgaagtaat tgatcgcctc ggctgcccgg     44400
     tctaggtcat cctttgggta cgaggcacgc tgctcactaa tgaaaccctc catggtggac     44460
     ttggctcctg caagggggtg gtaggtccca aacacctgca tgttaccacc ggcgatgctg     44520
     tggttgggat cgtccgatgc gatgttcttc gcatctgggt tggcgcagac ctgctcggag     44580
     ggggaggaaa cattggcagg attacagtat tgaggattct gcgggccatc aatgctagaa     44640
     tcatagtcaa gaccgccagc gaagtggtcg aaggacaaat tctcctggac taacaccaca     44700
     atatttttga tgttgctcat acccgacgca gcgggcatcg ccgcggcacc cagacttagg     44760
     gcaacgagga gtagagagcg cgccatattg atgaaaatag aaagctgggt atgacttgag     44820
     cgagtctacg agtttataac ttttttccca tttcatttta ttcctatatt tccttttctt     44880
     taaacctctc agaaactcct ttcatcgcac atgctgcagg tcacaattct gcgcggtctg     44940
     cttctctgtc gatcaaaaaa gccctaaatg gcccccccgc gtcgtgggcc gtgagctgac     45000
     tattattggc caacacgttt aacagaagat cagatgttct gatgttctga ttttctagtt     45060
     tttgtgactt ttagcactct taggggaaac actagaaact tccaaggttg ttcatgatag     45120
     tatatttcat tatttttcca gtgacatcct aacatttact tggaattccc ttgttttcgc     45180
     tctatccgaa atcctaaaat gttatcgtca ccgtttattc gctgtatgca ttttgttcgg     45240
     aattattact cgattgcata actacctatg ttgtataatg ttgtagatca gtcgatctta     45300
     tgactgttat acttcctttt gcatagtcgc ttcatgacca gtcgcactgt accgctttcc     45360
     cttgcccacg cgaaaaggtc acatctctgg atcatctcta ggttatcttt tattttttaa     45420
     ttgagctaag ttgaggggta aagtcagcag gaaggtatga agttcaaacg gtcggacggt     45480
     cggggtcacc tggtaaatat cagatcgaaa ggccaacaga acttgaacgt agaaaatggg     45540
     aaaaaaaaaa aaaaaagaaa gaaatgttct gtataaacaa tgaacactat atcccccaac     45600
     cttagcttga cttacctctc cccttgttgg ttcgtttacc gttaaaaagg agttatgggg     45660
     aatgtatata tcatcgaatc ccagagcaag aaataagtga gaatttgtac aaatctaaag     45720
     taaatataaa atttcaatcc catacccggc gcatccctat cagacctcat gctcacaggt     45780
     caacaaattc gccacggagc agctcgtctt cctggacccg ttccagatag ctcgctacct     45840
     tggttgtcaa tgtagcaatc tcatatccga agaacttgta tgccgcctta cccggtagac     45900
     tttgaccaaa gcgtgtcacg ctgatgcccg catctgcgta ccgttcccag ccattaggcg     45960
     cgtagggctc aatcactaca gctggtatgc cccggtggcg ctgcagcgtg gcacgcttgt     46020
     aatcgagtga ctgtttctca aacaggcgct ggcaggggaa gctgaccacg cgcgcggtga     46080
     tatctttctg cacctttagt tgcttagcaa cctccaatgc gaatgaaagt tcagctccaa     46140
     ccccgatcaa agtcacagca gccgattcag cttcagatag gacgtatgcg ccaagggcta     46200
     caccatcacg acgcgtctgg gcgagttggg gcaaagcctg ccgagaggta gaaatgatac     46260
     ttggggtctg cttggcacca atcgcagcaa tccatgcacc agccgtctcc tcgctatcac     46320
     caggacggat gtataggagg tttggcatcg cgcgatacag gttggccagt tcaataggct     46380
     ggtgggtcgg tccatcctcg cccataccaa tggagtcgtg agtggcgacg tggatgattt     46440
     gaaggtgctg caacgcaccc attcggactg cgggtgcagc atacaggtag aacataaaga     46500
     acgtcgacgt gaccggaatg atggtgttcg gggagtaagc tgccagaccg ttggagatgg     46560
     cagccatggc atgctcacgg acaccataat gaatatagcg accagagtaa ttgccattga     46620
     taccacacgt tgtgcggagt tcgggctagt gatatagtta gcatgtccct agttattgta     46680
     ctatcagttg ttctaactca catgctggaa gtcgaccttg ccaggccaga tcatgtttac     46740
     ggatggcgag agatccgcag taccaaccat gaaggaattg atgtctttgg cgattgggtt     46800
     gaacactaag ccagatgagg cacgggtggc agtgggttta tcagggaagg cggttgggat     46860
     gtgctcctcc cagtcgggtg gaagctcgcc acgcacgcgg gccttgaact cggccgctaa     46920
     atctgggtgc tggacagcgt agtcgtttac cagctgatcc cactcttgaa cccactgctc     46980
     tccacgctca ggaatcccct ggaagaactg gcgcacagat tcgccaatga caaaatgctc     47040
     ctccgggttg aagccgtagg cagtcttcat atcacggata ctctgggcgc caaaagcagc     47100
     gccatgagca acagcagttc ccgcaacgct gctgtgcaga ccaatgaccg tcttgatatt     47160
     aatgaaggtg ggtttttcct tcgatgagcg agcttgctcc aatgcactaa caatggcctc     47220
     aatatcaaag cagccgtctg ccacctcgat cacatcccag ccacaagcgc gcatctttgc     47280
     gttcacatcc tcggtgttgg taaggtcaac tgatccgtca caagtgatct ggttgttgtc     47340
     gtagatgacg gtgaggttgt ttagacggaa atgtccggcc agtgagatcg cctcgagacc     47400
     aacaccctct tgcaaacaag catcgccaat catacaccaa gtatggttgt ctaccacatt     47460
     aaatcccggg cggttgtagg tcgcagcgag attcttcgtc gccatggcca agcctacagc     47520
     attcgcaata ccctgaccca atggtccggt tgtcacttca attccctcgt gctcaatctc     47580
     cggatgtccg gggcataacg catcgacacg atcggagtgg tatgatttga gttgttcgaa     47640
     ggtcatggcc ttgtagcctg taagatgcag aaaagagtat tggaagaggc aagtgtggcc     47700
     tgtagaaggt tattttcagc atacatccct agagatatac aaatttagaa atatatatgc     47760
     agaactaacc gtttgacaag acgaagcgat ccctgttgaa gaatcccgga gtgtggggtg     47820
     cataacgcat aacatatctc caaagcgcta caccaatcgc agccataccg atagcaccac     47880
     tggcacacga tcagcttgtg ctcaaattaa gattcagttg cgaggaacat acccggggtg     47940
     tccgccattg aattgctggc agagatctgc aatcaataac cgaaaggtct tcaataccaa     48000
     gtcatggtcc ttggacagct tgtggactag aggcattgca gagctgtgga cgccattgac     48060
     gccgttctgt tgaacttcga ctgacattgt agaaaccata tagagatgag caataaagaa     48120
     tgtccaaatg cccaaagctg gacggaaagc tcattgaaat attgtaagtg gtgatgctta     48180
     atatttccta atcgggcgat cttccccaaa gggtcgaccc ccacctccgc gagttggcaa     48240
     ctccatccac accaaaatag gtaatttgag ccacaactta ctagatcaag tacttattgg     48300
     gctcccacat cggctttaaa gaatggaact tgcccacttt tgtactgcac agaaaacaca     48360
     caatggctcc ggtacttctc gatcagccaa acggccagca ggtggtgaaa acggcaggcg     48420
     atcgggttcc cctcaaagtc tcccatccca atccctcatt gcagataacg gccgaccaca     48480
     agttgaaatc tgtcaacacg cctgtttacg cccccaaacc aggcgaggca ctggttcata     48540
     tcaaagcaac tggaatttgc gggtcggatc ttcatttctg gaagaccggg cgcattggat     48600
     cattggtgtt tgaaggtgac tgcaccattg gccatgaagc ctcgggtatc gttctgcaat     48660
     gcggcgaagg ggtcaaccat ttgaagccag gtagacatga ttcatttgag tttggagttt     48720
     ttgagctgat actttgatag gtgaccgagt ggccgtcgaa cctggtgttc cctgcgaaca     48780
     ctgtttcctc tgtgatgagg gccgttataa cctgtgcgac gatgtccagt ttgccggtgt     48840
     ttacccttat gaaggtacca tgcagcgtta caagaaccac cctgcgaaat ggctgcataa     48900
     gctacccgac aatgtcactt tcgctgaagg cgcacttctc gagcctcttt cggtggtgat     48960
     gcacggcgtc aagtcggctg gtctttcgtt gggccgcggt gtagttgtat gcggtgcagg     49020
     cccaattggt ttaatcgcct tagctgcagc acgtgcctcg ggcgcacacc ctatcgtggt     49080
     gacggatctc gaaccggctc gactggcgtt tgcgaaagaa tttgtccctt cctgcattac     49140
     ctatgaggtg gaccgtacaa aggattcgca aggtaatgca gaggccattc gtgctctctt     49200
     cgggtctggc gaatattttg ctccggagac catacttgag tgtaccggtg tggaaagcag     49260
     tgtatgcact gctgcataca ctgcacggcg gggaggcacc gtcatggtga ttggtgtagg     49320
     aaaggcgatc atgaacaact taccttttat gcatatttct ctcgccgagg tcagttgcat     49380
     tagtgtcctg atggagtgaa tattgaatat ctttggctga ctctgctaga ttgatctccg     49440
     attcatcaac cgttaccgtg acacctggcc gccagcagtc gcctgcctaa gtggtggcat     49500
     cttggacctg aagaaacttg tatcgcatcg tttccctctt gaaaaggccc aagatgcgct     49560
     ccacctttgc gctgatactc gaaatggtag catcaaggtg ttggttgtcg atgagcagga     49620
     tgtttcgtta tagatgtggt aaggaaaatt tgttttcgat tgttgcgagg ctgagcactg     49680
     ctggagtctt tgctctatcg agccaatctt gtttagttcc gtgtaaacta ggagagtgga     49740
     aaagcgaagt aaacaatatt cagcaatgca aatgcttgat ttgatactat ataccaattc     49800
     aagccagaca caatgcctgc acaactctca acccccactt tgacccttgt attccctcaa     49860
     aatgatgact ggcaaaatat ggactcgatg gccggaattg gatccttgga agagtgctcg     49920
     ccaggactca agaatgtgtt gtgtccggtg cattcagggc cgctgtacta cagttagtga     49980
     gagtccactg gctggattgg cattagactt acgtgaagag acgacatggc tttttcaaag     50040
     acacagtaag gacgtcccta tgacgcgtta gtctcagcca aaacatggtg gctagaaacc     50100
     aatctcactc ttcctcgatg ggatggcaat cattcaatgg cacatcgata ccacggctct     50160
     tttctgctgt ttcgataccc acctgcatgg ccatgttagc aataaggcgt ggacctgagg     50220
     acgaagatcc gcacaattgt tctttttggg tccttcgctg ccgatacaga gagaagcatc     50280
     aagcttagaa gcgacaactg cttgagaccg tacatgacgc agatacaagc acagatatct     50340
     gaaggtatgg gatgctcgac agtgttcaga gtactccata tggtgtagca ggtcgaccct     50400
     tcctgcaagg agatgccatc tgtcttttct ctatcccttg cgtctgtctc ctctgcaagg     50460
     gccaggggtt acagttaaca gcactgaaag ctcacccctt cttttgcagt aatcttctcc     50520
     ctgcacacgt gcggagtact ccatagcgag gatcaggatg taactgctga tttgagctgt     50580
     atggagtgca tcttatgttg tgttcgaggt gcaatgtcga tcgatgggca ctgttgaaca     50640
     tcagggattc tgaattccat actccgtgct tcgtcgatat cgagagaaga tagagcaaac     50700
     catgcaacta acatagttaa ctgaaaaaag ctcaaaaaac gtccgaagtg gccgagtgtc     50760
     aaagaagtga aagtggcgat gtctcccgaa ccccaatctc cccacttcaa ctttgcaact     50820
     tccaactctt ttggatattc tttgcatttt ctcgatcaca tatttacagt tcaacataga     50880
     ctccatggtt ccgtaattgg atcacaaccc cggtgaactg ggaaagccat cgcgtgtctc     50940
     caattacgcc atgaacgact ggtcccaacc cgaagcgact ccgtccaatt ccaccgatgc     51000
     tgcatttgcg tctccattgg gagctaacag ctggggtgat ggattctccc atgatccagg     51060
     cttcttagct tcccaggagg agctacgatg catgcttttc aatctcgctc agtctgcagc     51120
     cccgacccgc gcgccgagcc cagataccca ggaacaagac ggcacacaat tgcgcgacag     51180
     ggggcagaca tcaacgcgtc ctgtgctgtc aaatccccgt cgcatcgagt acttgaagaa     51240
     ctatgtcggg caggtggcac catgggtaag tggcattgct ggtggtattc tcaatgatcg     51300
     ctgatggccg accgcagctc gatatgttcg attcgcaatg tacctttcga gtgcagattc     51360
     ctgcgctggc ccgatcattc cctgccctgc tgaatgccat cctcgcgata tccgcccgac     51420
     aaatggaaag gaaggaggga attcaagact catttgacag cttggagctt taccaggaag     51480
     ccattcgcct gctgagccca ctgctgcaaa tgcgtgaccc taaagttgtg gccgcctgcg     51540
     tacttctctg ctgtctcgag atgatgtctg cgcgtgcgca ggattggcac cgtcatctgg     51600
     aggggtgtgc agcacttttt gacgctttcc aaatgaatgg gttcagtgag ggccttctac     51660
     aagcagtatt ttggtgctac gcgcgcatgg gtgaggatcc atattggagg tcgaatgaaa     51720
     gggatatcac tgatttggaa taactagacc tatgtggtgc gttgatctct gatgggacac     51780
     agagcactct tcttcggcct agcaaatggc tcgcacctgg atgtcatgaa gatgatgctg     51840
     cgcagctctt caaggctgcg cagtccccgg acatgcacgc caactacgcg gtatacctgt     51900
     gtgcgagatc ctgcgagctg gtggctgatc gtactcagtt tgtggagcta gccgttcaga     51960
     atgactgcgc cggggaggcc ttcaatcgcc gttggctgcg gctctggggc gatttgcaga     52020
     attggcttga caaccgacca ccggagctat taccaatcaa cacgacaaca accaaaccat     52080
     tccccaatat ccttttccta caatgggcgg ctatatcctc gaaccaacta taccacacgg     52140
     catgcatttt gctgctcaac ttgatgccca aatctatcaa actacagcca acacccgcaa     52200
     tctctgcatt atggcatgcg aggcgtattt gtggaatttc gctcgccaac ccacaccacg     52260
     gatgcttgaa caacgccatc cagccgctat ggattgccgg acggctgttc agccatgtat     52320
     ctgaacacag gattatagtc gaactgattc gccatatcga agccgagact ggttggggcg     52380
     cttgttggcg catccgcgac ttggaactag cctgggggta tcaggtctca cgcccagacc     52440
     ggactatgga taggcctcgg tttcccgtaa cagggtgagc atcggtatca acttgaatga     52500
     tcttccttta ctatgtctcg tcaagaaggc accactcgac tcgcagacta tgcaagcagt     52560
     tttttacgtc ccatcctgtc acagtatgaa tgcgttctaa cccacgcaca acctcgtgtt     52620
     gttgtgactc atgtgtcatc cggcgagctg ccagcagaaa ggatgccaat agacatggat     52680
     cccagcactc ccgacgatca ttgtggagag caatactgca tatccgctgc gtgtgccaca     52740
     gcggtgacat ggcaacggag cggaagtcgg tgatgcgtgc agtgcgaggt cgattgtgta     52800
     acaagatcaa catggccgta tggtatagct ggttgccgaa caagctcgct ccgttggcaa     52860
     agagaataac ggggaaactt ctttctggcc cagctaactg atcatccatc tctatttcca     52920
     gcatgggctc aaactcccgt ggtcgctctc gataccattg ttgcaattcc tcgaccaact     52980
     gcacccatat acggaatgga ggtcgatcgg gaggaacctc ttcattgtgc acaaattgga     53040
     tcgctctcgc gcatagccat agcgggcgat aggcgtagaa gaaaaccatc tcaaacgggt     53100
     cagccacgag atctacttgt gtgaaatacg gaaatgacgg gggaagctgc atgcgcatat     53160
     cgctatcggt cgctaacgct gtcgcgagat ctgtggtgcg cgaacaagtc agtgaatagt     53220
     gatcgaaact acctatgttg ttttagaatt cataccaagc ctgaaaaaga gccaatagat     53280
     cgcggaattg atatctctgc ccaccgcgtg ggaacttaga gcccccatga ggtcatgatc     53340
     gcactgtctt tcagggttcc acgtggtttt gatatccgag atacaatatt tcacctgatt     53400
     tataactttc aacagtgcga cacgtgtaat gtcaacctgc atatccgagt cggcgtgccg     53460
     aaggaatgac ttgcacctgt cttcgggtgg cttatgtgga tcaagctggc ggaaagaagt     53520
     ctcggatagg tcaaggatgg agttccagat aggtgacgag accattgcaa gctgaagacc     53580
     ctggattcca aatgattgac caagatcaca aatgtccaac tactgcagtc agcgtggtgc     53640
     agtccgtggt ggtttcaaat agctcaccca agaggctacc tcatagcgat aatgtcgtag     53700
     caaggcttgt gtttcggtgg gcgaaagtgt ctcgagactt gactcgggtg gttgttgtat     53760
     agtttgcggg ctgaaggtta attgatgcga aacatttgat ggtatcgttg gagtctccaa     53820
     agtggctctc gctggagatg gaactaccaa gttcgacagc cccagatcgg gaccgttcat     53880
     accgagagcc aacaatccgg cgactgccga ttcatcatta tcattgagga tcgtgtaatt     53940
     ctgttcggcc acggcatggg gggcgggctc tgaccagaat ggctcatctt catctctggc     54000
     gtcgctaaac gtgatggggt cggcttgttg tggttgtgga gtcgtatcaa tccgagaaaa     54060
     tgcttcttcc agtggatgat cctcggttcg gttgaaatct tctgtgtccg cgttctcttc     54120
     ggtgacaaac tatatatata tggattaggt ctctaccctg cgattatcac cggaaaccct     54180
     acccgaatag cttcatagct ggtagatggt gtctcggtat ctgacgcttg aatagtgcgt     54240
     gcattcttcg tcaaaaaggt caattgtgga ccatattggc attggaagtt ccggtcaatg     54300
     cagttccgac accacggttt gccttcatcg cctgaataaa tattagactt gaatgttcta     54360
     gatccagaaa aagaacatac attttcgcct acggacgcga cagcgcatgc atcctgtgcg     54420
     acatctggtc agtcgagttt ctctttgacg cttcatggca ggatcctaga ggctacagtg     54480
     ctgtgagacg ggagcttgcg ggattccaat cgggaaggtg ccgagccaga ttaggaaggc     54540
     gcaagcacca tcagctgacc atcacatgac ttaatttgtc atcctgttta cgtcagggga     54600
     ttcaccgggc cggtacggag ttaaaagctg acattcaaca attatatcaa gtgacagatc     54660
     gggaaattat tagattgagg tagtcaaaac ctggtgcaac tacggcttct tctccgccaa     54720
     acttcgactc ttcttccact cgtccacaat tccagcatag accgaagggg catacacccc     54780
     ggtcagctca gtgtagtacc cgcccccgag tcgatgtgga ttcagaccca aatcgcgcaa     54840
     gagcatatca ttgtactaat gcagtagtta gtttgcgata tcctcgtact tccgcgcaac     54900
     aaccatacct gaatcgcctc tacttcaagg ccagttcctg tcaatgagcc caggaccaca     54960
     tcctcggaga tagtattctc catagcctcc agcgaaagat tttcgagcga gagggcctgg     55020
     tgtggggttg actgaatgtc cacggtggag tcgagcccct ctgtcaaaaa tgccgccacc     55080
     caaagagctt gaacctctgc aacaacagca atagtggagg ataaaataac accgagggtt     55140
     gcaaaggagc ggtcgccttg tgcgactaat tcaggtgcaa ccatacggcg gaaaaggcga     55200
     tatggtacca gcgtgtgaga ttcggcccat gagggaggac tccgatctgg aagagcgcat     55260
     ctcgtcgcat tcaaagtctt cctgaccatg acctcggaac gtcgatctag atcttcccag     55320
     tgttggatgc ggtcatttat ggctgagccg agtggtccat tgattctctc cgctgtttcc     55380
     gctgcaattt gccaattctc gtggatattg ccccccgagt ccaccagggc tgacagaccc     55440
     agttctagac ggagacttgc aggttcaaat cgaatcggga ctattggctt atatccggtc     55500
     gcgtggatga ccagatcaat ctcatgaata taactactgt ctgctaagtg aacagcagct     55560
     tttgtggatg tatccgtggt tttccccctg acagtgtcga tatccgtgat cgctgatcgg     55620
     tacacataga catggggtaa tctaattgtt tcccagagat ccccttggtt tgcgatgcca     55680
     ataccggatg cacacgagac aacactggag atcatcagtc acagaatatt ccaagtgata     55740
     tctcattgaa cttacctgtt ctctgggcga agcttttcca ttttcggatc agaaccgtat     55800
     tgtgccgctt cctccaagct tctatcaatt gatcgccaaa gccaacgaac ccaccatcga     55860
     cctagtggat tgccatggaa tagccgcgct agccatgagc cctcccagtg aagacccccg     55920
     gagggtccaa gagacagacg tcttggagtc ttgtagcagc acggggtgag atgggtgagg     55980
     agtctgctgc tggcagcctt atcgcttgcg acggtgttgc catttgggag agtagacatt     56040
     ggcggtacca tccatgcggg ccctgcacct cgatcacgga tgatccaatg tacttggacg     56100
     ggactttcct gtgtggactt gagatgcagc tttgagtcgt tgcggtgtag agtcgcaaag     56160
     aaatgcacca gatcaaatga tgattttgca ccaccataaa tagcaactga tcgcagctgt     56220
     ggatcaggag aatctttcgg tgggatgcta acaacttcgg agtcgggtgc tttcagtggc     56280
     tgatatccaa ggtgttctct tgcccattct ccaacatctt tggcatggat gactggagct     56340
     gggttattgg agcccactga tggccccttc gtgtcgggca tatttggtac cgaggtcagt     56400
     cctgtagcca ggaccaactt gtcgcagata atggtgatgc gccggcccgg ggacgttgat     56460
     acacggatgt tgagcttcca ctctttggtt tctagacggc tgatgtcgtc gacctagaga     56520
     tcactcagaa ataccacaat tggtagaatg gactgagagc agcttaccgt ccagttcaat     56580
     cgtatgtgct tcttgagctg ccatttctcg acccatgcat ggagataccg gttgatcttc     56640
     cagcctgcaa tgaactgatt ttgtgtgtca cttgcatgtt cctctggaac aacgtcggaa     56700
     agaggcagat cactgaactc ataaagtcca tatgagttct ggctcaacaa atttgggtaa     56760
     agacgctcct cggcccaagt acccccaata tccgaggcag agtcgatcac gagaaggcga     56820
     ctttcggatg gggtcgttgg ggaagcatcg atgttctcag taaaacaggc agggatttcg     56880
     gcgactttat ctgtgctttt ggctgtactt tcgtaagtcc cgacaagttg tagatatgtc     56940
     tttgctgcga tgagaccgta aagacctaac gaattagcca acattcaatt tggtcgtcaa     57000
     ctgctaccaa ccggctccga cgatcacaac tcgttccatg gctaaaatga ttgcaaaggg     57060
     agaagaaagg ggggggaaaa tagacggagt ttttaatgca aaagtgtaca atgaaaagac     57120
     aacaatacga agaatagctc gaggatcctg atattgttcg tgtggggggt caccacaaca     57180
     atgggaatcc cattcgaaaa tacaattttg acatattttg acatattttg acatatgggg     57240
     taatgtagac atgttaggga caatctgtaa tagaatatag tcttggacat atttgtgaag     57300
     gtatggacca cttaaacaga gggataatgt caacagcatg attttgtcga gattgggcag     57360
     catgtacttg taatctagat gtccacaggt ttggatacaa cataaaataa aagggaataa     57420
     aaggcattaa ccccaagaag aggctaggaa ctcttgagcc tgttctaaag ttctccaaaa     57480
     cctcaagatg taatctacac cgccaggacc tcacaagtgt gataactcac ggcccatatt     57540
     gttatcagcc tgcaaactcc agagcttact tcagtcgcta tctcgtggct gtttcatatc     57600
     ggtttctcca tcccaacaac taccccatat ggatatgtgt gtgtgtgttt gtgatcttgc     57660
     cagccacact gatcaaatcg gtgccaccag gttgttccat caaccgtcct cgtccgtgtt     57720
     attatcacat atctcatatc cgccctctac gacccttctg tgcgagcacg cagaccggtc     57780
     attgtagttt catattgaac aattacatga gctatagtcc cctaatgacc gtctcgtggc     57840
     ccgtcgttga gcgcctctta cgggagtctg atcgtgtttg atgcatggct agttcgattt     57900
     catccaaact caacatttac tatccatata gaattgtatt caattatact gatttcgaag     57960
     actatagttg gaaaccatcg acctgtcaat cccacgtagc cccctttgga caacctttat     58020
     cgatgtatat tcctactagt attacacaaa tacggctgcg aatgacacgc ttttattcta     58080
     tatctgaact gcttccgtat atccacatca tatcgcgagt tcccgaatct gtctaaccag     58140
     atcgatcaca gtctccttga agggccgata tttcaccccc aactcccgag atacagtctc     58200
     cccatcaatc ccataagagg cactcggctt ctcacccgtc ttataattcc tagttacagt     58260
     ctctttggcc cagttgaatt catcgcgaat gatatccgca gcatattcgt acgaaaacgg     58320
     ctccggagaa gcggccacaa atctcttgcc accagcttcg ggtgtaagca acgcctgaac     58380
     atgcacctcg gcaaggtcgc gagcatcaat ccaaccgggc actcgcgtca ccggaagtgg     58440
     atctacaccc gcggccacac cccagagcat catatttgac tcgttgagct gctgcaccgt     58500
     cggcacaggg tgcactaccg gaccaaaaac cataggagga cagagagtga ccaggtcgaa     58560
     tttggttttc tcttccttaa caaactccca tgctgcgagc tcggcgaact tcttagagcc     58620
     gcggtatgcg gtgacagagt ctgacttcag atcgattgcc tcctcgtatg tcaacggatt     58680
     ccagttcgca gcggtatacg tgaatccagg tgctggagtg ctgctcgggt cgactactga     58740
     tgcgaaggag gatgtcatca caaggcgctg aacctttgat cctggcttgg cggaggcaga     58800
     aagaatcgac ttcactccgt tgatagcggg caaaatcaat tcctgttcgt tgttggtggt     58860
     gtcgtagaag aatggctgtg aaatttatta gccctttgtg ttcaccataa ccaaggtgat     58920
     tttgaatggc ctacgctcgc tacatggatc actgcgtcaa tgctatccat tacagaatcg     58980
     aaaaccccaa tctgggtgaa gtcttccacg acgacaaaat caagcttcga agcgtactgc     59040
     ggacgtgcag ccttcatctg atctcccttt tgctttgatc ttgtcgagcc tcggactgag     59100
     aatccgcgag ccagtagatt atccacaaca tgggcgccga tgaaccccgt ggcgccagtg     59160
     acgaggacgt acctgcggtc gtcagcactg accgggtacg tgggaataga ttaacttacg     59220
     agggctgttg agaaggcatt ttatcaggcg taggaatata tagttagaag gaagaaggtt     59280
     ggatcgggct tattatagtc gtgtgtaccc cgcgtggggg gaaatgaggt tccaagatta     59340
     atatccacag ccattccgca ctgctgttag tgtgggggag caatatacgg gaatataagg     59400
     tgaacagagg gtattctatt gttctagctg ataggttata tcctttagat atacatgtat     59460
     gggggagatc aatcaccacg tatctatatc tactacatgt cacttcgaac tcacttctgc     59520
     tcctgcaaca cctcctccgt tgtgcggacg atgacatcaa aggcattacg gatatacttc     59580
     tcttcggcca aagcgttggc actaatcacc cgtatcacac agacgccgtc aacgacggta     59640
     gaggtaatga agatctcgcc tcgcgtgttg accaattcgg agatcttttt agttagaccg     59700
     tcagcaactt catcttttac cacgcgatca gacgatccac tggccccatt agatgcccca     59760
     tgggggctct taacgcggaa gacagtcaag ccaaagcctg gctttgtgac gatctcaaat     59820
     aggtcggacc gaccacgcac caaaccagca aaggtatcac caagcccgat ggtcttgcgg     59880
     atatgcgctt tcatgccatt gagaccatag ctccgaatca cgaaccaaat cttaagtgcg     59940
     cggaatctgc gaccgaggga aatacaccag ttccggtagt caattacact tccactctcc     60000
     gagtatgggt tgcgcagata tgttggagtg atatccaatg cgcttgtcag atccaagcga     60060
     ttccggacaa agaggacgct tgggaatgtt agaccaaaga tacaaatttt tccacagacc     60120
     attggtgtga aaagcttacc tggcatcaaa gttcactagc aaccacttat gcatgttcat     60180
     gttgaaactg tcaactccct ccgcaaagtt cttcgcaata tactgccact catccgcaac     60240
     gagggacgca ccggcatagg cggcatcaat atgcacccag atacgctgcc acgccggctt     60300
     ttcctgtaaa actgccttga tttccccaaa gcggtccaca ctgcaggtat ttgtcgtgcc     60360
     aaaggtcagg gtgatgtggt acggggtaag tccgtcctca tcgcacttct cgagaacctc     60420
     acggagacga ggtccggtca tttccatgtt atcctccagc cgcgtggtca cgctgcggaa     60480
     gcgagtaccc gcaatcaaag cccccttagc accgctgctg tgtgtttggt cactggcaat     60540
     agcgaccagc tttgcttgga catcgaactt gcggtcctca tattctggtg taccctcctt     60600
     caggccttcg gcaagcagca gttcccgcac acgcctctcc cgtgcggcaa caatgatagt     60660
     cgcaatagca tcacttgcac tgttctggat aacaccgcca ccgcgggtct ccgacgtact     60720
     cctgaaacac tcgggtagtg ccagggcttt ggcgacccaa tccataataa tagtctccat     60780
     ttccgtgcat gctggcgaac acagccagtt gaaagcaggg gccgtgaatg tggcggagta     60840
     catctcgccc agaatgctgg ggtatgtcac gcacgccggg tagtaggcca tgaaattggg     60900
     agactgccaa tgcgtcaacc ccggctttat cttggtgtca acatcttcct ggatttgggc     60960
     ccagtcttcc ggttcatcag gggggttctc cgggatcaga gggcgcaggt atccgggctc     61020
     gatagcgggg aggactcggc gctcgggcac gctgtcgaag taattgacga ctgcacgaaa     61080
     gcttggttag attgaacata attgagccag aagtttacgc aaagatagag ggctcgtact     61140
     atcatcaatg gcagagtgtg ctgcggtctt gaactgattg tgatccatgc tgcgcgtcaa     61200
     ccagagatct gcgatgcggg ggtactttgg tttctatgga gctttaagtg cggcaattgg     61260
     cggcgcaggg gaacacagta taagagggaa aaaaaagtat aacacgagta caagttaaat     61320
     tgtcagattg agaccacaga gaatggtttg aggcaaatgt gggaaaagca gacattgtcg     61380
     aagaaaaggc gcggggaggg aactaattcc gtcggaagtg tccgttcctc gttccgagct     61440
     cggaatcttt ccgttattcc gaggagtata tccataacgc aggtgtttat catcccaagt     61500
     ccgtctccga tagtctagtc ttcctcttcc ttgggatcat aaatgtcgcc tgcaggtgtc     61560
     ttctccaatc tcttcccatc ttctgtgaca atctctttgc taggtacaac caccacaaaa     61620
     acccgagcaa catccttgcc tcgattcacc cattcgtggt tcgcgccacg gcagacaatg     61680
     acatcgtgtt gattcaaaat cttttcttca cctccgtctg taatgaatcc gactgtgccg     61740
     gatagcacta cggcataatc caagcttagt gtccgatgga accagcctgc gtctgccggg     61800
     ggtagatcga ggacccgaca ggaaggaccc ttggtgtcag ccagcgggac gagagttttg     61860
     tgcggatcgg agagctggcg catattgtcc accgggaagc cgcgcgaccg gtgaatttgg     61920
     atcacaccga acccagagtc agggcccggg gttgagaatg ccggagcggt cgtgggatca     61980
     tagggcgtca gaatttcgtc ggaagcgaag tatgcctttc cctgagcatc gtggcctgcg     62040
     ataacgcgac ggattggagt gtccatggta aggaaaataa gtctttggtt tggatagtgg     62100
     acaagagagg ttgagacagt cttcgaagag agaagcgaat atgattatag aaaggaatag     62160
     gaagttgggc ttcttgttta tataccttgt ggactgaagg aacagctgat taataaaggg     62220
     tattacaaag cttcgaagat gtcgatagtc tttcactgag tgagtatgcg ttgttccgat     62280
     tgataatcat gggattggta agatgggggc tgaaaattca tgaaactaag ggcaaggctt     62340
     cccgtctgac cggcagaata ctctaaatct aggtggcgct gataattgat caattgtgtt     62400
     tatagacaag agctttgccg cggtttacct agcttcattt gaagccccct gctcgccttc     62460
     cccattgtct gaattgtcaa atccctcatc atatacctcc gaatttagat ccctcccttg     62520
     gattttcaac ttctccattg gtaaatacac aaacagcatg cgacaccatt cagtgttact     62580
     tcggttgcgg aacgaatgtg cagtacccct ttgcacactc acatcgccac gacccatacg     62640
     tcgactcgca cccgagtcca gtacgagatc aacctccccc tcaattatca ctccatagtc     62700
     gacgctcact gtccgatgca ttggcgtcgc ctttcccgga cggagatcaa tcagacggaa     62760
     aacggttccg ttatcgactg tgattccagg aggttgatgt aggaactcgt cgtacatggc     62820
     gacgtccgcc tcagcgtcaa ccgaggccgg catactggtc gtagcgtata gcagggcaat     62880
     ctcgccatcg tccccagtcg gtgtcgacgg aaggtagtcc ggaacttggg catgggaaag     62940
     aaatactgat tcgccctcgg tattgtgggt ggtgatgtag cggcggatat aggggagggg     63000
     gttctttttg taaggcataa tgagatgata gagatgacat ctgaggtatt aggtcaggtg     63060
     ttcaccaaag gtagtgagtc tggaattggg aagttgtaaa tatatccccg aggaaatgtt     63120
     ctcacatcat ggtggcatca ttttatagat gcccaagtag gattaagcat aattatgttc     63180
     caaggtcgag cgaaactcaa attggccacc cacgatgtac ctaggtattc tatccatggc     63240
     ctttcgttat tatgtgccca aatttggagt tcaaatggtt ctccaacatg cgtttatgcc     63300
     catccgacac cttcatcttg tcctttatgc tactagccaa tttctcaatg cactcatcta     63360
     ggctagggcc accctcaaat gtctgatcgt tctttttagt ggcaactgct tcctcccaga     63420
     gatcgttcaa gtcctctccc cacccaagtg catcagccaa ttgacgaaca ccatcgtcgc     63480
     aacttccgag gatgcacaca tcgtcgtctc gattgcccag gtctcctgct ttttcattgt     63540
     tgatcaaaac acgaggaatg ccccgtctta ctagccttgg cagcctagag caaggtgcca     63600
     cacgcagact agttcccatg acaagcatca agtccgcctc taggacttct ttctcttttt     63660
     catcaaactc agccgagaga gattgcccaa agaatacaac atctggctta accgcacccc     63720
     cgcatcccgt atcaagacaa tagggcactt cacccgtgcg gatggctttg ttcatgagat     63780
     cgtcgggata tgacgacttg catttatagc aatgctgact cttccagttc ccatgagtcc     63840
     acagaacctt atcgggagga accccagcat cttgctcaag cccatcgata ttctgagtga     63900
     aaacaaaatg gagcagattt ttctttgcta gaagtgccag gaaagcatgg gtgacggtcg     63960
     gtttaagatt tcccgggtga cgtgcccggg cgatcgcgta gaatggctca ggcgtgtgag     64020
     agaaataatt gacgtgaaaa atggcctccg ggtaaggaag ccgcagcgga gcaagcttgt     64080
     cataaagacc agtatttgga gatctgaaat cagggatccc ggcgccagta ctgataccag     64140
     cgccagtcaa gacgacgatt cgggtggctt ttccagtctt gatccggtcg acgattgact     64200
     gaatgtcggg ttccatacta gcctttatat gacgtgaggt atcgtcagac ataacttcga     64260
     atttgggtat tgtgtgcccc ggggagtgga tggaagtaaa tgattgtttt gatcttcgag     64320
     cctcaaaata gaggggtctc tgtgggcgcc ttactgcctt aggttgccaa gtagagcctc     64380
     atcatccata cacgtcatat gttcattgtc ctgtgagccc gacaggaaac atcatccctc     64440
     attactcgct tggcaaagca acatttgtca actctgtgag caagtttgtc cagtccggcg     64500
     tattcagctc gacgttggcg ctgctttcta acatttccgt ccatatgtct tcaagaggta     64560
     acggatcgag caatgcatct gttggatggt tgaccgtcga ttgaccattg gaaatatcga     64620
     gaggaaatgt gatgctcttg gaacccaacg aaacaggcgt ggggataccc ggctgtggag     64680
     tactggctgt tgcggcagtt gaattcaaag atgtagaggg ctcctgcaag tcgcgagagc     64740
     ttactctttt ttcgtgcttc cagtgccttc gtaagatctc catcatggcc tttattcctt     64800
     cacatgcgat gggcgaggat tgttgtgccc ggctgagcat tcgacaagcg tcgagcactt     64860
     cctcttttcg cctctcggcc agaatgtcat cccagttgaa acacacatct atcagaagga     64920
     tggcagctgc catgaacaca tggtgcatga ctgcccatac gaccgagctg tgtggtgtaa     64980
     acacaggctc ttcctcgtcc atgatgcgtt tcacctcgag caccttgcgc gcagactgaa     65040
     gagatacgac atgggaatag gaatatttgg gatcctttgc tccacgcaca aaatagtggc     65100
     gatgcaagcg gcagaaccgt gaatggtaac cctgttgtac tagagctcgc tgccatgcaa     65160
     gagttggtct ctcacgatag atcgctgagt attcgcgctg ggaggcttga tcaaagcgaa     65220
     agaaactggg aatctcagca cgtacctgct ggagcttttg gtcgagctcg agtatcttct     65280
     catagggcac ctcttgtcca tgcaaatggt agtatgacgt ttcgtccact atttggcgac     65340
     acacaacagc cagtctcaat cgacatagac tatatgagat tgcggtggga gtagacagag     65400
     gaacaccatt ctcactatgg ccgatttcct catcctcgac attgagaggc acttgtacaa     65460
     tcatatgttg aggttggatc gagtacgtcc actcttgggg tccgctcaaa aatcctatca     65520
     accttgagat atcatcagtc atagtaccgg tgagatctct ccctaacaac gtaccagtcg     65580
     tatgctgcca agtcccacca caaccgtcgt ttgagttcaa cattggtttt atcaaatcct     65640
     gtttccaagc gctcagacaa aactcgaggg ccgtccacaa tgtgaagccc catgctaatg     65700
     gcctgaccca cgaatgacct atgcacaaat aacgggctca cggaggaggg aaagttcatg     65760
     ttggacagat gatgaccaat gatcatagtg gcttgcagtc cctcgagggt gggataaggg     65820
     atataattgc tctggatcaa tgctgcccct gccaaaaatg tgctttcctg actgaatggt     65880
     tctgcgtgct cggacgactc cgttaggagt tggtaataca gggcggcggc tgtgatacta     65940
     aacagaagcg cagtgtgggc caaattgaaa gactcatttc gcgcgacatt ctcgtaaatt     66000
     gtctcaatct gtcgttccac ttgactgggt atgatgagat gatactggaa gtcaaggtat     66060
     ttacaataat accgaaatag actcagagct tctaccttcg gtggcagata caatggcaga     66120
     tagatagtcg ccggatttgc acgagatgcg tgccgttcgc gcattggagg aagtcgaaca     66180
     ccgggtgtgg tatgttggtg tgaaggtgag cgctcgggtt cccggcgctg ggagagctcc     66240
     gccctcagcg tggcggggac tgcactcgga acgcgatgtc ccataacgat cgcctcaagc     66300
     cgatcggccg tcaaaagggg ctcatctcca ttgcgacttt gtgtctccgt ctcctgccgt     66360
     ggagtccact gtagcgcccg aggtggctca gacacgcgat cgtccaacat gggcctctga     66420
     tatgtttggc tcgtgacttg tacaggcgtt gtagccggac cgtagccgcc atagctgcac     66480
     tccaatttcc gcgcggagca gctactgcat gggagtcctc tgtcgcactt caacttcttc     66540
     tttcgacagg actcgcagga aacggggtct tgccgagtct gtctcttcga gcctggagtg     66600
     gtgactctag catccagtct tcgcttcatg ttgtcaagtt ttttccgaaa tggttcaaca     66660
     gcagtttgag cagcgaaagc aaacaacaaa caaacttcgc ggttggtttg tacaggagac     66720
     gtgtagatgc ccgtccggag ctcccgcggt ctctccgaga cgctaaacca tgttcggtca     66780
     attcttcctc cgggcatcta catagtagcc cggaggctcc gagcgccgtt cttttaagat     66840
     gtaattaatc ggaccttctt ataaaggcca tggtgctgcg cagtaatttt ggttcaaatc     66900
     agagccattg catttttaga ttggtatgct caattccacg gccttgagag tcccattgac     66960
     cggtaaaatg tcaccaaagg ataatcgtcc aactgaatac acgtacgtga catgatgctt     67020
     aaagcgacaa tatatcttac cgctgactct tctaggcccc gggcatgcct tgtcatattc     67080
     ggcgccttca cgtgtgcttt ttgcacggtg ggcttcatga actcgttcgg tatcttccaa     67140
     gagtactata caaagaatca gctatcctca agtcccacat ctaccatcgc atggctgggg     67200
     gcgatagcaa tatttctttt gtttgctata tctgttggag caggagcaat gctggatatt     67260
     tttgggccaa cggtaaggat actcttcctt gatcgttggg aaagaaacta ataatccatt     67320
     tgaacagctc atggtatatg ttggttcatt cgggtgtgtt tttgcactta tgatgacttc     67380
     actatgccac gaattctatc aatttctact cgctcagggt gtcgtattag gtatttccat     67440
     gggaatggcg acatggccaa tgcttgcatt ggtcggacaa tacatcaaag tgaagcgcgc     67500
     tgcggcaatg gggattgttc ttgggggttc atcactcggc ggaattatct ggcccatcgc     67560
     aatcgacaga ctgattaacc atcccaacat cgggtttccc tggaccatgc gaattgtcgg     67620
     ctttatcatg attccttgct tcacattctc atgcgcagtt gccaaatctc caaagaaagc     67680
     tacgacaaat gctgagagtc gtgatttgaa tcaggcaaga ggcgaaaata ccactgaaca     67740
     aaaggacgca ccgcagagtc acaaggtaga ggccctggcc ctttggcgaa agccatccct     67800
     gcagctactg tgtctcgcca tgttcatcat atactttggc atgttcgcgc cgttcttcta     67860
     tacgacgtcc tatgcggttg gtaaaggttt ctcgacatcc ctagcattct atactgtttc     67920
     tattgtgaac ggcgcttcgt tcttcggtcg agtccttcct ggcatcgtgg ctgataagta     67980
     cggaaaattc aactgttgca tcgttgccac tatagcctcg gggattattg caatgtgctg     68040
     gaccaaggtg acatccgtga ccggtctggt aatctggtcc gctgcatacg gctttgcatc     68100
     tggtgtgagt tagcctcagt tgatagcaag cttcgaatac tgactagata tgtagggcat     68160
     tttatccctc cagcaagctt gtgccgccca ggttgctact cctagcactc taggcttggc     68220
     aatcggcact gtgtcagctt ccacagctct atcgtatgat tgccatttct cgaaaggata     68280
     atgtgagatg ctgataaaag ctccagtgcc atggcgaatg ttcccatcag tggtgctcta     68340
     gttgaacgat atgggtatgt ttctctgtca atgttctcag gggcatcctt gcttctaggt     68400
     ggtgtcctct tgattgctgc gcgtctgtca cagaacaggc agcttcgagc tatcgtctaa     68460
     tgtttggcca tcaggccgag gttccgcctt cctatttaat actctagcct actctctggg     68520
     ggacgggtgt tctagaagtt aatccacaag cggtgccggg ccttaagaga ggtgtaatgt     68580
     agcccagaga ttactgtggc tcgaagatgg cttcatcgga tatagatttg ctgtattaga     68640
     aataatcttt ggggccgaat ctaataaata tttcctacgc ttatcaggtt agttattcga     68700
     ggaaatgatg ataaatgccg gaaaggccgc cgcctagaga cacccattgc ctcacttcct     68760
     cgctggtatt atttctattg ggtacgtaac aacttatata ggcctgggat tctttgaaag     68820
     ttcaagcttg cttgcaaata catcttttct gtatactatc tattgtgttg gctcgtgtat     68880
     tttccagtta tgaagggatc ctggagacag ccaaaaatat attctcattt gttgccaagc     68940
     tggcgattgg gcaatctgtt ggtgcttcaa atcgtagcct tcgatcccag agcatatata     69000
     caaataaata aaaaaacaag ttccaacgtt cccaagtggt cccgttataa gcaagtgaaa     69060
     atcagtttag cccgaggtaa cgtgaagggg gccgttgccg tcatcaacag ggcaaccgtc     69120
     gctgtcggaa tcgaattcaa cgacacagct cgagtcctga ccaatagcga taccaatgaa     69180
     agtagtatcg gtctgtccct tggcgctacc gaggctgttt ccatcaccgt ccttgacctc     69240
     gcaggtgtca gggtgtcctc caaagtcaga cttgcacttg aacttgcgtg gggttgccca     69300
     gcagtcgccc tcgattgtga actcgcggcc gtcaccggtg ttgtaacagg gagagtggtt     69360
     atcgggatag gcctggtcgt aaacagcttc gccggcctgg tttataatcg caaagccttt     69420
     gaagtggccg ttggtgttgc cgccggcagg accggaaatc gtcgagaagt cgccgcttga     69480
     ccagacgacc ttcaggcgct ccgcgtagac ggttgtagag gtagccatca ggcaaacaag     69540
     gatgttgcgg agagaaggca tagtgaagag aaaaacagaa aatcgagttt tcagagtaga     69600
     aggtacttga gagttcgttg ttcttgatgt tcttctcttg tcggtggcat ctggaggccc     69660
     tttatacctg ccccgagttg tccccctgcc actggaagct gcctccatgc ccagtcagat     69720
     ggcaacatga gatgatctac agtgtttttc tcaatgacca tattccaatt gaggaaatct     69780
     taacgaagta tctggcgtcg atacctgtag gtgacgcaac gttggaaggc gctgatagct     69840
     gtctgccttg actgggagac ttgcgggaaa aggagaaccg ggttatgccg tagaaacata     69900
     tagtgcacac tttgtacgga gtagtttgat tggcttcaga cattgggggc ttaaatatgg     69960
     agtcgagcct tgcaagtttg ggctgcagat cggcaagctg aagtggataa ctgtccaatt     70020
     tggtggccgt tgacaatatg atcgacatag tcattcgatc tggctcttca atgattatct     70080
     cgcccccaaa aaatgtcagc actaatgcac gctaataaag cagggccaag ttctatttta     70140
     cttctttttg gatcctgatt catgctatgg ctagcccatc ccgttgcatt cctgtctcgc     70200
     ctttctctta gacgcctatt ttcatatact ggaaaaatgc ttttctttgg acgatctgcg     70260
     ccaaagtgcc ttgccgttgt ttgagcgatg ctggtgagag tattacccgc ctaaatggct     70320
     ttcttcaaat cccgaacggt tgaagtactc tgtcgacatt tggacatact gaagtacctc     70380
     tcatatttcc agccatctaa acccagtgca gcctcattga gcgttcaatg taagtactag     70440
     ctgctaatat ttacagcggg agggatttac atgatccttt actggtctga tgggcaagca     70500
     actacatcta tatatatttg tccctggcta tatatagcaa agtgctctct acggactatg     70560
     ctttttaccg ttcttgtaca ttctaagtat tagtctactc ccgtttgtat tcgttatcct     70620
     tttcgggtat aacactgaga agaaagaata ctggtttaag aagcaatcta aaaagagcaa     70680
     cccaaaacac actgccttgg gccaaataga ccacattatt aaaacattac gcgaacaagg     70740
     acagcgacca catgagcggt tggctatttc atatacacat acgtaaactg tgtcagttgt     70800
     tggaagaacc aagagtcttg ctgagtccat tcagcaaaac tgaggttcgt tcacttccgt     70860
     tgtggccagg catcgtacag tccctcaaag actgtcacat cgccaaatgt cgcttctccc     70920
     tctccgttgt ggaagaattt aatgtcagtc gagttggcgt accaggacct gcatactgtt     70980
     agttgctgac cagtctccag gaacaagaca aacttaccga gcccaggtgc ccagagcaaa     71040
     gcgtccgttc gcataaactt cgagtattcc attatccacc acgacggtga gctccaacgt     71100
     ctcaaccttt tctttaccat tttccaagac gtcaaagagg cgcagacgac ccgcctcgtt     71160
     gtcactgaga attccatgag tggttttcga cgcggcactt gtgttgctgc ggtcgacgat     71220
     gatagactca ttggagaatt ggtagtagat acttgtagct tcaagaccag aggacaagac     71280
     ctggaaacca gcttgaatac cagagtcgcg ggcggtggcg gggaaagaga tgttcgctgt     71340
     catagcaaag aacttgctcg agggtgaggt gttgaatggc accgacccag cctttgacaa     71400
     ggtcctacca gactcgacaa aagacgggcc ggatgtgaga gcgctgtaag tctccctggc     71460
     aagtgaaatt cccattgttt cgaggtcgag ttgaccagca ccttcgcggg acacgcgcca     71520
     cgatgtgaac tcctcgcgcg ccagcttgtt atccaccacg ttggggatag tgcggatatt     71580
     cagctctcgt ggcagcaaga gggcgccggt ccagttttgt tgagcggtag ggaatccctt     71640
     cgctagctca aataggtctc cagtgagcca gatggtcgaa ataaaacgat cgggggcacc     71700
     gctctttttg gatgcctgag agctcgccgg caagatctgg cctgcagcag catacccaga     71760
     gagaccccag tcaagtacac ccgccatggt tggcttgaag gtgacggagc cctcatttgt     71820
     gacatttcca gacacccaca gcatatcgtg aattgaagag acttgaggaa cgatgggttg     71880
     gcccgaaccc tcagtaccga gagtcatgaa gatttcgccg tccttgctgt acccctccgc     71940
     attcagggag aagacattgc caacctcaaa attgaagccc catcctccgg cccagtcacc     72000
     gttgccccaa gtggtattga cgggctcatt ccaccattga ccgagatatt cccagtattg     72060
     gaaaccagcg tcatgctgac ggtagaggaa cgagcaaggt ccgacatcgt ggacaccgcc     72120
     cgtgatggtg atataccagg ttccttcggt gctgttgaca gatttgtcca gaaggggact     72180
     ctggaaagcg taggggtcac ggaaagcggt gatgttcacg gcaaatggag gcgctgggat     72240
     cacgggccct tggttgagct tggtgaagtt gcgtccaccg tcataggaaa cggccaagga     72300
     ttgtgtctca cttccccggg tgtaggggat ggaccagtga attgggagat acgagacaga     72360
     ggtatatata agggttggca taccgtcgat accgttcgga atgacggagc catcaaagac     72420
     agcaagaggg tcgttctttc ctcccgcggt gattgacggg ccaccatcgg gattgaggtc     72480
     cttataggta acgagatcat cggttgtagc tgccgaaatt ccatcgtgaa gccaacccac     72540
     atggaagaga ccagtcttcg ggtcggtgta atgggcgcac ggatcaccta gcttgccaga     72600
     tggaggcagg agatgggctc tgggtctcca tgtgtcgaaa agggatgcat tcgacaacgt     72660
     actgaggttt ggtggtgccg agttatagtc gatctgggga ttggcagcca atgcccggtg     72720
     ggctaaaccc acggtgattg cagttgacag cttcatggtg cagatcttgg atagcttcat     72780
     gagctttccc cgggatatac gtacttttat atgtctaata tgcccaagat aaattgaccg     72840
     agattagatg aatatgggag ccaatagaaa tagcacctcc atcaatactc cattaatatg     72900
     gatcgagttg cgaagctcat ttcctctttg gatgtagtcg gcagattcca tgagccaacg     72960
     gtaaaaccgc ggggaaaccc cggctgacag tttccccgat gtaaacatat attacccacc     73020
     cgggcagtta ggtagttcga aatgattcta cttgatttgg ttgtgtgggt ttaagggaat     73080
     atttcatatt ccgtattaaa gtaggatatc aaacaaaaga atagatgttc tgaaagtcct     73140
     agcccctaca acttaacttg atggtggctt cgggcattag gtacctggta ggtgcctagt     73200
     aggtccctgg aggatcaata aagcctacgc tgtcctactg caggtgatag tatccagttc     73260
     tgtgcgtcga tcgcgaatca tgatcgtgtc cgatgacata tcaatgacca gaaagtgttc     73320
     cgaggttccg gcgggattca atgtcccctg agacaaagga aattgctcta tgaccagacg     73380
     aagagatatt tcagctgtta ttgacgattc cttggataac cgtaatctgt tatgtcgatc     73440
     ggtgtactag ctcgtttcca gatctcatcg ttgtcagttg atatccatcg ccctgtcttc     73500
     aaagcgatac gacacactcg gcccggagtt tatacccaat gctgggcctg ggagagactt     73560
     ctccacaaaa gaaaaaggac cagtgagcgg gtactatacc taggtagcat gttaacctcg     73620
     cgtttggttc atcttcatcc cgtatcggca gttccactca cctactttga atgccttata     73680
     agtccttttc ttctcgctgt tatagctggg ataatggtca ttcgccatat agggaaagca     73740
     tgttggcatt accactctac gacaatgaag gcaggagaaa agcataagta cagaggagcg     73800
     gcggagtctc aacgcgattt aattcgcata atgggaattc cctgctgttg gtactcctag     73860
     gctattctga ttgaagcagc tagggcaggc ttgccggatc ctggaatacc tttgacccac     73920
     aacaggccat tttcgtcccc ttggtgccat tgttgatagg ctctgtggtg gtgagccgtt     73980
     ttcctgtccc cgcaagatat gcgaggtgat gcgtagagta ttcacttcgc tccaggtcat     74040
     atgcggttgg ctgaagccag ttcctgatct caacaatgtc ggtgggaggg aggggaagga     74100
     tatggtccac gttgtagccg cgaacatcac ctaggacaac cagaactgga tcatttccat     74160
     cggaggttga agaggacata aattttaatg tccacttgtc gacgtttgta gagggaaagg     74220
     tgaagacaaa gggggttgga ccccgcttta gcttgggatt ctcagctaac taacgctttt     74280
     tacagccctg agaagcagaa tgcatagcga ttctctagca aaaggttcac gttaataggt     74340
     atctggcacc tgctgcgagt gtgatgagtg tgagcaggcg acggcatgat agcggcaatt     74400
     tggcaattgt cagctgatat ggcgggacat ggggtatttc gtcgggaagt tgcctaggtt     74460
     cagttctcac ggggcagaaa attagtagaa aacgcaagct gggtaggaaa tcatgaatct     74520
     gggtgatgag agagggagag agaggaagga agatgaatgc tgggaggtgg aagaccatat     74580
     cccgccttag gcataaacgc tggctccaca tgaacatcta tagatcagat cataccatag     74640
     cattcaattg ggttcatttg gttcaatccc atacttagaa aaatatatac ctcgcttcca     74700
     aatatcctag cgaagcataa tcctaaccag atatccatac acacatccaa tcataaggtg     74760
     agccaacaag cctaaatctt atccgaagag tacaaacgaa taggcacgcc aagatcatgc     74820
     gacatcgtca ggttagatag cttaataggc tcctgtcgag gatgggggtc cgcgttttcg     74880
     agggtatcga agtgctgcat cagacgaacg acggtgtagc ttgcctcagt gagagcgtat     74940
     tgttctaagt gattaattgt tagccagtca cttggagtgt tcttcaattt cgtccgggaa     75000
     cagacgagga tctgcacaac ttacgtccaa gacagatgcg cggcccgcca ttgaaaggaa     75060
     ggtattccca gccatgcttc gcattttcct cccagcgctc gggccggaag gaagtcgcgt     75120
     ccttgcccca tagatcggtc cggcggtgca tagcgtagac gctgtaggca accatcgtac     75180
     ccttcttgat atagaccggg gattgctggt caacgccacc gccgagtggt agggaggtgt     75240
     cttttgtcga aacgcggaag ttgacaggga cgggaggctg gagacgaaga actggatttt     75300
     ttggagttag ttggataagt attcactgac agagtgtacc agtatcgacc acagcatcga     75360
     ctgaccttcg ttcaacacat atcgcagata agggatatcc ttcaacttgg tttgagtcat     75420
     ttccgaccgc gggttcttcg cgtctccgaa cacctccacg atctcgcggc gcagccggtt     75480
     ccacacgtta gggtgacgcg aaaggtagaa gaacgtcgag cttagcagac tggccgtggt     75540
     atcgcgacca gccaatagaa tattgagcat gttatcgcgc agcatttttg ggtcatcggt     75600
     gtcggccgcc agtgcttcga ggaagatata ccgaccgtcg gtcttctttt cggggttacg     75660
     tttcgactcg agagcgagat tgacatagtg atcgacgact tcgtgaacct gtcgacttgc     75720
     ctcgcggaat tccttgggat tgacaaccca gtacaggccc tgggcgcgac tccgtgcagc     75780
     gagataatcc tgagcggttc caaaggcgtt ggcgaaacct tgtgcgctac cgacggcaca     75840
     tttttccaac acacctgtct tccccgaggg gggaagcatg caccctaccg attccccaaa     75900
     taggaagtgc gttgccgagt ctagggtcag caggaaaaat aaacgttgga tgtcgaaact     75960
     gctcctgtcc ttggggataa ggtcgatcaa gttggagatg tggtcatcca acatagaaag     76020
     atcggcgacc tgtatcttgt gtcaatgaag tgtcgtgcaa tccgacatat cggaaagttt     76080
     acttggtccc tagtgaactg cgggcgtaat aatccgcgcg catgagacca ccccgcacca     76140
     tcgagagtga agatgccatc gcccaggagt gggtagaatt gctggtgtcg tgttccaaga     76200
     gaaaaatctt tgaatcgggt agcgagaatt gccttgacat tttcaggctc gatagtggtg     76260
     attagattgc gagacaggaa tgtctgtttg taggtatttc catagacagc atattcgttg     76320
     tagagatgct cgatccagcg cttttcgcgg acagccttgc tcaagcgaat aaaacctgga     76380
     ataccgaaga accccgagga gcccgaacgg gcaggcttgc agtgtaaggc ttttgattgt     76440
     ttacggtggt gatgtagttg tgcgaagtag cgtacgacca agaaggccac agacagcgta     76500
     ccaaccaagg taactgcagg gctgaacaac attttgtctg ttatctccat gaactgaaag     76560
     aattgaaaga aaacgagcaa ttaaatatgt gagatggaat tttaattcac agaatgctat     76620
     atgtccacgg cctcggtaga gctccacgtg agaaaagacg gggaggatcg caagctgata     76680
     cgaaagggga atagtgtcaa aaggagaaaa tccaaagtca aaatgagtca cgatatccgt     76740
     tgaacgttga acatttgtca aggtttaacg agtcttggct ttgaaacatc caagccactc     76800
     tttcaatgcc gtttgaaaat atccccgaga aatcgcccca ggtacaaagg ccgtgtggaa     76860
     atcaaagcag tgctccgcct tctgcatgat gtagccgaag atcgtatttt cctccgtctc     76920
     cacattgcac ttggggatct ctgtcgtcag agtcacaccc tgtgggccta accgtgtctc     76980
     cgcgagggga gacaaagtcc gccacggatc aaactggccg ccgctccagt aaacgttgga     77040
     cggacgaata gaccatccgc cggtctccgc attggtcgcc tcggtctgcg ggtgtttggg     77100
     gaacagaccc ttcgcaacag cctccgggaa gaatctgttg caatattcct gtgcatattc     77160
     gagggtctgg tattttgaca gcaacgagtg agctccgaag ttattggttt ggaagtatcc     77220
     ccattcagtg cagtactgcc atgtccagct gatggtgtct ggattggcgg atggtggtcc     77280
     cagatcgcac tcgagcggtt cgctggtttc aagctttttg cagttggtct tcatattcat     77340
     attgactacc tgtgtgaaaa ccggccatga cgcatatcgc tccgcgacat acttcttccc     77400
     ccgggtcgga gcgaatcctt cagagggtgc cgctgcgcta gtcttcgggt cggtctccat     77460
     gtgttcgcag aatgactcca ggctgcccac accacctccc ataccgtaag actggaaaaa     77520
     gttgtaaatc gtcacgagtg cggcggtgaa atctccgttg ctgttctttt cggcgccttc     77580
     accgaagaat tcccgcttga tggccgctgc ggccgattcg ctcttggaga gttgctcgtc     77640
     gatatactcc agtgcggcct tgatgtccct ggtgcagttc aagtgtccat atgtaaccat     77700
     gccgtcatac acctggtcaa aatagacact catgtcgatt cgtgcttcga cgggggcgga     77760
     cgaagcgaaa gcagcgtaaa tagtatcggg atacgattga cgggtaaacg ccgcgcgcat     77820
     gccagcgtac gagcctccga ccatgaccca tggtgttcca gctggagtca ggtccacatc     77880
     gctgtaatct tggcgagtga attgggccgc aaagtatggt atgtctgcca gagcctgctt     77940
     attgttgaga tactggagat gttcaggctc catatccagg ctgacgttgt agggaagaga     78000
     atccccatag tacctggttt tggttagttg agcccgggct ttcactgggg aggggacaca     78060
     aaccggtgct cccaaacgat accaattcca ccgaactctt taaccaactg gtaaaagaac     78120
     gtgctcgaat tgcttagata ggtttgcccc gcaggctccg cggttgattc gcccacatca     78180
     aacacgaaga tcggtccgtc ctccttgtaa tgctcttcgg atacccaata gcggttccga     78240
     tagtggccaa ccgaagagtt gctgtggtca attgggatct ataaattgtc agcatttatc     78300
     accatcttcg gcattgggaa gcatagacac ataccgaaac atactctgcc tcaatggtct     78360
     catcaagctg ggagttggta acgtcatgca ccgtggtctt ttgaccgagc agggtatctg     78420
     gatgaatccc cagctcagcg gaaagcttca gatcccgctt gaactgcgat gtgacaattc     78480
     ctgcagctgt accggacagc gcagtcaggg ttgcaatccc cttaaccaca gttgagaaat     78540
     gcatactgag agtgccttgg cagtctctca aacccccagc ctaggataca cggatataga     78600
     acagatttgg attatctcac tgctgggtct cttatggaat atatatgcat tacagagata     78660
     ggtaacaact gggaaaatgc aaaatcgggg taataaatgt accccgagaa caatatgata     78720
     agaacaatat ggttgcgttt gtgacaaggc tgcagtcatc tggaacatca gatggattgt     78780
     ggattcggac ctgacaggat catgagtgga catcgtcagg cacacctaag acatgaccgt     78840
     cgcgtgcggc cagtgagtga atgaccaggg gaagtgacaa tctaatttct aggcatttct     78900
     ggagttaaat gtaacctacc tagcacaatt tgagctgtat gtctcgaatt aattgggcag     78960
     ttaccacatt taccccccgc ttttacagtt atcgagcctt tcctgcggtc aattaattgt     79020
     gcattgcatt agtgaagtag ttactccctg ctagctcaat actgactatc acttccggat     79080
     taggcaggaa tgcgacagat tcagcgatga aatcctgaga tccgcgatgt ccatagaatt     79140
     cgattaattg agttcctgtg agatttacaa catagaaaca cacttccgca tctggtttca     79200
     cctaaaaaca ggcaccacgc gatgtccttg tcctataccc ggtggatccc gagaccgggt     79260
     gtgaaaggca agtcgaccat tggccatgga gaaaagcaac gatcaaccgg actccgaaca     79320
     atagccgggg cttagtattg ttgtgagcta attgtttaat tagcttgccc atttctctac     79380
     tccgtactca attcatgaca ttgttttgtc tcgggctctc acaatcatgt ctggaaacgg     79440
     taggagttgt ggaatgttga tctggaatgt cgacctacgt agagttaggt gggaaaaaaa     79500
     gtccaatttt gcgctcatcg tggaaataca catgtggctt gaattgactt ggaaggattt     79560
     attccacacg tttttcttct cggagttccg ggcgccccgt caactgtcca gatgggcagt     79620
     tggctcctcc ccctcgtttc ctcttttcct cttttcctct ttttcccctt caagtcatca     79680
     tgtgacatga gcggttgctc tgtggaatat accaaaccaa accagagcaa tagttgtaca     79740
     atgttgccat gatgaatact gcgtgggttt gtgctagatc ggtgtggtga ctagagccac     79800
     gggtatcgta atatatagac aggtcgtcta acttaggctc taatttagca taatctagat     79860
     ttaggtactc cacgaagtat ttattcgttc tctgagtcta atacaagcat gccatctatt     79920
     ctatgtgagg ttgtacaact attcctgtct tgtagacaat ggacacggcg gtacggagta     79980
     cagggcaggc atatatgtat acatcgtata ttatacccaa ctatcaacct tggaaccttc     80040
     gaacccatca ctgttccgag taatgacgat agataaaacc acactcagaa cacatttggc     80100
     cgagagaaag aaagaccccc ttgcgtccca aaagggaagg taaaacgcgg cccctcggct     80160
     cgccttccgc ctatatcaag tcccatccta tcgcttttca ccaggtttct cagttatgca     80220
     aattggactc ggcccgatct gcgaatattt ccaaggttct gtctgcagag tctgtcaatc     80280
     tgctagaact aggaacgtca accttgctct attaagggta actggcgtcc agcacctcgg     80340
     cccagtttcc aactctatga cctgccagcg tataacgcca tggcgtctga cacaaacaat     80400
     accccctctt ttctcattat catctcttcc taaatgaccg ccatctagtg agcaaagaaa     80460
     aatctaacca tgtcacgatc atgtcgcttg caagagaaag tagccatagt cactgggtcc     80520
     tcatccggcc taggacgagc gatcgctatc cgctatgccc aagagggtgc aaaagtggtc     80580
     tgcgctgatc tggtaccaac cgcgcgatcc caagaagagg ttggtatcac cacacacgat     80640
     ctggttatca gagacggtgg ggaggcgacc tttgtgcgga cggacgtggg cgacgcaacg     80700
     cagatggaga acctggtcca ggtcgctgtg agagaatacg gacgagttga catgtacgga     80760
     accccaacaa gaagatctca agcaacacat ctgatgactt cgcttagttt ggtcaacaat     80820
     gctggcatca gcatcgaggc acagacacct gctgtactcc atctgactga cgaggcgacc     80880
     tgggatacaa caattcgtgt taacgccaag tctgtgttcc tgggctgtaa gtatgctcta     80940
     actcaaatgt tagcgcagga accacattct tccggcgacc ggggctggat catcaacatc     81000
     tcttccatta tgggtatgat tggtgggccg gagaatcgtg agtctaactc ctcggccctt     81060
     gggtctaagt tgatacttga agtcagcatc gtactgtgca tcaaagggtg ctgtgagtaa     81120
     tctcacgagg cagatggctc tggattacgc gccggataac attcatatca atgccatttg     81180
     tcctggctgt aagccagcta atttgaccgt ccaaattctc actgacaaat gcttagacac     81240
     acaaacggct atcttcaagg agacaactac taacttgact tcgtgggaag acctgaaaag     81300
     gcgccatccg ctgaaaggac ctggaatgcc ggaggatatt gcccgcatgg ctgttgtgct     81360
     ggcaagtgat gacgccagct gggtgactgg agtttgtctt ccggtcgacg gcggatatac     81420
     tgcgcgttag gcagttgacc tttcttacat ataacatccc ttatattatc ttgagccaca     81480
     taaaccggtt tattgaagcc cttcgtcgcc aaggacagag gccatgagcg gccaactacc     81540
     cttgtttatt tcaattcggg gaccataatg tagaccgtat gttacaacag cgcttggacg     81600
     agcatcaggg gtgcaccctg gctctcttcg ttaagggata gcgcagcagc tactccatct     81660
     tccgaggact acgctgataa aagcacctcc atggaccata attccaggat taagcgaagg     81720
     aatggcccgc aatccatcgt gtcaaaatgt caaacgccac atcgccgcga tcctgaggaa     81780
     gctattataa ccatcagcat gtactcagat taacatgtct gaattgtgag acttactaaa     81840
     tgacccgccc cgttaaccgt cacaaatgca aaacgcgatg cctctgcttg gccgtccaac     81900
     tgcacacaca cctctttcgc ggtgccaacc gtttcgttac gtcccgcgac atttgatgtc     81960
     caaggaagca gtggcttcga tgtaaattca gtctgtccct tccaggcaag cgagttagcc     82020
     caccgcaagt ttcccgccgt gttgcaagct aagtcaaggt ttccttggta ggccaggaaa     82080
     tgcactccac tagcaaggaa gatgatatgg tcggatgaag atgtcatcgc ctccggcgtt     82140
     gtcgcaaagg cgtcaaccac ggcgctggac tgaattccgt actccttagc cccttccggt     82200
     ggcgagagtg cctcccggac cgtaggggag ttcagatact gctcgatata agcagcttct     82260
     ttgtagcata tctcatcaat ataacacggg gctgtgactg ttgatttcct tgcgttaatt     82320
     atagtcaccc cttgatagta tactgataag aaggacttac tgtcgaagcg gttacggcct     82380
     cccttcttgc tctcgtcctc gtacaaacca atgatccctt tatagcaaac ggaatacgca     82440
     gccgtgcaga tcgcaagatc aggacctttg gcgcaagtat cgtagacttc catgcatcgc     82500
     ggcatgttag cagctataat atcgcatcgt gtctggttga acacgggcgt ggaaatgccg     82560
     ggattggtcg tgcaaagcgt ctcccaatat ccgaaggtga tgtccttgga tgacatgaaa     82620
     ccattcccta tcaggcatga cttgaggttg atctgaggct ctgaagggta tagttgattg     82680
     cgagtcacaa tctcagcccc gagatagggg atgtattttc cctggaggta tcagtggtgc     82740
     gcgcaaagtg acacggggcg gggcgagcct tactgcataa gattcaccgg agagatggaa     82800
     atctgagaag cgtttgtggg ggaaaatctc agatacgaaa atttggagaa aacggtgcat     82860
     gtcaaccgcg gcctcttggg aatcgtgcgc gacctcgtac ccctcgtcaa tatacgacca     82920
     gcccacatcg gctggctggt ccacgaaaag taatgaggag tttcgagacc aaccccaagg     82980
     gttgcgaacg gttccattcc cgtgttcgtt tatgagacat ggcccgtttt cttggaacag     83040
     gcccatcata ctcgagctcc cgggcccacc attcatccac aacgttagtg ggtcagcgac     83100
     gggatcattc tgactttcga agtaccaaaa gaacaaatgc ttcgggccaa tatctagcca     83160
     tcctgtatac tgtgcggagc ctgcggcaca gatagattca tcttgttgtc ggatgcgtat     83220
     tgaatggagt gaatttgtac ttcgaaaggt ggtgaagttc gccaagggct ctggtcggag     83280
     cacggtttgc gaggcatggc ccacgctgat tagggcggaa agccaaaatt tccacatttc     83340
     agtgataaat gagatttttc tattgcgtac atgtaagtag ggacaatggc aacaattgca     83400
     aagctccttt tataattgct gtcggtcagc gtcacattga aaagtcggag ttcggagttc     83460
     gggcctaata tctgctagct ccaaaagact tagagcgtat ccctttatcg ccaggcatta     83520
     tgcgcctata ttgatagtgt gcttggacca atcatgtgtc aggtctggaa ggttccagac     83580
     caacctaggt agaaatctcc agggctcttc agggatgtga tcgtcagtgg ataacattcg     83640
     cctcggaaaa agcagagtga aggttccccc tgtgatttta ctcacagcca ccactgagca     83700
     tgctactcca taaagtgatt cagaaaccat gtcgcttgtt tcggactcac tgctcttcga     83760
     gctgccacgg ttgatagatc gggttgtggc attggggagg ggggatgact ctaggggaag     83820
     gcaggatgag acagtcaaag aggaaggcac ggggaaggaa gcaagatctt aggaagggta     83880
     cgagtaccgg ccttggtatt tcacttccca aagcgacaat cttgaacttt tacggagcgc     83940
     tcctgaggtg acaattgtgt caataatagt gagcgtctat ctccgtccct tcatccaaat     84000
     ggggttaagg tattgtgggg tcattgtaaa gtccagccaa ttagcactcg tgaaacacca     84060
     gctggactct atatactaac cggatatggt tagcgcgctg tcagcatcag ccgcatgctc     84120
     atggacataa acattgggtt ctcacggact taggcattcg gaacggacta aataaattgg     84180
     agatatatat aataatcgag gtttactcgc tcttgcttca agttcgacca tcaataccaa     84240
     cgatttccaa atgcatctta ttctcacggg ggcaaccggg ctagtcgggt cttcagtgct     84300
     cgacgccatg ctcagaaaca ccgcagtctc caagatctcg atcctaagca gaagccccgt     84360
     gcgaatgaca gaagatgcaa aagacccacg tgtgcgcgtc attacccaca cagactttga     84420
     atcatacaag ccagaactgc tcgatcaatt gaaagatgca gatggatgtg tttgggccct     84480
     aggaacaagc cagactaacg tcaccgaaga gtacaagata cctctccctt tgttacatgg     84540
     atatcaaaac taacgattaa caggcagtat gttaagataa ccaaggatta caccctggca     84600
     gctgccaatg cgttttccac aatcaagcca tcaaaccatc ctttccgatt catccatgta     84660
     tctggtgaag gggccaccca gagtcctgga cgattctcac caatttttgc gagagtaaag     84720
     ggcaacaccg agaagcttct tggaacacta tcagagtcaa agccgacctt ccgggccgat     84780
     agtgtgaggc ctgcatttgt tgatcctgcg acgcacgatg ccatcaaacc gtatattccg     84840
     tcaagtggag cgactggcat agtcccaaaa cttggattgg ctttgcttgc cccggggata     84900
     cgctgctttg tgaagtcgat gcattctcca acggaggacc tagggtcgtt cttgacagaa     84960
     atggcgatgg gacgctacga agcaaaattg gagggcccag gggcattcag actaggagga     85020
     ggttacgtca ttgggaactc tggcatgcgg agaattttgg agctgtgagc atgcaacgga     85080
     cagttatgtt aggaacggct ggatatggat gatatttcat aatgtattct tagaaagacc     85140
     tcaaacgact acaaggaata gtatcaaaaa gaagttgacc aagccgcata agtagctgac     85200
     tatttttagt acagtatatg aattcgaaac aagcgtatat tagtcctgaa ccttcgaatg     85260
     aatattcgcc aactacggtg aaaccagtga ggtctgccaa tcaaaaggaa acaaaagctt     85320
     agccctttat taatatgacg ctacccggaa gggaaataat tgatagacat gttgataccg     85380
     catctatcag ctgagtctat tgagccccat tttcggcagg aagacgtcag caaacgtaac     85440
     agcatgtcaa ggattcgcgc tggatttgcc cttagcaacg tgatattgtt ctttgttaac     85500
     acaacataga acagattgcg atttcatttc atccaatcaa ccccatgtta tcgcagagat     85560
     caggatacac agaacgctga tctcgaccta taaaggttac ccaatagata attatcctcg     85620
     tctgaataag aaatctcaca aagaaaggtc ctaatgctta tttataaaat attgccactt     85680
     ttgtgctcat tagaaatata aataaagaga cgaacggctc ctatctttga acatttcacc     85740
     gcattctaca tttctacgca cgatgaagta cttccaactt ggcagcatcc tcgctctatg     85800
     cagcattgtt atggcaaccc caattccaga tgcctcgcct gatattctcg ggtgtggact     85860
     cgaaggacgg ccaatgaaac cacttgcgct aagccccgag tgtgcctggt aaggctggtt     85920
     gccttgctct gtaccagagc ggacatcctc ggagaaaggc atgtaagttc cgggccaagt     85980
     tctttcctgg cggtttcata ttagaatatc agcttactct tccgttaact agcgtgcttc     86040
     cgagcatgtt tgaccaacct gtgtggtcca gccttgcttt ctcttcggga tgaatatgct     86100
     tcttttggaa atgctaggct gtgatctatt gttatttggg gcttctgcta ttttgactac     86160
     tttgtaacag tttattttgt gtcatccaat atctcggtga gctcacactc ctttgttgat     86220
     tatgtgtatg atcgctggga ttcatttcaa tatttccaag gttggtcttc ctcgagcagt     86280
     cgatacctcc atgtagtaaa tatttgtggc cctttcataa taccatggtt tacttcccga     86340
     tctcccgaat ttcctccatt tgtaggatgc aagggaaatg tctacgatgg tatggaccga     86400
     gtaaatttcg gggcatgtct actttgggct ggcttctgtg cattcaagat gttcaataca     86460
     tatccagtca gcccctcttt tcttttcttt ctcttttcca tttgaaagct ttgatgaatg     86520
     cactaaacag gtcccagata atattcaatt tcccgtagtc tcggcctttc gggagaaggt     86580
     cgtccgcact ttcggaaact ggaatgattc ttttccatcg gattaaagtg accgggaaat     86640
     ttacctactt aggtgaagaa ttcatccaag caccaagatg tctcaaagat ctgattcttc     86700
     cattagtgcg ccccctggca ttgaaacagc catcacccca cacggagtta cagggggtct     86760
     tggcaaggct aactatggac ggggaatctc cagaagctgg cttgtgctta tttttggacc     86820
     tttccgtcga gtctgcagac tgtccgttcc tggaacggaa atcatccagc tgccaaggag     86880
     ccagaaacgc cacgcattgg tggaactacg agtaaagtca cggactatgg tggaatgaag     86940
     ctccagctac ctatccaatc tccacccccc cccccccccc aacatgcagc atgcagcgtt     87000
     tcacattgag aaacaaaagt tcgcggccta taatatgctg cttgtctgcc cttcatcgtc     87060
     tattctggac accagcaagt ttccctatag cgcacgttgg acatgatgtt tttcaagtcc     87120
     gtggccattg cttcgctggc ccttttggct aagcaggcat ctgcggcctt cggaatcacg     87180
     actagctctg attcctacgt aatcgatgct ggctcctcaa atcctctcaa tttcactgtc     87240
     agccggtcaa gctgtgacat tacttcgatc aattactatg cagctgagct tcaataccag     87300
     tcgactgggt ctcatatcgg atcgagtctt ggtagcgcaa cggtgtctgc gactcagagt     87360
     ggtgagtgag gaacaggatg cttattggaa aattacctga tcaatatagg cgactatatc     87420
     aaggtgacct gcgaaacgtc caccttgaca cattactatg ttgtccgcaa aggagattcc     87480
     accatccaca tggcgacata cacaactgaa ggttagcttt ctccgtgtcc aagtgtgacg     87540
     tctgtactca ttatctttct cagagcccag tattggagaa cttcgataca tcgcgcgcct     87600
     aaacgcagac ctgcttccca atgaagagcc attcggcgac gtctccacta ttgccggtgg     87660
     cactgttatt gagggcgagg atgtggtaag tttcccctga agcctttttt tcttattggt     87720
     acaaataact atagctaaca catataagtt cttggtggat ggagaaactc gaagcaagtt     87780
     ctactctagt caacggttta ttgatgacaa catccactgt aagaacacct ctaccctgtt     87840
     taattgcgac tgatcataac acagacaggt gtctctggaa gcgcacaccg cgtgtgcatg     87900
     atcctgaatc aatacgagac gtcttctggc ggtcctttcc aacggtaagc ttctcggtca     87960
     gcatgacttg atccaagcta atatgcgaca gggatatcaa caccaacaat gttggctctt     88020
     acactggtct ctactggtac atggtatgta acatactgag gctccactaa tatcgaataa     88080
     cggctgctta ctctgtacag aactccggac acgttaagac cgaagacttc cgccagggcc     88140
     tgcacggtcc gtactcgatg accttcagcc ggagcggtac ccccagttcc aaacttgaca     88200
     catcgttctt tgccgacctc gacatcaaag gatacgtccc cacatctgca agaggctatg     88260
     ttaagggcac tgcgtccggg gctgactcgg ctttcaaatg ggtggttcac tggtaagtcc     88320
     aatgaacatt acaacaggat aagaaaatat ctaaagcaaa gacaggcaca acgatgccgc     88380
     acagtactgg acctatgctt cgtcttccgg ggatttcacc tcccccgcca tgaagcccgg     88440
     tacttacacc atggtatact atcagggtga atatcccgtt gctacctcgg aggtgaccgt     88500
     caccgccgga aagaccacat cgaagagcat ctccggctcc gtgaagaccg gaacaacgat     88560
     cttcaggatt ggagactggg atgggacgta agtggattga tttcaggtcc acacaatcgt     88620
     tctaatattg actgctcata gaccaaacgg cttcctcaac gcggcaaacc agctccgcat     88680
     gcatccctcc gacagccgca tgtcttcctg gtccccagcc acctacacag taggcacctc     88740
     taaggtctcg tctttcccca tggctctctt caaatcggtg aattcgcctg tgacaattaa     88800
     attcacggca agctcggatc agacgggagc tgcgacactg agaattggca caacacttgc     88860
     ctttgcctct ggccggcccc aggttaaggt atgttcaagc cacatgcggc atcttccggc     88920
     tattggcatc cagctaacgc tttacatagg tcaacagcta ctctggtccc actccagctg     88980
     ccccgactaa cctcaactcc cgcggtgtga cccgcggcgc gtacagaggt ctgggcgagg     89040
     tttacgatgt ttcaattccg gctgggacta tcgtcgctgg ttctaacact gtaaggacat     89100
     tttgaacata gtcagatgat acgacctcgg gaggctaatg cggcttagat aaccatcagt     89160
     gttgcttctg gtagctctgg agacaaattc ctgagcccga actttgtgag tattttttct     89220
     gatcatctcg tcatttcgat ggaagcttac ccgtctcaat agatcttcga ttgcgtggag     89280
     ctcttccagt aaatattcga gacgatgagt ctttggggag cagagtagaa aatatgtttt     89340
     cgaagtagca agaatgcaaa tgacagtctc ttacccaata tcacttagct ttctaatact     89400
     ggcgaatgcc tttagaaggt gagtattaac accgagtatc aaagaaaatg tagtgaatat     89460
     agaattacac tctaaggctg aaatgacatg cgtagaagtg aaatctaaat gcatgtatac     89520
     aacagtcatc tctcaaaccc ttgaatggac caacctcccc ccaacccaga gggccttcac     89580
     attccgatca tcgccactcc aaacccactt ctgaatcttt tcctcccagc tctctgtccc     89640
     gaacagatcg acattcccca caggaccagt cttcaccagg tccgcattac catcgccagg     89700
     aacaaaatcc agcggactct tcttccccag cttgacccca ccaagccgga tcaactgcac     89760
     atcccacaac atccctttgt caaacccacc aaggtcattc gccatatcaa caaccgccgc     89820
     gccaccgcgc gtagcgaggt aaagactctc gggaacagac agtttctccc gtccatcaga     89880
     tcccttccca tccacgctct gagaatgatc cctctgccac gcagcagact gacccaacaa     89940
     ccgcgaagca agacaggcct gtcgcgccgc ctcaagaata ctaggactat atcccccact     90000
     aacatccgtc cccagcccaa ccgtaatccc ctcgtcaagc agcgtcctaa cgggacaaat     90060
     ccccgacccc agcgccgagt ttgacgccgg acagtgcgag atcttcgctt cgcgcgcacg     90120
     gatgagagcc cgctcatctg cagagagatg cacggcatgc gcgaggatgg tgcgcggcgt     90180
     caggagcttg tacttatcat agacggcggc gtagctgtcg gcttcaggga agagctcttt     90240
     cacgagcgcg agctcattga cgttctccga gatgtgcgtc tggacatgca gtgggggtga     90300
     gtagcttgcg gccagttcgc cgaggttctg tagtgctagc cttgtgcagg aaggcgcgaa     90360
     gcgcggtgtg acgatcggtt tcacgaggtt gccttccggg tcaagggtgt ggatgtactc     90420
     gattgtttgg cgggttgcga caatggagtc ttcggcgctg aagtcgtggt agtagtccac     90480
     gcagaattta gggttgtcca tgcatgcgcg gccgatgaag gcacgttggc cgcgggtgtg     90540
     acagagtgat gatagggcgt ttgtggctgg gacgtggttt gttgcgtagt aggaggcgca     90600
     ggttgtgccg tgggataaag tacgggaaat tacttggtcg tagatttgct gggctaggag     90660
     gggtgcgtct ttggggtcgg tttgggtttg atgtcctgtt tttgggtctg gtggtgaccc     90720
     gaaacgtgac tctactggaa atgtgtaggt ctctagccag tccagaagcg ttgatgagcc     90780
     aaagaggccc acgttaggat attgtggcgc gtggatgtga gtgtctgggt agagatatag     90840
     ttagtatcaa gacttgggct ttgggccatg gttgggggtt aggaggctga atttaacaca     90900
     taccaataaa ccccgggaag aagaactcgt tttgttcctc actggcgatc acaattctca     90960
     ctctggtctt cgaatcatga ctatcgactt ggccctgggc cccgatgtcg tcaatatcaa     91020
     cccacccatt ccgagtcatc agttcggcaa acccatggtc attattggct tgccagtccc     91080
     agcctttaat acgaccatca gcagcagaga cccacaaggc gccttggttg caagacaact     91140
     caggcttgga gcccgagtct gaaagaattg tttgaatgaa agtgccacgg tagacagtac     91200
     aagtatagtc cgtttgcgct tccatgtcgc cagtaataga gcccatattg ccggtaagag     91260
     acttgaaaag tccaactagc atggatacgc tcaagttgag gatagatgtg ccgtggtgtg     91320
     caccactcta aagaaactcg atcacaagta tcgatatata tactatggag aacacgcaga     91380
     tcagtctcca cagtggaaac aaggaaatgg aacgatcaaa agatcaaccc gagaccaaca     91440
     accacagaaa gaggatcaga ggcacgttca tatatgcctt ctcgttgctt cttctcgcta     91500
     ccagttgcca agcgaggggc attagataag gaatatcgcc cggaaaagag tgggtcctaa     91560
     actgcggaga atttcaagct tgttcctgct tgattcgaat gttctaatgg ttccttcggg     91620
     gcagccgagg catggattga cgggacaggg ctgcgttgaa gtcggttcgt tggaggatta     91680
     gggccacggc gattattggc gggcgggggt cggccgtctc cgattgtgat acaggggaaa     91740
     tacggtattt ggagcgggtg agttctcccc gataggttaa ttacaagcaa aaatgattat     91800
     gtatggtaaa gtagctctga taagcgtaat aaatattggg ggttgtcata gttgttactt     91860
     ctaccctttg gatactatgt attttgaact ggaatcgaat ggaatgtctg gaacactttt     91920
     gattctttga atattattct tgcgatccat ggacgctgga tgattatgtt gaatcaatcc     91980
     agccctcata aggacgtagt ctgcaggtag tcttttccta ccgtcatcaa aaataagaaa     92040
     tgttgaatgt atacacagag aagaggcgag caatggaagg atggagccct catataaata     92100
     aataaaaaag caatcagcgc ggcatgggta tcatagatct ctttttagat ctgtctctat     92160
     tcgctgtcct cgacaggccc gcaagtgcag aacaagtttt ggtcaccaaa ggcatcatcg     92220
     acacgagtca cggtaggcca catcttcttc tccaaaagca aaggcaacgg gtaagcagcc     92280
     tgctcacgag tgtaagggcg gtcccactca gcgacgagca gatcgcgctg agtgtgcggg     92340
     gacatcttca gcacgttacc ctcgcgaggc tgggcacctg actcgacctc gctgatctcc     92400
     ttgcggatgg agatcaaggc atcacagaag cgatccaatt cagccttgtt ctcggactcg     92460
     gtaggctcga tcatgagagt gttggcgacg ggccaggaca tggtcggggc gtggaagccg     92520
     tagtcctgca gacgcttggc gatgtcgatg gcctcgacac cgcaggtatc cttgaacgca     92580
     cgcacatcca ggatgaactc gtgtgcacag cggccatggt cgttggtgta caggatcgag     92640
     tagtagggct tcaggcgaga gaggatgtag ttggcgttga gcagggtgat cttggtggcg     92700
     tgggtcaaac cgcggtcgcc catcatgtta atgtagttga aggtgatggg caagatgctg     92760
     gcactgcccc atggagcagc ggagatggga ggggaggagg tgtcaccacg cttcgactgc     92820
     aggtactcgc tggtggggtg cgagggaagg aagggacgca ggtgctcgcc gacgccaatg     92880
     ggtccgacac cggggccacc gccaccgtgc gggatacaga aggtcttgtg aaggttcaag     92940
     tggcacacgt cggcaccgat ctcaccagga gagcagagac cgatttgggc gttcatgttg     93000
     gcaccgtcca tgtagacctg gccaccgtgc tggtgcacca agcggcaggc ctccttggca     93060
     ccgggctcga acacaccaaa ggtgctgggg taggtgatca tgaacgcagc caactcgtcc     93120
     ttgtgcttct cgcacttagc cttgaggtcc tcgagatcga ggttaccggt cttggtgtca     93180
     cacttgacgg tcacaacgcg cataccagcc atggcggcac tagccgggtt ggtaccgtga     93240
     gcagagacag ggatcaagca caggttgcgc ttggcatcgc ccctcgcctc aaagtacttc     93300
     ttgataacgc gaagaccggc aaactctccc tgggcacccg aattgggctg cacagtaacc     93360
     tcagccatgc cagtgatatc agccagctgc tgctccagat cgtcaatcat cttcgtgtaa     93420
     cccttcgcct ggtcggcagg catgaagggg tgaatcttgg agaactcggg ccaggagacg     93480
     ggaatcattt ccgtggtagc gttgagcttc atagtgcagg atccgagggg aatcatggag     93540
     tgagcgaggg aaagatcctt cgattcaagg tggtggatgt agcggagcat ctcagtctca     93600
     gagtggtagg tgttgaagac agggtgagtc aggtaagagg aggtacgctc aaggctggcg     93660
     gggacagtgg tgaggccaag agtgccatca acctcgaccg gagaggcaga cttgtgagcg     93720
     gcaaaaacat ccaaaattcc cttcacctca tcccggccaa cagtctcgtc cagggagaga     93780
     ccgaccttgt ttccgcccag acggcggagg aagacagagg cagcgcgagc ctcggccatg     93840
     atagcatcag cctctgcagc actgggcagt tcaatggcca gagtgtcaaa cacagcgccg     93900
     ccatcagcgc tgttcgagcg gaccgggaca ttgtagccca ggccaacaag cttctcgcgc     93960
     aggagtgacg tcatggacat gatacgctgg gcaatggact tgaggccaac agggccgtgg     94020
     taaatagcat acatggcagt catgttagca agcaaagctt gagcagtgca aatgttgctg     94080
     gtggcctttt cgcggcgaat gtgctgctcg cgagtctgca gagcaaggcg cagagcccgg     94140
     ttaccgaggc gatccttgga cacaccaacg acacgaccgg gcaccttgcg cttgtacttg     94200
     tcggcacaag caaagaatgc ggcgtggggg ccaccgaagc ccatgggaac acccagacgc     94260
     tgggcacttc cgaaggcaat atcagcgcca aattcgccgg gggccttcag aacggtcaaa     94320
     gctagcaggt cagtggctac actgaaagta ccaccctggc cgtggatgga gtcacccaaa     94380
     gcctggaagt cgtagatacc tccctcagta tcggggtact gggcaaggac accgatcagg     94440
     tggtccttct ggtccttgac gagcttgaag tcatcggcca aaatatctcc gatcacaagg     94500
     ttgatcccga atccttcggc gcgggacttc ataacagcaa tagtctgggg gtggcagagg     94560
     tgagacacga cgaaggactt gtcggccctc ttctgtttgg aagcaggcat tgtggcgaag     94620
     gacatggtca tggcctcggc ggcagcggtg gcctcatcca aaactgaggc attggcgaat     94680
     ggcataccgg tcagatcagc tgtcagggtc tggaagttca gcagagactc cagacggccc     94740
     tgactgatct cgggctggta gggtgtatag ctggtgtacc aggcagggtt ctcgagcaca     94800
     ttgcgctgga taaccggggg cacaatggtt gggtagtaac cggttccaat ataagtcttg     94860
     ccggagatat caatctgctt ccggtaggtg tcgagcagct tgagcatatc ggtttcgccc     94920
     aaaccgccct gcacactaga ccggtacagg ctgatatcgg cgtggggctc ggagaccttg     94980
     aggtccttct tggaaagaat gtcctcaggc agaacctgct tcacgaagtc atccaaggat     95040
     gccaccggcg gatcgagcac ggcgagcatc tctgccgcgg cgtccgggga ggggccaatg     95100
     tggcggcggg ggaaggtatc gagaggctgg aagatatcct gggggtgggg atctccatgg     95160
     tcggagatgg agctagtata gacaccacga cgggtcgcgg gctgcgaggt atgcactact     95220
     ctccgagtgt tcaatggtga caatgaagct cgggtaattg agggtacgcg aacacgcgac     95280
     cgcagagcaa gttggcgggc gccgcgaagg gcgaacaatg atgccgccat actgagaccg     95340
     gaggataatg agggctttag gggaaagcgc tcaccacatc cacaagtaaa tcagtaaatc     95400
     aaagtgagga tgaagaagaa gaacagaagt gccagacata tagaaattaa tatttattgc     95460
     ccacacctct tgccttttcc ctgtccgatc gtccgatgac ggagaacatg tcgggaaact     95520
     tagagcgata agaaattata agaaaccctt cttatccgac caatcacagt tgccactgtt     95580
     tgccacgggc cccagttcaa ccactcaccg ccttccagtc ggagcaaatg gccggtttcc     95640
     cgtcggaaaa gtcgtgccta ggcatatcta ctccacgaat gcccccaggg agggaagagg     95700
     gggggctcca agctccgatg gcatcataac tctgagcttt catgcggttc ctttggaaac     95760
     aatattgaaa atggaaatgg cctttgcatt actatcgtga tccaatcttg aataggtaca     95820
     tatttccccg acctcaaatc gtataccgga aagccgcatc gccctcaatg acccgctttc     95880
     cccgatccgc ctgcttatta cagaaccgga accacgcact caaagccaga accagcagga     95940
     caatgagaat gttacacctg gtaaaacaca gtcagtacac gaatgcaata tgagacagaa     96000
     tgagggacca cctacgcgag agcagcatat attcccggtc ggtactcggg cgcgtccttt     96060
     tcccgaaaca ccaagctact cacgatacca cccaggcctc caaagcctac aagtgtagca     96120
     ctggagaaag cccgcgtcca ctggccgcgc acattgttcg cctggtatgc catgcaggac     96180
     gggatattag cattagcacc ggccacagtg aagaacacgc ccacgtagcg gacagcatcg     96240
     ctctttgcga atcccatcat tggcaggcca atgattgcga gcagggcatt gaaaatcaga     96300
     attggtgcgc gcatgcggta cttgtcgcca acccaggctg tgccgtacat cacgattcct     96360
     gcgaacccgt agggtggagc gacgaggcat tgggcttcgc cgacgccgaa gcccatgcca     96420
     ttcatgagga tgatggggag gaagtaggca atggcgtaag taacggtagt caggcagctg     96480
     ggatacggtt agcagaaatc caggtccgtt ggaaaggaaa cgcacaagaa gatcatggca     96540
     aagccccaga tcttagcatc cattgagggt tttaggaact tcttgagaga gaaggcttcc     96600
     atgtctccat catttcggtc ctcgttaatg cgacggacga cccatgcgca ttctctctgg     96660
     tttaggaagc gccaggactt gtgtgcgcgg tcagggaagt cgacgaggaa gaaatagcac     96720
     atgatgccaa ttacgcccgt gatctatgct tgttagctcg ctgattttct ttcggttgaa     96780
     ccaactctgc gtaccactcc ctcgaggatg aaaatccatc tccagccggt caacccctcc     96840
     cttccgtgca actgcatcag accaaaggca aggatacccg ccaacgcaga agcgacgcat     96900
     ccaatgagat agaaaacgga gaatcgcttt tggacgtcgt ctttgaagag ttagcacttt     96960
     gcagccactt ggaaggtctc tttgagcgat ctctcttaca tcgggtatac cagcaagata     97020
     gcaagtagac gcatccaggg aagtaaccgg cttccagcac acccaaaagc acacgggttc     97080
     ccatcaacga gccccagtcc tggacgaaac ccattccctg cgacggtcaa taaaccagag     97140
     taatgttgag aaagcggaaa gtccttacaa tcatgattcc cgcccagcat acaataatcg     97200
     aggacaggaa gtaagttggg ccgatttttc gaatgatgac cgtcattggg ggctggaaga     97260
     taatataggg cacgaagaac atcaggacga taatggacta ttcaaatgtt agctacccgc     97320
     cagtgaaatg tgatcaatgt gtataaacat acatatcgct cgccgacatg gagatgcaat     97380
     tcttctttca gcctattcag aggtcaacca tcatcgaaca caattctcct tcacggcaat     97440
     gttcttaccc tgcaacagca gccatgctca gattcgtgcg gtccatgagc gaaatgcaat     97500
     aagccaatcc agtcatggtc accagacgta gatcaattcg tcgaatgatc tttttctgtt     97560
     cctgtggagt gaactcatca tcttcgacgt agctcggagg cctcttcccc gcgatatcct     97620
     cgacgcggtc ctcagcaggc ggtttctcat cgatgggagt catggacgcc atgctgatat     97680
     gtccaaactg aattggagta tacaatagac agacaagatg tagaagaaag caataaaaga     97740
     ggttgagaag ggaaaaagaa aaaaaaataa ttttaatcga ctttggtcag aaatagaaga     97800
     cgaagctgca gccttatcta gaaaacgaca agaccagcaa ggataagtat atccaagtag     97860
     ggatataccc ccgacataat ggcatccgta cttaaaccag ccattcaaga tcgacggtcg     97920
     cctattacag cccgcttcaa gctgcccagg aaaatcccca agaaacaaga cccatcgaga     97980
     acgcaatagc cgagagaaag tggccaagtg cctcgggaca agtacaacta ccgtacgaga     98040
     acggcattct cagagatatt gtccgaaaca aaggaggggg aagtcacccc acttagtgag     98100
     agcctgtacg agtcatctgt tgcgcactga actggttaga gtcggtggct gctttggggg     98160
     gggacaatcc ggagaggcga tggggaagga aatgcggggg aaggtacttg gcaacttggc     98220
     aggcgcgttg actacgtgat acactttggt ctcccctatt tggcttcaaa tcttgtttgg     98280
     agacttttaa tttgatagag atgtcatttt tgtggggaga actggagatg atctgtccta     98340
     ttccttgcca atgttgcttg gttagggctt tgtctttgat tcacgcactt tgcaattgtt     98400
     cttaacaggc aaagaatcca ccaaaacacc tcgtttcctt aaataccaag ccaagtaagg     98460
     aggcatctat tgattgatct cgtacttgtc ggggaagtat catttgggca gagttccggc     98520
     caagggttag ctatgagttt agggaacttt taacattccg tccccagatg gcttttgata     98580
     cgtcgaagct caaaccctga ccggtcactc cgaaagtgta aatttcccat gtgggaaacg     98640
     cctctaatga tcctggggtg atgatcccca gaccgtataa tcctggtatg actagatagc     98700
     gttgccgtat atggtgatat cattatgcag aatgcggtaa cacagcctat actccaacca     98760
     gtcaagggct tctattgaaa gttagtcctc agtacaccga gtctgtcatt tgacgccatg     98820
     tggtgctttc aagtatccac cttaaagagt tccaaggttg ttataaggac acggagctcg     98880
     aatatagaac aaaagcctta accatactat tgggaattaa atctcaattc ttttcttttt     98940
     taatacctcg gttcaacctc ctaagctaat ctcgtcaacg gtaacttcca ttatcctcgt     99000
     atccctcctc ttcttcgtcc tcttccaaaa gcagactctc gcgttcttcc tcatccaccc     99060
     gatcctgccc tcccatctgt ctcacagaca cgaaaacaaa gatcacgagt gctgttccaa     99120
     cgacgaatcc ggcaactgcc aagataacat tgattggaat tgggtttcca tcaaacttat     99180
     tatgtgtcaa cgcgtcgagt ccgtactgag agaagtttgc gatccccgag aggcaaatga     99240
     tggcaccgta cacacgccca aacgtggcaa agccgaagac tttagtagta taatcactag     99300
     agccaagatt agtaggcaga gtatagcagt gagaggggga aaagcaacat acgacatggc     99360
     cgagtaatag agaggtcgga gtaggacgaa gagtaaaacg gtcacataac cagcccaaac     99420
     tgccggaatg gagttcagca caccgatgac cgtggtgaag agcacaatta tgccaagcat     99480
     cgttggcaca ctaaggcgat caagcaggaa gccgatcacg ggcgtgaaga gaacacccgc     99540
     aactggcagt gcgacgtcga aaagggcacc tatcttgtct gccttttggg ccgatccgag     99600
     catgtactca tactgcgagc gaaccgtcgc gataaagtag ttcatgcgaa tcatctgcag     99660
     aacagtcatc agcgtgatca ggataaacca gggcgtagcc atctgcctgt gcgccggcag     99720
     gccgtgcaat acaccccaga cccaactcgt ctgctggcga tcctcttctc gatccgcacg     99780
     catctgccgc tcatctctat cgccgagaac ctcgtcgatc tggcggatct ttttctgtcg     99840
     ccgctccgct cgcttcttcc gcacctggtt tagctccgct gtgctctcga tctcatcatc     99900
     agagtcgtgg acatcgcgag tagcatcttc ggccctttcc attttgtttt ccaattgcag     99960
     ggttgagaca tagtcccgcg ctggcatgat ggtcaccagt gcgatgaaca cacatgcggg    100020
     gactatcaga tatcccagaa agaacttatc cggggtgaaa gatttgccgg aagcctcata    100080
     tacgagccgg tagaagagga acacagcagc agaggcatcg aaggcaccag tcaccagcgc    100140
     gacgatcgtc cccgcatatc tggggaacgc gtttgcaatc tggaacgagg ggacaaataa    100200
     aaaggtaccc gccagagcga ggaagaaatt ccccgcgata tagccatcaa agccaggttc    100260
     acggaatgca aaggccataa tgacaccacc aacagcaagc aacaggcaag aaatgaacca    100320
     gcagacccgt gatccatatc gatctagaat cgtcccaact ggaagcgccg agacattggc    100380
     tgttatcgaa gcaatggtga agaacaggtt gagcctggca gttgattagc aagcatagct    100440
     ctagatggtc tgtgcgacaa acacacctaa ggtcctgctg tgagcatagc tcaagccctt    100500
     catctatttc ggcaggagtg caatgcccgt ggtaaacgcc ttcctccaca aggacaggct    100560
     tgagcgctgc gaagccaaac acgatccccg acgcgctcca gcacgcgagc acggtgacga    100620
     cgacctgggc ttgatggggg tcagcagttt gtctcacact gggcggcaga gcacagacct    100680
     attctctttg cggaggagtg tttgtacgct ggtgttccag gccgcgtttc tgcgaccggg    100740
     atggcgtcgc taggttggat gacatcgtag ctgatttttc ggcgaatggg agcgaaatca    100800
     tagtcctcaa ctaggtctgg ttcgagttcg cgatcaatgc cgtcgatggc agaaacatgc    100860
     tgcaccaggg acattgctct gtgttgaaca gatgaggtgt tgtggagggg aagttggcct    100920
     tgtcgtggca aaaacttggt tctttccccc ctcgcgctag actcctaatt tacgcagggc    100980
     agcttctacc catatatatc tctagcatgt gcaatgtctt ttgactggta tatcttttat    101040
     ttacacgtgg atagctactt gtgttattgt cgtgcttaat atagcttgga tctacgagca    101100
     acgctatggc tatggtacct ccgatttcga agttactaga actacctaag tagctttatt    101160
     tagatattgt agtagtttac ggataacgta atccactagc gagctggcca cactagcgag    101220
     ctggccaccc tacaaaaaac gcgtccatga attagcactt agtcaattaa actatctacc    101280
     atgccaccaa ttcgctccca atcctccaaa gaatcaactg agcaagaggg caggatctta    101340
     ttagctatca aagcttttaa aaataaagaa atctcttcaa ttcgtgaaac tgcgcgccgt    101400
     ttcaaaatcc cccgttcaac cctttcttca cgtcttaccg gaatacaaca ccgcgcgaat    101460
     tgtcgcgcaa attcgtgtaa actgacagaa attgaagaag aatctcttca aaaatggatt    101520
     ctctctatag attcccgggg atcagctccc cggccgtcta tagtacgaga aatagcgaat    101580
     cttctccttg aaaagcgtgg cactaccccg gttctttcgg tcggcgaaaa ttgggtgacg    101640
     aagtatgtga aaaggcatcc tctcctatcc tcccggtttt cgaaacggta taactacgag    101700
     cgtgcgaaat gtgaggatcc aaaagtcata aaggactagt ttgatcttgt ttaaaaaacc    101760
     atcctacaat ttgggatcca cccggacgac gtttataact ttgataagac gggttttgct    101820
     ataggattga cagcgactgc gaaggttatt acgagaagcg aatactacgg tcggcgagca    101880
     cttttataac ctagaaatcg tgaataggtg acggctatcg agtgtacgaa tgcggctggt    101940
     taggcccttc caccgtgtct gatttttaaa ggcaaagtct ttattgaatc ttggttcgat    102000
     agtcttcctt ccgactagcg tttcgaagtt agtcctaatg gctggactac tgacgaaatt    102060
     ggacttcgct agcttgaaaa gctctttatt ccgaccactt ttgtacggat aaagggggta    102120
     tatcggcttt taatactaga tagctataga agccatttaa taccgaggtt tgataaaatt    102180
     tgtgaaaaaa aaccgggtta taccaatctg tatacccccg tatttatcct atcttttaca    102240
     acctctagat ataggctgtt ttgcggtgtt aaaacgagcc tataggagac tagttgaatt    102300
     ccggatgcgg tacggatcca attatatgga taaattggac ttcctggatt cctatcctac    102360
     cgcacgaatg gaagctttta aaccagagat tgttaaaaac agcttccaat ctgccggttt    102420
     agtccctttc gcgccagaga gagtgatttc gaagcttgat attcggctta ctacactaac    102480
     ccccccccct agccggggta gtgattggga tccaaaaaca ccttcaaact gcaggcaatt    102540
     ggaaaagcaa gcttcctcta tcaaagcatt gcttcgtatg agatcaggaa gtcccccaag    102600
     tccgctgaat tccgctataa atcaggtttt aaaagcttgt caaatgacga tgcaatccgc    102660
     tgcacttcta gagagagaag tgagtgattt acgcagtgaa accgagaaga agaagcaaaa    102720
     gcgtgctaga tctgggaagc atctatacgc agagagcggt ctctccgtgc aggaagcatc    102780
     tgcgctgatt atacagccgg tggaagtagc tgaacccggt cccggtcagc atggtgaatc    102840
     aggtttacaa ccgcgtacaa aacccccccg ggggtgcgga gtatgcagga agccaggaca    102900
     taggagagag acatgtccag atagatgatg tttttttaaa aatttaattt aatggcgttt    102960
     tggttgagat aaatggattt gaaattagta tgttggataa agtggccagc tcgctagtgt    103020
     ggccagctcg ctagtggatt acgttaagac aagctatttc ccagctccga ttcgcggggg    103080
     attcgccaag attgccgctg aggtcagaag gttttttcct tcaatttggt ccaatcacaa    103140
     ctaatatagc ctagaagacg tctctcattt tgtggagtgc cctgaattaa ggtgaacgca    103200
     tccatggatc atcctcgatt tggcctatct atgagtggaa atttctagca catgatatac    103260
     atcgaaacac accccttggc atatactata gttattaaaa tccataccct tctcagactg    103320
     tagcagacga tttccccttc ttgattgacc tccattccat cgtcagtgcg gggacaatca    103380
     tcagacagga cacagccacg gcaacaatga atgagtgccg aaggccatca ttgtataaag    103440
     tcagaacctg ggccaacttg gcagccggga cagcaccaga gaggcccgtt gccccagccg    103500
     ccaggatctt ggtgacatca attccctgga tgtggagtag atttgctccg aggtaattct    103560
     ggaagaggga ctgagcgaca gcaataaaga cagcaccacc gagggactgc gcgaagaaca    103620
     tgagggagat accaatggag acttcatcca taggaagaat ggtctgcgcg gccatagagg    103680
     gctgctgcat tcccgtgccg ataccgatgc caaacaacac ctggtacccg atccaggcag    103740
     cgtggttggt gtccacctgg aatgtcgtca tcaaccctgc gcccgttgac atgagaatcg    103800
     ccgcaacgaa catccacgga acgtaatatc cagttgcagt gatgattgac ccggagagga    103860
     tggatcccac aacaagcgcc agcaccatgg ggatcgtatc aatgccggag ttcacagctg    103920
     atgtgccgcg cacgccctgg aaccagagtg ggagtgtgta cagcatagat atgagccctc    103980
     cacccacaca cagggcatag acgactccgc tgatgatgct gcgctggttg aagatatgag    104040
     gcggcaccgt tgcatccttc ttaaggcgga tctgcacgcc gacaaatgca atcatcagga    104100
     ttcctgcaat gacaaacaga gcgatgattc gcccgttgct ccaggggtag gccgtgccac    104160
     cccattgcag ggcgagcaga aagcagatga cagagggcag gaagaacacg cttcccagag    104220
     ggtcgaggcg gaggattttt cgcttccatg tgcacggttg gggattgtgg gggacagcca    104280
     ggaaaatgaa caagacaacc atggtaaagc cgccgacagg caggttgatg tagaagcacc    104340
     agcgccatgt gacgttgtcc gtaaacgcac cacccatcaa aggtccgatg atcgacgaaa    104400
     tcccaaagac cgaccccatc aggccgacaa agataggccg tttggccagc ggcacgatct    104460
     gtgcgattat cacggttgca ccggaaaata tgcctgccga cccaataccc gctatcgccc    104520
     gccccaatat gaaggcctta gagttcggcg caccgccgca gatggccgat ccgacttcaa    104580
     aaataaggat ggcgatcagg aagacagtct tggtcgagta aaaggtgtac accttacccc    104640
     aggatagctg ggtggcacaa cttgtcagca ggtatgcact tgcataccaa ctgaggtcgt    104700
     ccagagcatt gaaccggttc gcaattcggg ggactgccgt ggcaaggatg gtgcgatcct    104760
     gtagtgttca aagttatgtt agtttagatc cgcgtgagca atattgaacg caacgttcat    104820
     accagggcaa ccaaaaacat agcgaacaga attgaaataa taatagctat tagccgggcc    104880
     cccgttggca aatgagtctc atcttctttg atctcggagg gcttctcggt ggtagtcgag    104940
     acctggtgcg gctggtggtc gggctgctct tcgatcgatc gagtcattgt ataacgcaag    105000
     aattattaaa tggcaaccat atgtcttttt cactgatata aattgataga caaccagggg    105060
     gaaaagcaga gttatataat agtaggtagt tagtggtctc gggggtgaag gtgtattcgg    105120
     cgccgaacaa tatagagcaa atttcagttc ggcgccgagc taaagaacgt agcaacgccc    105180
     ttcgctcctt ctcaagcgta gcttattatt ttgtcagttt ttggaggtat ctctacactc    105240
     tattgtcatc atcattttta ttcttttcaa gaatggaaag tgcagcgtgc tgattcatgc    105300
     ctccgaaacg gacaggaatt caatgcgccg gaaacatgtc tactttgtgg tatatacatt    105360
     ttggcgtttg acgggggaac aatgagcaaa gatcacctgg acgtgctcaa ggagtctcaa    105420
     tgggaaatcc atcgcaaatt cccgattcct gagcatattc tcgtgccatc gaccgaagtg    105480
     gagaataaga ctttctccaa atttccttgg ttatcatctt gctatcagcg agggggtaag    105540
     tcgacattct catagaaaca tttaaatttc aagctaaaag taaatccaag ctgtcagata    105600
     tgcattttcc tcaaaatatg atctcacggg aattggccca gttgcacgtc tcggttgtca    105660
     gccgtaccac cttccaagag acaaaaacac cgcacgaatt tcgggacgag aggcgatacc    105720
     acagtatgat gatacaatat tcacacattt ccacccagga ggttactgga tgcatcccag    105780
     tctttataaa cacaaaaata tgggatatgt gtttcactat tattgttggg agatccttgg    105840
     ccatctggta ggaaaaaggt tgatcgagga gatacttggt caagttgttt gaggccgcga    105900
     ggcagtattg gaaaacccat aaaggatggg ctgttatgac ctagatacct tatttcgtgc    105960
     ccagctcgat gaggttccat acgtgggatg tgagagctac gttcgcggct gtgatatctt    106020
     tgtcaatcca tggattatac ccgagcttca aagtacaatc caacttgccc aaaatatggt    106080
     tggaaaacgc aaaagctcct atctcaacag acttccactc gaaatctccc ttctggtggc    106140
     ggaaattatt tgccctatca tctacactca atccgatgtg cagaaaatac gtaatatgtt    106200
     atccgtgttg gcattgaatt taccagatgc cttttggaga agccgattac aatccaaacg    106260
     tgatttgttc ttcgaggtgg atttgctaga ctgattcagt ggactggcag ctcttgtggc    106320
     tagagttgat ggaccttctt tgcgataaat ggtataactc cagtggattg gcacaccgcg    106380
     agtggttact tggaccaatt agggggatca tcgcaaattt tcaccaaatt cgacagagac    106440
     attttgctgg aagatagtat cacaggttcc cgcgttcgct cttgctttga catatcgagt    106500
     tatggcactt taatattcta atgaatccat ttaaccaacg atgctaaaag tccacatcct    106560
     ttctcgaatt tctcagagct cgtaactgca atgcgttcgt cttgatttaa ttcatcattc    106620
     cctaagtcgt ctctgcaatt tctttgacgg ggtggtcctt tctatcgaat ttgttgactg    106680
     cagctcttcc gacaatctgt gatgggtatg acgtatgttg gcccgacgcc aatgacgtag    106740
     gcctggggca cccgttatat gtcaacatgg ctgatcactt ttcattttac ctgttacctg    106800
     ttctatattg tcgattggaa ttttttacat agcatcttct tgtgttgaca tttgaaacga    106860
     gaataatctg caagaagcca agttgaacca acaacaaacg cagtacaccc gttcaaaaac    106920
     cgtacaaggg gagcagcaca aacaacacaa tggccaacat atcaattagt gccccaggtt    106980
     tgagcagcgg cggatttctt tacaacaatg gcaacaataa tgcccgacta tgcgtcacag    107040
     ccgagaccga agattttgac atggaaatca tcaagaactg gcaagaggaa ggattcgatg    107100
     tcgtatacct cccttataac ggcggaggaa aagactacgc tcgccggctg cagtctgtaa    107160
     aggacggtct cggtgtaggc gaaaactacg ccgtggttgg tacgcacagg attccctctg    107220
     aacatgataa actctcagta tgatgaactg actgaccaaa ttcttagcct acggcgacgc    107280
     cgcggactac tgcctcgact actacattaa ttccgtcaac tccagtcgac tctgtgctct    107340
     ggtcgcctac taccctagcc taatacctga cacgcggtca cgattcccac tctcactcca    107400
     agtcctcgta cacttggcag gcgagaccgt ggacgtactt gttcagcccg ccgcgcttgg    107460
     cttgcaggga aagaaacgcc ggcagacgcg gccgatcaat gctggtattg ggaccggaga    107520
     gcgtttggac ctggcgtacc cggcgtttac gtatgacaat gccgtgcccg ggtttgcgga    107580
     gacggacctg gaggaatatg atcatcgggc ggccgatcta gcctggacgc ggactttgaa    107640
     ggtcttgcgg aagggatatt ccagggatcc ggattacgag cagcggtatg agcagcatgt    107700
     ggagggtaag ttgcaagcgc agagggatcg agggatgacc ggctaattct ctgttaggca    107760
     agtttttctc gtcaaacgtc aggaaaacga tggatggtta tgttcagcac aaaacgccgg    107820
     gtgtgaccta tacgccgaca gtcagcggag ggatcgggaa aaaggcgttg cgccatttct    107880
     atgaacaata cttcatcggc aaactgcccc catctatgcg cctccgactg ctatctcgta    107940
     ccacaggacc cgaccgcatc gtggatgagc tgtacgtggg ctacgagcac acacaggaaa    108000
     ttccgtggat gctacctggt gtcccgccga caaacaagcg agtcgagatc atcctcgtga    108060
     gtattgtcag tatgcgcgcc ggccgtcttt actccgagca cgtatactgg gaccaagcca    108120
     gcgtcctcgt tcaagtcggt cttctggacc ccaagctgct gccagatgga gtgcagggtg    108180
     tcgatcgact gcctgttgtt gggcgcgaag ctgctcgtcg catcctccat gaggacacgg    108240
     agcttgaaca ggaagactac cataacaaga tgatccgtcg agcgcgtgcg cgcgcgagga    108300
     gaagcatgaa tcagagctct cgcgcgtcgc aggctggcga ggagcctggt cttgacctga    108360
     agagtgacgt tgagcagtcg ttgcctgata ggagtcgaaa taagggcaag gctgttcaaa    108420
     aaacaaagcc tgctagtctg cagcggacag ccacggaaac ggctgagcac gtggatgggg    108480
     acggcgctga tacagagaca gagtttagtg caaaggctag gtcggacact ggcaatcaag    108540
     ctgcctatgt tgaggatgcg gggaacgaca gtgccgaaaa cgggtctaag cagacatgac    108600
     ttgcaacttc tatctctctt tgtcaggata accacgagga cattcccgtg tcccttgttt    108660
     ttcctctggc gattcataag ctcagttagg gatgttcttt cgaattttta ggcgactgtt    108720
     tcttgattat gagcgatgtt gtacatgtcg acctctcctg tttagcgcta atggttgtca    108780
     ctattttgga tactatgata tttgggcaga catccatggc gacaagagag ttgaagcctt    108840
     caacgtaagc aactacacca gccatggata ctgtaaaacc tcgggtcaat ccttgaccct    108900
     gatgaaaccg ccactgggac cgttcatccg gactctactg ctcctaggag ctcaatctgt    108960
     tcctagagat ctgctacgga ttcccgggac cggctgaagt gactccagag cgtatgagtg    109020
     ggtcctggga gccttgttgc tcctagagac aggtagggct cccagaagca gccgtagacc    109080
     ccctaggatt cagtgctagg attcagtgga gtgcctgcag agccgactcc atctaacatg    109140
     ttgaatatca gcacacgtgt gtagcgagcg atgataatga gtagctcagt attttgaggg    109200
     taccgctggt gattggtggg tgtggtgtgg ctcgatggag atacgataca agcacaactg    109260
     tccgaacctc gtgccctcca aatgagagga catgaataat gcatgcctat taccacctgg    109320
     cagtcccaca aaacctgtca tatagaaata tcagccctgc ccagggtcag gcttgtcaag    109380
     agactgagtc agcacgagga gtcaaactct ggaaacctgt tggaataaaa tacggcatta    109440
     ttccactcga ccaacacaaa aaccacggtt aatgtgtata gcctaatgga ggccataccc    109500
     cagtttgaca aaacctaagg ttggaagcat tgttatgcct aaggcatcaa caagctcgtg    109560
     ttacgttaca gggtaactgg gtagaatctt ggcgcatttc cccctcaagt ttccttccac    109620
     tgtcaaacaa ccccctgtta tgctggcttc gactttgtgt cagtcatttg ccgaaaccac    109680
     ctctgataaa tatggaagaa acagtcgccg agttacgacg tcagcttgag gaagtgagac    109740
     gcgcacggga agaagagaag agagcgcgag aagaggcaga gcgccgtgga gaggaacaaa    109800
     gacaggcgcg agaaaaggca gaaggacgag tacagcacaa cacgctgctt ggtcttcttg    109860
     atcggtgcca catctctctg tctcaagcga tccaagttga gaccgacgcg gctctcacga    109920
     ctcaaggcga tgcgactgat ccagtcaacc gactttaccc caagcgtatt acaccttggt    109980
     gtgaattccc cgatctccaa gagaaaatct ggaagaaatt cgaccgcata ggcaccttca    110040
     cttcacgacc gctcttcccg tctaatgaac aattagatta tgtcgctact aacattcagg    110100
     cccggccaat ttattctgaa gcgtctatac ggaattttga gcgtgaaacg gtggatattt    110160
     ttgtcgaaaa agtcattgag gcgctacgcg acgatgaaac tcttcgacgt gagtttggta    110220
     tcaagggtcg agtcacatgc tacgacggcg cggaaacctc gctcgagaac agcatggagc    110280
     aaatgactct ccagaacgcg cgctcgcccg agccactagc gaacaccaga catggcagaa    110340
     aagccacgca gaacccgagg acacctagca ctccacagaa gcgcaatcgc cgtgctaacc    110400
     agttttgcgt acataccgtg gctaacgagc ggaaagaacc cgtttacgca gtggagttca    110460
     aggcgccgca taaggtgaca atcccagaat tagtggcggg cttgcatgag atagacctgg    110520
     ctctcgtgat gtcattgatc aggaaggcga tacattcgag tatcactcta cgcgcctcgt    110580
     cgccgccgtg gtcacccaaa tcttctcata catgattgat agtggacttc agtacggcta    110640
     catctgcacg ggagaggctt ttgtttttct ccgtattcca gaagatccta ctgttgttca    110700
     atactactta tgtgtgccaa atcaagatgt acaggccaac gatcaatacc gcctccaccg    110760
     gactgctgtt ggccaggtac ttgcgtttac tcttcaagcg ctcgccgcca aggctccatc    110820
     ccaaaaatgg catgatacag cgcatgacaa gcttagtact tggaaagttg aatatttgga    110880
     cattctacgg gagattcccg aaactgtgcg cacccaaggc cggccgactt ctaactatcg    110940
     accctctcac tggaagtttg aaccaaaaag acacaataca cggtcccgcg ctaggtgtca    111000
     accagggaat tcgactccaa agcactcgtc tacggaagac agcggcagtg tggaagaaca    111060
     ccattctccg tctaccgcag cagcagcgcg cagccaggcg agccgcgaaa agtcgagcca    111120
     cgacagaagc aacaaacaac ggcccggcga tagacgcggt aggacggaag cagaaccaaa    111180
     ttctcagaag aattaccagg ttacacgagc gtactgcacc atagactgca tacgcggcat    111240
     agtcaatcga ggtcctctgg acaaagaatg cccaaattta cagagccacc tgcagcattc    111300
     tagcagtcac aggcattcga taggcccatc agagttcacg cgcagacttc actgtcaact    111360
     cgtacggaat cgaaacgagg gattcgaaca attacacgta cgcggccgaa cgggctacct    111420
     tgtgaaggca acccttctaa cgcatggtta cactgtggtt atgaaagcga ccacggcaga    111480
     gaagcaacat cgtcttcaag tggaggtgga aaactataat cgccttagaa atctgcaggg    111540
     ccaacaaatt cccgtttgtc ttggagcttt caaaccaagc atttcatatt ggtaccacgg    111600
     agagttgatg gcgcagataa tgatcttggg ttggtctgga atgcgacttc agcacgtcat    111660
     taacaaagaa aattccagct tctttgacca ggagcgcaag aaagttcttg ctgtgctaca    111720
     gtcacacgga attatccatg gtgatagtga gtggcgcaat atgttatggg atgatgcggg    111780
     ctgccgtttg gttgtcattg atttagagga tatgaagtgg ctgaaacgtc ctcgtgcact    111840
     tgaaccagcc tcaggcaaca cacgtcatgt ccatcgcgtc cgggatgaga agagcaggca    111900
     aaacctctta tctagttctg ctggcgtccg cacatgatgt ttctagacat atggctcagc    111960
     cttattgatg ccgatcatgt ttttgtattc cgatcacaag gcggtaaaaa gaatgctctg    112020
     aaggccgacg aaacaaaatg cctacatgtg aacatgccct gctttacaaa ttctcggtca    112080
     ccacattatg ctgctgatca tagaagcaat ctgtggagct tcagaactgt ggttcattct    112140
     cattacatgt gaacaagctc cccaagagac taataataat tgacgtccca aaaaattccc    112200
     tcattacggt agtttgatca tgacattgcc tagtatacaa atcattatct caccttcaga    112260
     cactgtttct tgcttggaaa gttaggtggc taaggcgaag tactgaggag agggaaggga    112320
     aagaaggcag aggggctggg gacagctgag aggcagaaag caggatccag gagaaggtgg    112380
     ttaaaaggaa tccaggctcc ttttggtagg agcctaggtg caaatcctat atgactaggg    112440
     aagatcgaca ttgtaacccc gggatcaggg ttagcattaa ctatagtagt tataactagt    112500
     tagaaaaggc tagttagtgt tagtgggaat taacttggat tttcaacaaa tcccatatag    112560
     gcagttgcaa ccaccactga cgttgcatta taaaacagtc cgaaatgttg ataggagata    112620
     caggcttcat tcttatatag agagagggag ctagtaaacc accttagaaa ttggaagtgt    112680
     atgtatttgt ataggagaaa aagcgtcatc ttcatagaat caagagatag ctgatagaac    112740
     tataccttat taagtcggct ataatcgtaa ttcaagtctt ttaattcttc ttccggtttt    112800
     aatgcagggc tctaggccag acccaggcat tcaggcacca ttaattgtgg gaaaaggggt    112860
     ttgcacctta ttttcccatg gcgtcccaca ggcgatagac cggacgggtt cattgggaga    112920
     atctcaatga gttcctgcgg tgacagtggc gctcctgaac tgttgggaag cttttgatga    112980
     tgggcgggaa gacgtttgtg acgtctgact gatcggtcaa ctgacaatgc ttccaaggtg    113040
     cttcagttgg tttcccaagc gtcctgattg tggactctct caaaggcttc accaaggagt    113100
     cttatttgca cctcaaactg ctattcgaat tacggatcga attgccactg acgatcctct    113160
     caattctgct tgtctctttg ctcattttga gtattcaaga cagtaaataa agtatccgaa    113220
     ggcttccttg ccagatagtc ataaaaaagt ctcgagatca tgtgcaacac tgaaaaggca    113280
     cagtatttcc agcccataag ctgacaccac caccgtcgtc gtcaccaagc tgctcgattc    113340
     aaccaggcta aatggctcgt tcttcgtagt tcactttgct tcaaattact cactcacgcg    113400
     tcctcgccta actcacgctg aacagcaaac ttgacagctt ccaggacatc ctcacaaact    113460
     ttcctaggag gatattgcgg cgtcttgtta tcttgataga cacccgtctt gaccaagatg    113520
     gagaaccagt cagtatcact gatctggttg tactcattag tacctcggat atcggactcg    113580
     ggcgtgtcgc ccacgaaata aacggtggct ggcggttgat caataccgta cgtccccttg    113640
     cgccattcgc gaagcagtct tgtcgcgaaa ccgaatgtcc cgagatgcgg tttgccaaac    113700
     gcgacagtag tcagctcctt accagtgagt tctttgtaaa gagcttctat agacgtccgc    113760
     agtgcgccca ttccaaggcg cgagtgctcg tgggaggtgg accacacgat gtcgttgtgg    113820
     gaaaagtaaa taggcggacc ctcgtcaaag gtctcggagc gagtccctag gcgtccattc    113880
     ttcgacatca gaagatcgag gatgatctgc tggtcaccag cccagtctct gctgtcagcg    113940
     aatacgaata tagcatcgat agtggtctcg tcgaaatttc tatcgcggga attgcgatac    114000
     tcttcctctg tcaacttccg gaacggcgtt gtgtcatgct tggatttgat gatatctccg    114060
     ggggtaacca cgtctttgaa accatagtcc tctgcgacga cgcggcattt ctccccctcg    114120
     ccacctacca cgaggacggt ttgatacgcc tcggccattt cgcgcatcgg tgtgtgtcca    114180
     caaatgaatt gtccaggtga gacctccatc tgtagctggc gactgaggtc aatgcagcgt    114240
     tcttcctccg tcttcccgcc gccattggtg acgaagatat acgggcttag gatgaagtca    114300
     atatgtgcat gtcgggagag agaggcgaag tgtttacatc cttactccat acggattgtc    114360
     tccattgatg tatttcatcg caccgatcga ttctggaagt gccttccctc ctttcaggag    114420
     aacgccgtcg atatcgaagg cgatggcgaa tttatctgta ctgcttgggt ctggttgttc    114480
     aacctcgggg gtggccctgt cagaggccgt ttcatcgatg cttttcctgg ctctttccag    114540
     ccgcgtggcg gttccgtttg catcgcaggg tgccttcata ttttcgggag gagcgataac    114600
     tgttggaccg ctatacagat cgcatcgctt agcgtcggcg gatgatagcc tccgcacgct    114660
     ggctgttggt gctgccatgg tatggactga agggggattc tttgatatcc attcgcttgt    114720
     gaaagtatag accatagacc ccggcctgaa ggtaaccata ctttatacga tgaaactgag    114780
     tcacgagatc cgatagcatc tggacaggat gtcatcatga cgaaacgtat ctggttcgtc    114840
     cgcattcgca atcaacactc tggtttcttc caaactttgt aggataaact gtggggatgc    114900
     gataaatcac aatgctatat ctcaacaatc ggggcccgga taggtggcaa gcttatataa    114960
     tgttctgtat gttcatcgtg atacttgaat gaaagcaggg aaacctgcat caggttatca    115020
     cactatacgt cggtgcttcg aggttacaac tcggctttca gtcatttttg cttctcgttg    115080
     ttactcgctg tttctctgat atgtcatatt ggaagactac gaagaagcac atgaaaatat    115140
     gggcttcttt ccatgtatga agagattgga caattccgac tcgatttact ttccatagta    115200
     ttaatagtat gtctttgtca caaaccacat gcggtataga tctctgattt ataatccaat    115260
     actattgtat tctgggcata aaatcgagac ttggtgatca gttcgtgtat atacaacata    115320
     agcggtggag cctacgccta gtcgagataa gacgggcatg cggagtcttc gaactcaacc    115380
     aatcacgtgt agcgtgggat gtcaccctca atgacactta cattctgcta catgaacaca    115440
     gcagtcaatt acgaccttat tgtccacgaa atcgtagcag atctgggcat gtcgggggtc    115500
     aaggtacgcc gcgttgcagt tactatttac atagcgctga cgtcgatgtc tccccgtatg    115560
     gaacatacat ggattgaaca tcgcacacca gttactccaa aggagatcgt caaagagtta    115620
     aactcacatt caaactcata tatatcgatt tatccccgag atgttttcct agtgggtcaa    115680
     agacggagtt caacacagtc tcaccctggc cctggccaat atggtgcggc ggcattcacg    115740
     attccagact ggtcgcagac ctcgaggtta tcctgggttt aaactggacg agacgcatgt    115800
     cacgggccca gtgtccttcc tgaatccaac ctccgcacac tacgaaccga gccagcaagc    115860
     agaagacatt caagctcccc cacaaatcga gcgtctctgg cgatcccgcg acaacagaaa    115920
     aggccggcat gctattcgcg tcgacacaga agccttgccc catgtaacga gactcacaac    115980
     accaccactg acgcagtcag tgtcagcggt agccaagatc atgctccgga tggtgaccta    116040
     cgtcccttac tgggatgtat catatctagt cgccatgagc ttcactattg ggtccgcagt    116100
     attcatcgtc aatgggttct tcgtctggct accactggtg gaccgaaaga ccgaatttca    116160
     tggtgaaata actattgccg gtggctggac gggattcgtc ggcgcgacta tttttgaact    116220
     cggtggtgta ttgctgcttc ttgaagcgtt taataccaac catactggat gttttggctg    116280
     ggcgcttgag agtgtcctcg agaagactat cgaagatggg gttcctcaac atgcgatgaa    116340
     agagatcaag ccgaggatgt cagagtgcga gcatcaccat gcgaatcgga aatcgtttct    116400
     ccgggagaag caccatcata ccagtaacaa tgtccactct cacctagatg acactggtta    116460
     cgttacttca tcgccagatg gcaggtcctt ccgatggatt ccatccaagt cagaattgtg    116520
     cacgcattat ttccatgaaa ttggctttat agcttctttt gtcttattcg ttagcgcaac    116580
     ggtcttctgg attggtgcaa tagttggcat ccctgccatc ttcacgcgca taagtcaggg    116640
     actcattgac ggcctctact ggggtactac tacacttggt gggaccggat tcattgtgag    116700
     ttcactactg tacatgcttg agacgcagtc caagtggtat attcctgctt ggcatgttct    116760
     gggctggcat attggactct ggaatctgtt ggcagtattg ggtttactct ttgtggtgcg    116820
     ctgggcccgg caagtagcaa ctctggcgcg gattatcagt cgtccctcgc tacattttgg    116880
     ggctcactag ctttcatgat aggatccatg atccagtggt atgaaagttt gcagaagcat    116940
     cctgttgaga aaaagtgatg atgagcttca atcaaggcac cgcatgagaa ttataagtag    117000
     atttaggctc gtaatatcct ggtaagggtt ccatatgtac tatagagtaa agctgaatag    117060
     ggcttaagcg ttgttttgcg atactgtcca agaaacacat tgaacgttga acattgaaac    117120
     catgtgtgct ttcggctttc actgcagtaa ttgtcgagct gagaggtggc attttaccgt    117180
     taaggactgg agagttcatt gtggaagctg aagtggaaag ggagttacct aggtatccat    117240
     actacctcag atccatactg tgtcccatcg cccttatccc aaccagtagt ggatttccgt    117300
     tctttgtggg gagggagtga tgatttccct catcgtgatg gccagattct gagggctgat    117360
     tagagcccct tcattctggt ggcttcctgg ctcaaaggtt gcgacgtacc agctttggct    117420
     catctggttg attttcaggc tatttggtca gtacggcttt taaagagtgt taggtgagta    117480
     aatacatata tgtctccagt agcccatatc taaacaagtt ttctggctgg gaagagtggc    117540
     tcagtctctt caacaacata ctcgtggttg tccgaaggag atgtcatgct cttccctttt    117600
     gtgtttcgtc tcgtctctgc atttttcttc ttcttcttct tcttcttttt cttacactag    117660
     tgtctgatta atatgcatgg ttgtgtattc acagccattc ctttccgcct actccgtacg    117720
     aaaatcatat tcaccggcag ttgatctctc cagggctcta atcttcaggt acgtaacatc    117780
     taaaatatat tagagagtta tctgagcttt gtgggattat agctccacgt cgtacttttc    117840
     atgcataagc gtgaagccct gatagggtta cttgaacccc agatcagata ggggagttag    117900
     tctgatccaa aggggcccta tgaataaaca gttggaaaaa gaagatgaaa accaagaaac    117960
     tgtaattcat agcgaccttg aaatcttttg tatacaaatt gggaagagca tttaaacgcg    118020
     ttccaccccg acactgctag caactttgtc gtcgtcatgc tgctcaacct gaatatgtcc    118080
     ataagccttg atttccgcgg ccatcttcct cgcctggtca actgggtccc ctccccgagc    118140
     gaagatcaaa tcgatatcct caagacgcag gttgctagtc tcggggtaat agaagtagat    118200
     cacaggaacg aaaaggaagt tcgtgatcat gaagatcaag tacgctttcc attggatccg    118260
     attgataatc acaggcgtga tcatgacaac ggtgaagttc caaagccagt tggagctgac    118320
     accgatcgct gttcccttag ttcgggcttc cagaggcagg atctcaggta cgtataccca    118380
     tggtaccgag ttgatggaca tgccatggat gagcatatac aggaaaaaga acgcgacaga    118440
     tgcttcggcg tatgtctttc cgcttggttc gttgacttgg gaaagcaagg ctgctaccat    118500
     catcatgcat attcctaaac ccaaagagcc gatcatcatt gtcttccggc gacccatgct    118560
     gtccagtttg aatgctggta ggagagaacc gagcatgaac atgatttgaa tgcagccacc    118620
     caaaatcagg gagagctggc tagttagccc gacatttgtt ctcagcacag ctaatacagg    118680
     ttagcacagc ttttgactca gcaaaatatc gatacatact aggcacgaag tatacaacca    118740
     agttgattcc gcccacctga ttcatgagct gaatgcccca agcgagaagt actcgctggc    118800
     cagtcttcac ttcatcgttc cggaagatct tccagaaaga ctgcttgctc accgaatctt    118860
     ccagttcgat ggcggacacg attcctttat gctcattgac gatgaactcg tcttccggct    118920
     cacggtcata cacggcacag aggacatcca tggcttcttg ttcctgcccg tggttcatga    118980
     gccatcgagg ggactccggt aggccgaaga ccaacacgat gacgaaaatg gcgaaaacca    119040
     tctgcatggc aataggcagt cgccacgcga taggtccgct aacaaacgac atgccaaagt    119100
     cgaaccagta tgccacgacg attccgacgg cggtgaagag aacttctgag gaaatgagac    119160
     gacctctggt tttaccctcg cacatctctg gcagaagaaa gagtaatgag tatttattgc    119220
     ttatgtatga gacgatttaa cggcattgga tctgacttac cggcctggta catggggaca    119280
     gtgctggtct tcaagccggt gcctgcaccg gtcacaattc ttccaatgat cagatgtggc    119340
     acattgaagg ctgtggtctg caggattgca ccgacaatta ccacacccat tgcaagccaa    119400
     atagctcttc ggcggcccag tgtttcgccg atgcaaaagt taactagccg tgtcagttaa    119460
     tgtccattcc aatcagatac ttcatacaac tcactcagac acccaagaag acaccccaaa    119520
     ttataacaac tgacaatgat accctcttcc gagtcattgg ggtagccgaa ctgtttcctc    119580
     cagtcttcat tgccgataat gccactaaac acaccttggt cataaccaaa caagacaaaa    119640
     gccacaagac agcaagacgt gacagcgacc tgaagggatc gaccccttcc ataccaagag    119700
     cgcatgatgg cgtggaagtc aagatcacaa tccggggtat gaaggaagca gtgcaagggg    119760
     ctatagaaaa aatcaaccac ttagccgggg gtcttcgcac catgtttata gtctgcagaa    119820
     caggccccgc tacgtactgg gcctggcacg ttctgtcata agagttaacc cgcatcatag    119880
     gggacgatca agcagtctca accaatgaag ccaggttcct gtggacccgg gaattgggat    119940
     ctggggtatc tggagttagc catttacgcg gagtttgggc gaaactcgtc tgtgcggagg    120000
     acgagaattg gcgccacagt cgggagccgg aatcgggcaa gccaaccgca cctcttgccg    120060
     gtcgatgccc gagttgtctt cagttggctc ggcaagagcc gacggttgga tggttgcgac    120120
     tgcctgtttg ggattttacg gaatattgct actccgagat catccgggct actagcctgt    120180
     ttaggaagtt tgtcttaatt tggaagttgc aaccactggc tccactatcg gcactcgcct    120240
     tcgatgttta tgtacatgta tatacctacc taggtaggta cctaggtagt cttgcagtat    120300
     catgtatgtt gctgtggctt aggttgacac tgctatattg gttgatatgg ggcagaagcc    120360
     aacgacaaca aagtcacctt ctaaaataaa tatactctgt ttatccaatt tcaatggtct    120420
     aaccctacct cttggcatgg tgaagcctga agaatgtgaa caatggggac tttgttttag    120480
     gtacagttgt ggtttggctt gggaaagtgt catatagggg accctatatt gtttagtgga    120540
     taatcgagct atagggaata tttagctgtt gctgctagtt gattctttat gaaaaagaga    120600
     gcaccaaaac taagtacaaa ggaaaagaga aaaaggataa agacgagggt cctgttaggg    120660
     gctagttaag ctcccaacct ttgcgtgacc gcatcccgtt gaaccaatcc tgcacatatt    120720
     ccaacccagc gtggggacca taaatttcgg tttcccactg aggtaacggg gcatcaagtc    120780
     cagtctcttg cagacatgtt tctcgtaaat gctcgaggct tccaccgcgg tcatagatgg    120840
     aggactcact aagctggcta cgttccatcc gcatctgggc ccgcaatgcc tcggtctcag    120900
     cctcatctac agtgaaatcg tcgttgacaa cagtgccata cgcaatacga gctccctcaa    120960
     ccgtgaccag cttccggtgt acttccaggg caaccttttc tgccggacgt gtcaaaggat    121020
     cgcccaatcc accccctccc caagtcaccc actcgagaag atcacccggg tcgacgcgaa    121080
     tatgatcaca ctttgaaggc aaaatctctg tgggaggact gtcctcagac ttggagaacc    121140
     ggtagagcat cttacgggat cgctgtcccg gctttccgcc cttcaacccc catggcttgg    121200
     tgaaccaccg gtcatcgtgg agactgaact ccccacgagc gaggaatcgg tatagcgtgc    121260
     gctgagcatt accaccgcga taaaatccgg cgccaccact gtcggcgacg ctctcattag    121320
     cttcaatacg caacgggtag ttgagctcta ttatttctgt cggaatggac ttgatggcgg    121380
     ggaagagaca gtggcaatca ggtccgtcgc cggcctgtcg tgcaggcacg cctccaaatc    121440
     cgatctggta gagctggtac cactccccgt ccggcttaaa tccagagtaa aagaagtgag    121500
     gcgagtcact gaatccagct gcagcctggt aggagtcttg cttttggcca atcagagctt    121560
     gtacaatgtc caaggtccgc ccgaggaagt gagttcggca cgagattggc gcagggcgaa    121620
     caggcttgag gactgatccg cgggggatgt gcacgtcaat caagtcatgg aaaccgtcat    121680
     tgataactgt tcccggggca gcggctgcaa tgaggtagta cccaatgaac atcctgaaca    121740
     ttgtctccga gagataaaag ttgatgctac gctcgctctg tggagaagtg ccgctccagt    121800
     caaattggag ccggttgccc tctactcttt tcatggagca ggtgagtgcc caaggtccaa    121860
     caccgtggcc atcatcatcg acgaagtctg tgaatttgct ttccagatcg tcgaattggc    121920
     gctcgataat ctttgcgaat ccagttcggt tccggtacag cagctccgag cacgcagcca    121980
     ggtacacttc agtgccgaaa cgggtggcca actctcgaac tctggtggcg gccatagaac    122040
     aggaagctac aatggcagtc aggtcagagc gataccatgc cggttggcga gagtttcgac    122100
     aaagaagatc gaccagatct gtgttcatca caccaccggt atacagcttt atgcaaggaa    122160
     tctgcacacc gtcatcgaag acagatgtcg cgttgattga catgcttccc ggaacgatac    122220
     ctccaacgtc tgtcagatgg ccaaattgcg atgcgaatcc aatgatctga ccgtcgtgga    122280
     aaatgggcaa aaaggcgatg atgtcgttga ggtggctgat ggcgccctgc acttggtagg    122340
     tatcgttggt aatgaacaca tccccctcct cgattgtgcc atcccaaaca tcgaggaatt    122400
     gggtgataaa gctgccaaac tgaccaacca gcattttgcc ctcactgtcg gttatgacat    122460
     tgaattcatc ctgctgctct cggatggcag gggacatgct gcatcgtagc atcatcttgt    122520
     ccatctcgcc gcgaatggag gccagtgtcg aggatatcag tgtaggaatc aatggagtac    122580
     ccttgacaag ctctttggct gactcggcag tgtacgtggt agcggcggta ggcttccttt    122640
     ccagagggtt gatcaaaata ttcccgatgc tatcgatctc accatagtag ccaggcaaga    122700
     tgagtgtatt gctgtccatt tcagagataa tacacggacc cattacttga ataccctgct    122760
     tgctaatctt gtgacgatcc cacagggttg ccaatttctc ttcgccttgg acgatgatat    122820
     tctgctcgcc aatctttgca tctgaagggg gaattgtggc tttgccaact tgaggaatgt    122880
     caataccagg cgaggcgtct tccaacacaa cccccagtct catcaattca agctcaaagt    122940
     cgggtaagca gtaagtgaac atctgctggt gctgctggtc gaacttttgt cgcaacacat    123000
     catgccattt atcggtagtc agggccaagt cttcttcagt gagatcaatt gttatcatca    123060
     aagcttgacc tttgtaccgg agatctgctt ggtatgcagt tttccatgac aagggccaca    123120
     gatcacccgc cgtcctcgac aaagtatccc gacactcttg ctctagcgtt tggtactgtt    123180
     cccgtgcctc ggcaacagtg gttccggaga caatacggat gaatgtggcg gattgttcgt    123240
     gtctaagttt agtggtcaca tcaccctgtg cacataggat tccaggggaa ggcgggatga    123300
     tcacaggcca ggccccaaga agttgaccca cggcatttgc atgcagaggg ccggcgccac    123360
     cgaaagcgac cagtgcaaat tcacgaggat catagccctg ctccacagag acaagacgca    123420
     aggcaccata catagtctca ttgatgatag tgatgatatc ctcggctgtt tgaatgaccg    123480
     gaagcttcat ctggttcgca atatcctcga cagcagttat agcagcctgc acatccaacg    123540
     cgaactcacc accgagcaat gttttgggca aataccccag gaccagattc gcatccgtga    123600
     cagtggcttg ctttccgcct tttccataag atgcaggtcc gggtgatgca cctgcgctct    123660
     cggggcctac ccgcaaggtc tccgtgagct ccatataagt tgtgattgac cctccaccag    123720
     ccccaacggt cttaatatca actgcgggcg cccgaacaga aagactctct acaacagtct    123780
     cccgtcggag ctgaggctgc ccattgtaaa ttagtgcgca gtcggtagaa gttcccccca    123840
     tatccaaggt aatcagattc ttatacggag tactccgagc cacaacatct gccactccct    123900
     tgacgcctcc tgcaggtccc gacatgagga tgttgaccgg caactcagaa gcgagagtca    123960
     gactggtcaa tccaccatcg ctcttgagaa ctcgaatggc ttcactttct gtcgcaagcg    124020
     cttcagacag attgtgcaga tatttctcaa caaccggctt caccagcgta ttcgtgcagg    124080
     tcgtgaccgt cctctcatac tctccgactt cacgcagaac atctgtagaa caaattatgg    124140
     cgataccggc cccaagctcc tcgcggactg tttgtgcaac cacgcgttcg tgagcctcgt    124200
     tgctatgcga gtttaatagc gagatagcga ccgcttctgg tttctgtcgc gccagctctt    124260
     tcaagctttg tcgcagattc tcaacatcaa ctggcgttac tgtttcgccc tgtacggaca    124320
     tgcgttcttt acattgaacg actcgctcaa gtggcactat ggggtcgggt ggggtccagt    124380
     gcagccacgc acccaatcca cctgggatct gggagcgacg caaagccaat atatccttat    124440
     ggccagccgt cacaattagc gcggtgcggg cgcccttccc ttcgaggact gcattcgttg    124500
     cggtcgtcgt gccatggtga atgaattgga aagtccccga ccagccgaac tgctgatgga    124560
     ctagttcacg ggccttggca atgccctgtt ggatccctat actttggtct gggatggttg    124620
     ttgggacctt tgctcgcact gtttgtccat gcggggtgaa cacgtaaaca tctgtgaatg    124680
     tcccgccaac atcaactccg agttgataac ccttctctgt gacttctcgc atggtgcagt    124740
     tttggtgtgt ctggggaata gacttggggg tgatgaggaa tcaggggatg gtcctagaaa    124800
     ggagttcgga atcattaaaa ctcttacgaa agatttgaac ttcgaattca ccaatgctat    124860
     cgcattttgt gtgggcttac cagcccgctg tcataaaaga ggggatgaag tgccgttctt    124920
     tacctcgttc gattcagtgg ggcgcatatt gccaatgaag ttgttcatgc atgggtgtat    124980
     atgccactaa tatgcaacca atatgcaact agacagactc tgcaagccgc ggttgttcgg    125040
     cattggactc ggtatagatt gactcttgca tatatacatg tgtgtccatg ccaagtacaa    125100
     tctctcctgg gtatatacct gctaaattcc gactgacttg attctctcaa gttttgtgct    125160
     cgggtgttcc aaaatctagt agaccttgca agtgtactcg agcagtcact tcgtacaatc    125220
     acaatataac cacttcatcc ttcttgttca agtttaacga catagtcgcg acgtcagtag    125280
     ggagctacct aggtattaaa tctaatagta tccgcaagct gtcaggtgta gtcgtcagcc    125340
     aatgaaatgc tcgaatgatc gccaacctca tacactaatg tcgtcaatta tttttaacct    125400
     gccatctctc tacgtagaac gcacgaatag tacaatattg gtgtgattcc caagcatttc    125460
     caagcctttt tagaggcgaa cagccgttgg aatgtaaata ggagcaccca cataccacga    125520
     tcctagatcg acatcctatg gacactttag gaccggaatg tgcgatcaga acaccgattg    125580
     agagaagatt ggattttatg acacttgcca gcccctgggt atgacgcaga agttcccttt    125640
     ggattttaga ggcgtttcat gttcagcatc atagtcattc cagtcattct tccccgccat    125700
     cccattacgg tgcggcaatc atggaatgag aagggtgaca ggacgtaacg tatataagaa    125760
     tggataaaac gtcttgctgc ctacgctttg caatcacgca attcagtctg atcaaagtct    125820
     ataagttccc gaatatatca aaatcccagt aaccatgcgt tccctcacca catcatttat    125880
     ctccctatcc cttctatcag gcacagtcca cgccgaaagc atagctcgtg tttggacaca    125940
     cttctaccca aactgccctg gcgaggcatt cagcaatctc gacacatacg aaaagtacca    126000
     cgtatccggc ccatcccaaa atatcactca gggcagctgc aaaagcttct ccgtcccctc    126060
     ctacgagaag aacctcgtcg acgccatctc cgtcgacgcc gagctcctct ccaacgacca    126120
     cgacctccct tttctctcag gcggcagcgg ctgcaacatt accgtacacg aggtcccgga    126180
     atgcatcgac ccgcccctaa tcagcaaaga gatccgagat ggcgtcgcaa ttagtcagtg    126240
     cgcctcgcgc cagttcgtcg cttacagcca ggtctgggtg aatctcgttt gcgacagcga    126300
     cagccctctc cacaacgaga acatccctac ccatggtgca aaggagaaca acaagcaagc    126360
     agacacccac cagtccattc ctacttctca gcccgatgcg cctgtgcgcg ctgaaaagca    126420
     tactaccgtc gaggatatca aaaatatcca gatgcccgga tcgaactcgg attcttggcg    126480
     tgcttcccag gctacgcata gccagcgtga gcccgtgcag gagggtcgtg tcaaccaggc    126540
     tggtcatgcg cagagtgatc agatcgtgca tcatatcatg cagttgttga agaataagac    126600
     ttcgcatatc gtcaccggca agcatcatgc ccactcgaat gttaccttgc atcacaatgg    126660
     tactgccccc ggtaatagta ctgtgatgac tcgtcggcgt ttgtcggtct tgcgaaacag    126720
     ggctgctcgt cttgtttaga gttggatttg gaaatgttgt atatctgagc gtttgatttg    126780
     tgatgaattg gaatcatttg tgtataccag attagttaaa agcccactgt gatatgtgaa    126840
     acttgctcta ttacttgatc ttttcatact gctaaagtag tatcttaagg aatgaatacg    126900
     aaactccttg cgctcacaat tcaaagtaat gtagatcaaa ggattcaatg gatatgaccg    126960
     actccaagag gcgacagggg tcgtatataa tttttcggtg tcatcatctc attatagcca    127020
     cttgactttc tggtctactg accaagcgaa atgatatttt gtgtcaattg cagacacatc    127080
     acactgtaga acagcaagac cctctatggt acttccaaca ttgacgtagc aaattcatca    127140
     acaagccata cccatgattc ccaacttaat attctaactt gtctcttcat cggcatcttg    127200
     agctgcctgc ttcctacggg cagcctcctt gccagcaaag ctaaacaaca tgccaagatc    127260
     ataggtcact ttcaaacatc ctgcaataat gaaggacaca ccgaaatggc cattgctcga    127320
     caagataccc gtcaacaggg gacccatgct ctgggctgta gtcttcacaa catttaccgc    127380
     gcccatgata gctgtgcgct tgtctgccgg caaagctgca gcaaggaatg cggagcgagg    127440
     cgccacatcc atgttctggg tgcaggctcg cagaatcaaa aaggtcagtg ccagaggcag    127500
     gctagatggg acggagatga gagccagaca gatcgccgac ggcagatgag tgaataccat    127560
     agtctatcaa agagttagaa gtcgttcagc agcccgagta ggaagaatac cttaccttga    127620
     cattaccaat tcgtttggcg agggacgagg ccaccagcat ggatgccgca gaaataatgt    127680
     tcgtagtgaa gaacatagtg ccgagcccac ctgaaggcag attgaacttg cccttgaaga    127740
     agtaggtcat ccaggacctg acaaattagc attgtagcct ataagagtta ggatctcact    127800
     cacagtgaag ccaatccaga cgcaaatgag tccactccaa acaggatgaa gagacggata    127860
     accagagacc acaggtcctt ctcgatagac ggaaacagcc ccttcttcgt ggccggttcg    127920
     acatcttgtt cgacaggttc tgacagcagt ggtcgggttt cggagctctg ctcctgtggc    127980
     tcttctttct gaacctcgac tttgccactc agacccagag tcaagattag cttaacgacg    128040
     ccgacgccgg catagacgaa gaaaatgatg cgacaggcgg gaatgaaggc ccatccgtgg    128100
     attgactcga gagaattgat gatccaacca cagacaagca ttcctgtggc tgagccagca    128160
     tttccaatca aggaatacca agcaaaaaca tcactcagaa gctcatgtgg tgtgagatga    128220
     gccagagtgg attcctccac ggcacggaac gggccaattt catttccact acgaagttag    128280
     ctcggataaa aagaaaccac agaacaaaaa agacgaacct cggactgatg acaccgaaga    128340
     ctgcagcagc cagtagaatc cagaaatttc caaaaagagc aaaaatgact ccgctgccag    128400
     ccataaggac cgatccgagc gacaacaccg ccttgcgacc catagcatcg gcaaatagag    128460
     tgaggaagaa gctgatcacc acatctccga ccagcgtgag agtcataaac aagccaatcc    128520
     gatcatctga aatccccatg gccgatagat acgacgccaa aatcaaggtc gagccgccgt    128580
     acgcgaagag ccggacgaat cgttgcgcgc aaagaagctt cacgtcgagc gacgaccgcc    128640
     acatggtggt tagacccagc tcttcgaaaa catgggccat gtatcgcgcc ggtcgcgatt    128700
     gattctccat tatcagatgg ttgaaggaag aaagttgaag gtggaaacaa cttttaacct    128760
     ccgacgttcg gagtcggggt tcgggccgga gctaagcttt cttcggggga actaaacggt    128820
     ggacggtggg atatatatta catctctctt tgggagtata aggagtatga ataaaattat    128880
     tatgtacaaa tatctctcac tgctcagtct tgggaggcca tttcactcgt cgttctgccc    128940
     gcacatacaa gttggtagga cgaatcaact ggaacatggg atcatactcg actggcccat    129000
     cattctcttt tgtgaatttg taccggtaca acaatttggg caagaacact ttgacttcct    129060
     gcaaggcaaa gttgaaccca atgcacatac ggggtccagt agcgaaggga atatacgcag    129120
     acttatggcg gtccttcact tccgccgtat cccagcggtc tggatcaaac cgtgctgggt    129180
     tagaccagac agctgggttg ttgtgaatgt ggtgaagggc aggaatgacg atagagtctt    129240
     cgggaagctt gtatccgcct ggaagaatca tatcgacctt ggcagtgcgc gcgggctggt    129300
     atgagggatt atgacggcgt tgagtttctt tgatgaattt gtccaagaac gtcagacgat    129360
     cagtcagatc cgcagtcatc ggggtgtcgg catcgatgtc gttgtcaatc aattcctgta    129420
     ggagtctctc ctgcatgccg ggatagttga ctagggaata aagcagccac gacaacaatg    129480
     agctagtagt agtaaaccca gcgccggtgg ctactaccag tgcctccatc agacttgtct    129540
     tgggcaattt ctcgcccttg ttatccgtgg cgcgaataat ataatctgcc taacgtcagc    129600
     tcgagccttc caactgccag gtatttcact taccaatcat attcgaggcc tgcaatgcag    129660
     catcctgtaa cgggagatcc tcgacaccat tccgagaagc attttgaatg gactcgttaa    129720
     ccatctcaac gatacgatca cgagcatgcc ggagacgctt cgggtcaccg aaaggcaact    129780
     tggcgtacca gtcgccacgg gcggttacct tcttgttcag ctccaacgac tcggcaattc    129840
     ggtagacaag ttcatgaggt ggcgcatcca cggtggagaa atgcttaaag tccataccca    129900
     gaaccagctt acccacggcc tgcgcaccga gcttaagcat gtacgggtag acattccaag    129960
     cctcgccgcg ctcgtctagc tcatcaaaca cattgaatgc atcctcgaca gtctcttgca    130020
     tagtgggggc atagtggcgc actgctttcg gtcctagcgc tggcgggagg aacttgtgtg    130080
     ccgcgcgcca ttcgggtgta tcggtgtcac ccaagaacac accggcctgt tggttcttaa    130140
     tggggtgtaa ggggtgtgcc tcgttgattt tcttagtaaa gaaatcagac tctgagaaaa    130200
     caatggccga tagctcgggg tcattggtgt ggtagaccgt ccggcccatg ttggtggttt    130260
     ggatgatggg tccatattgg tcaaatagac gctggtggtt tcccaggtgg tcaggataga    130320
     cctcgaagaa gttccccaca aatggcagtc ccttgggacc agggatctcc cgtacggcct    130380
     tgccgtctat ggagatggca atgggctctt cattggcaag gatctccgag gtagtggaca    130440
     acaccgagtc ctcagactgg aaaccaattc ctatcatggg agtcagaatg atatcggaga    130500
     cgataggaca aaaatcttac catttggctc aacaatggca aattggccag caataaggag    130560
     ctgaagtcct tggtagtcga ctgttgtctc tacctcaatt gggcgagcag aggtaatagc    130620
     ctcgcccagt aagtagaaat gtttggcaac cattgtgaaa tgagaatgaa acaagttatc    130680
     ttcctctctt gaagggcccg ctcacatttt ataaggatct aattatctga gccgttcaaa    130740
     actgcatagt agactccact atttcataaa aaagcgtccc gattcttttt catctcataa    130800
     tagaagaaga tgtatatctc taagagcctc ggctcaaaat atttctcagg atccacaata    130860
     acatcacgcc gaaataggca aaaagtagtg tattccatac gggaatggag ttggacgtta    130920
     tatttcgggc tcaccgtggc cgacgggcag acggcagacg gcaccgacac gcattgtgcc    130980
     gtctcggccc caccgacaag atcgaggttt tgtccttttt cttttacttt ttctttgatt    131040
     tttttcgaga tgccgaggca ttttgaatcc ctgattcctg gtaggctggt tttatgtttt    131100
     atgtacatat cggaagtgct aagtgggcta ttgcgataat tccatgttcc agtacggagt    131160
     acttttcgtg atattaaatt aagactccat ccttttggtt tttgcaaaca tttgaaatct    131220
     ttcattcaca atgtccgttc cagaaacaaa agagctgaag gctgagtgga aggcagatgt    131280
     tgagctgcca gagtatacat tgaaagatgt agcggcacat aacaccaagg gtgatacctg    131340
     gatggtcatc catggacagg gtaatacatt tttttaaagt tgattcaatc gaaaagccgg    131400
     tactaacatt gcaacagtct ttgacctcac aacatatctg caagatcacc caggtggtgc    131460
     agaggctctc atcgaggtag ccggcaccga tgccacagca gcctatgagg atgtcgggca    131520
     ttctgaagac gcccgtgaga tcatgcagcc attcctggtg ggaactttga aggatgccca    131580
     gcagtatgtc cgacccaagg cagtgcgtgt ggtgtcccaa aaagcacccg tagaggccgg    131640
     ctcctcatca tcgaccatca agacgatcgc ttgtgctctg ggtggactga tcccagtctt    131700
     ctacgtcttc agcaaaagca acaatctcac aaccaacctg ggagccatct cccaactgat    131760
     ccctcaccaa ctgaagagct tacgactgcc tcatggaggc ttcgtcaacg gcttcttggc    131820
     cgcttctgct atctccacag ccgtgggagt agtggtagca cgacaggccg gcaaattcac    131880
     caagatcgac tctgggttca tgcgttaccc acctcgtatt aagtcaaaga aggtgatccg    131940
     tgccgatcca catctcacac acggtttcct cgagccgcaa caataccaac gcctgccact    132000
     cgttgaaaag accgaactag caacgaacgt ctaccgtttc gtctttgcac tgccaaccgc    132060
     cacagatgtg ttaggtctac ccatcggtca acacgtcgcc atcagagctg ttgtcgatgg    132120
     aacgaccgtc actcgctcat acacccctac ctccaacaac atcgaccggg gccgcattga    132180
     actcgtgatc aaatgctacc ccgacggtct attgagtggg aaatatctgg ccggcctgac    132240
     cgtgggcgac gaagtcgagt tccgcggacc taagggctct atgcgttaca caaaaggtct    132300
     ttgtcgcaag atcggcatgg tggccggcgg cacaggcatc acgcccatgt accagcttat    132360
     ccgggctatc tgcgagaacg acaccgacac gacggaagtt agtctggtct acgcgaaccg    132420
     cagcgaggct gacattctct tacgcgagga gctggaacgg ttcgcgcgcc aatacccaaa    132480
     gaacttcaag ctgtggtata tgctggactc tgcgcccgag ggctggacct atggatcggg    132540
     atacgtggac caggcagttc tggcggagca gctccctgca gcatcgccag acactaaggt    132600
     gatgttatgt gggccgcccg gaatggtcaa tgccactaag aagaatttgg tggcgctggg    132660
     ctttaccaag ccaggggctg tggcgaagat gaccgatcaa atcttttgtt tctagaaaat    132720
     tgcctaatat agtaatagcc gaggttaatg gagaagccaa gtttttgttg agtcgatggg    132780
     aaatagcggc tccggccccg ttgccgaatt tgttctcgtg tccgacacca aaaaattctc    132840
     ctccggcaga cctccgagac agtccactca ccgagtgctc attcccgaga ctttgactgg    132900
     ttggagctta tcttccaggg gaggtgtgcc tcggtacttc atataaatag tatagattaa    132960
     tgtacataaa cactatctcg ggctgaaatt cccctggatt acaacataga gacaactccg    133020
     atcaattcgc atcatccttt gtagctttgc gctttcttcg acgcctgcgt ctccgccgct    133080
     tcttcaccct tggtttcttt cgttttcgaa tcatgtaccg aacccgttgt cctaatcttc    133140
     cttctctcgt ctcgaaccta gtcttcaaat ccacttctgc tgacatcctc acaataggag    133200
     tgatgatgga cttgatatcc ttcgagccgt agtatcgagg aagatatcga ggaagatcag    133260
     atgatatggt aacactcttc ttgttcttcg acggtgcatt gtcagtagaa acaggctcgg    133320
     gagctggcgt aggatcttct ggatcgagtg gaactttggc tgatcgtggg gtcaatggcc    133380
     gggattgcaa atgacataga taaagatagt ataagagcag tagcaaggcc ccgacaccga    133440
     ggatagaccc cgctattgcg cctttgttcc catttgatag tccggtgctt ctggccgaac    133500
     ggatttgctt gggtggagga gttgctgctc tatcgaccac gtggatgaca gtggtgaatg    133560
     gagtggtcgc tgtcaatgta gccaagttca acgttggcca gggcttagta tgtcccaggg    133620
     taatgactga cacaaacgtg gtgtcggcca cgataagtgt ctgggtgacc tcgcgaatcg    133680
     caggtgccat tgctcgacgc aaattgaact ggcatgactg ggcttaaatg tcaatggcag    133740
     catcacttta tctcgcacca caaacacgta gggtatgcat gagcggatca aacgggtcct    133800
     ctaatatatg tgataaagca atcgaattgg tgactctcgt atcttctgac ttagttatgc    133860
     agcttatgca gtgcaatcac atgagtctca tgacgattgg tggaatggtc tgcaggtgtc    133920
     gttgcgaggc cagctcactg catcttggcg cggggattct catgagcacg ttattaggac    133980
     gaacacctgt gttggctttt tttccccgcg aatactacca ggggtctcat gtcgcttggt    134040
     ttattttacc aaagcgccgc ccacccttat tcattagact gacatgcagc ttttatctcg    134100
     aagcaatttt ctgcccgaag aagaacaagc gcaggtgtat ggtcgcctcg cccgcacgga    134160
     tgagcccgtg cgatactcga tatcaaagag tcctcgagtc ctcgacgttc ggggcgaact    134220
     catagtattc aatatgtgtg gtacaaattc tctataaaat ttacaacttc gcgcgtgcag    134280
     gagcaaagtt cgacccagcg ccctggctaa tagcttcgac aatagcatca acgctattca    134340
     aaatccaggt attcccctcg tcgctagcta accattgcgc agcctcttcc ccctcgacat    134400
     cattcaccca cgagccatcc tcaagcgcct tccgcaaccc aaacacatgc gagatgacct    134460
     ggggtccaac gccagactga gcgcgcaaac acgagatagc aataatagac gtcagaatcc    134520
     gcccagcaga gacgccagtg ctacgctccg gatcagacag cagggcaccg tagttgctgt    134580
     gtaggatgtg caccggcaag tcggggtgtg aatcggccag tttattatat agcttcttct    134640
     cgaatggccg atagatagaa tcccagagtg cgtggccgcg gtcactgatc gcggagatgt    134700
     tctccggggt tggtgcgcgg gtcggggtac gggagagctg gctgccgact gagtctggaa    134760
     ggctggctct gaaggcgttg aggcagttta tagtgcgtgg aataccgttg aaactgatgc    134820
     attttagacc gacctcacgc atgagctcgg cggtctcgac ttgcttgtcc gggttggtgc    134880
     tggctagttc gtagagggct gcgagggact cgggggaatt catagtcatt gttgccgcgg    134940
     tctggcattg atgttagatg gcggttcaat cttgactgag ggggttgatt cactgatagt    135000
     gcgacccatg acggctgcga gatcttcttg gattgcgcgg tctcttggat cttttggtag    135060
     accgaggtta tgtttgctgg cgcggggacg gtggatgggc gggcggcagg agcattaatt    135120
     aatgccttaa ggctgattga aagtcgagac atgtcgaagg atgagctctt gtgtcctggg    135180
     tgtggatgtc ttgccattaa agattggtgt tgaaagccaa ttctcttccc gacctcgggg    135240
     gctttggaaa caaacggagc tcagaagtga acaccgaaag ataccgggag gggattgtaa    135300
     tatgacagta atttgaccgg aatgttccgg taatattacc agtggatctt ggaaatccgg    135360
     ggatcgcggg gaaacgaaac accgcgaggc tcttggaagc tctgccattg gcgagaggcc    135420
     ttggggctgg agaggagctc ggacccagaa atgccagccg aaggggttct ctctggctgt    135480
     ttgtgggtta tttctttcaa gtctttcctc tttttctccc cattctacgc tgcgacagat    135540
     agaccaggag aataagatca ttcgtgcgtc gccaagcaac aaccaaagtc atcatggacc    135600
     caccgaagtc aagagtgtta gagctcgaag aggcgaagaa agctcctctc gatcaatatg    135660
     gcgacctctc gcaccagcag aaattgacac ggaagatact atggaagttg gatatacagt    135720
     cagttcaggc actacaatca ctccgcgctc gctaatacct ctcccagcat tcttcctatt    135780
     ctagccctcc ttttcctcat gtcgtttttg gacagaacca atgtcggtaa cgccaagatt    135840
     atcggtttag aagcggacct ttctattaca gaccaccagt ataatgtcgg cttggctgtg    135900
     ttctatctca cctatatttg caggtgcgtt gtgtgccatt ggattacaac gccagaggct    135960
     aattgatata aagcgagctg ccgagtaatc ttgttcttaa gaaagcatcg ccgaagattt    136020
     ggctgccgtt cttgacgggt atttggggca tcatcaccat gtgtctagga tttgtgcaga    136080
     attttgctgg tttcgttgct gtccgggctt tgttgggtat tgccgagggg ggtcttctcc    136140
     ctggcatggt atgcttccaa tatttcaaca gaattgacgt tggtcatgac taacatatac    136200
     aaaaaggttc tatatttatc ttctttctat aaacgaggcg atttggctct gcgaattggc    136260
     ttgttctaca cagctgcttc cctgtcgggc gcatttggag gtacgtgcat cggttttatt    136320
     ggttcttcga cgaatgctaa caatttaggg cttcttgctc gtgggctagc tgaaatcggg    136380
     cctcgggggg gaatagaagg ttggcgctgg attttgatta tcgagggcct tttggtacgt    136440
     tgaaggtgat ggttattaaa aaaaaaaagt gctcgtctga cagttaatag acatttgtct    136500
     gtggagtgtt gagtttcttc gccctcccaa atagcttgca atcagcatca tttttgactg    136560
     cggaggaaaa acaatttgga gagaaaaggc tgatgcttga tagtcccgga tcactggaag    136620
     ggtaagcttt tctgacccgc tggatgagaa agcttggcta acacaaacag atccttggca    136680
     tctgaggctg aatcgttcaa atggtccgaa gtgcgccgag gtgtgctgga tctacaagtc    136740
     tggctctctg cctcagcata ctttgccatt ctttctgggc tatactcctt tggcttgttt    136800
     gtatgattgt tctattccgg gcccgtctga aatccactga ctgtttctag ctgccaacca    136860
     ttatcaaaga cctcggtttc gctaaagatg ccaatgaggt tcagttgtgg tctgtgatac    136920
     cttatgcggt cgcagccgta cttacaggtt agtccgcttt gtctaccttc catcgatctc    136980
     atcaaatgct cactcatcct ttagtctttg ttgcgatcgt ctctgatcgt ctccgtctgc    137040
     gaggtgtggt gatgctcttc actctcccaa ttgcgatcat tggatatgca gccatcgcca    137100
     acattgactc ccctcgggtt caatatggca tgaccttcct catggcaacc ggccaatacg    137160
     cgagtgtgcc gtgcatcttg gtgtggttgt cgaacaactc tgcgggacat tataaaagag    137220
     ccactacatc ggcgctgcag ctggcaattg caaatgctgg aggatttgtt tcgagtaagt    137280
     cgcccacggg ctttatttat ttatttttta cacagatctc taacatcagt actatagctt    137340
     tcaactatcc atctagagat gggcctctct tccaccgtgg acataccatt gttcttgggt    137400
     tgttagtgtt cgcgtggttt atgtgagtat atttcttgtt atggattcaa gagctattgc    137460
     tgattatata ggattttact taatgtgctc tactgcgcga agatcaaccg agacaaaagg    137520
     aagggtaagt atgatcaata cgcagggtat aatgacgacc gtaacccgga gtttatgatg    137580
     gttctatgaa tgatgagagt gatattagac ataatgacat gtcctacaaa tatatggctc    137640
     acaatttcag gatggtaatc gtggcatgtc aaccgttatt tcttttatag gttcagcgta    137700
     tgattctgca caagtaatgt tatacccacc attgccacca gtgatgaggc ttccaatcct    137760
     gcctagttgc accccgcaaa tcatctgtat ttaccacatc cacgccttca tgcacaagca    137820
     catgccaaac atggttccgc agtccaaccg gccaggtagg agtgccccaa taccgcacct    137880
     ttagtcccaa cttgtgagct gcacgtactt gactccgaag aatagcgagc tgaacattcg    137940
     acagacggct aagagagaga gatccaatag ccgtgcggaa gtctgccgat gcataatagc    138000
     tgttggatgg gttatatgtg gagtccattg atttgtagtc atctgccgtt atttcggcag    138060
     gaaaggtcaa gttgtcaaga ggtgcatcgt aaaagacgtc acggtaagtc gtgttctcta    138120
     acaagagatg taaaggcgcg tctccgctgg cgacaacggt aatcggcccg tatacaacat    138180
     cagagccatt aaagtgagtc aagtagccct tctcacgaaa cgggttcagc cgttcgacaa    138240
     gaagaggcca ggtccgacca ccctcggttt tgcagtcaac cagcaaggtc aggctctgct    138300
     ttggatcatt ggaaaatagt ccgaccattt cctgacccat aacttttggc cagttgcgag    138360
     aaggaggttc attgtgtgta tcgagcatct tcagtagcgg gtcgaggtag aggctctgca    138420
     atgttccccg gaggactgtg gaagctgaat gaccgaccag aatctcattt ccccatggcc    138480
     agacatcaac ttcaaagctg atacatcctg cacgaagtgc tgagcgtagg ggaacgtggc    138540
     gccagtagtc gttgtgcgag tggcatggta tggggatgac accgtaagta gaccaatcgg    138600
     aagagcttga ggagcgttca ctgggaaaat tgaccaactc gagttcacat gggaagagat    138660
     aaagaaagca ttgccatgca acagtgagga taccactaaa gtgagacatt gttagctcaa    138720
     catgacgtgt caagtgcgga gagcatgatg caaaagccag caatccacac ttccagaaac    138780
     acttagcagc acgcacataa tgaaaatcag tgcccagaga ggtcgctgta ctgcgcggca    138840
     gaacatagct ctcttagagc ctgggtatgc aatgcagtcc aggtgagaac atttccagaa    138900
     agacaatcgg gtctggttgt tcgataccaa cattttgtca gagactagga taattgtttg    138960
     ctcgggaatg tgctccagag cagatggatg aaatgccatg aaagagaaaa agagtgacaa    139020
     gcttttccta agggctgggc ataaggtaag cttattttat ggttagaccc caggcccaac    139080
     acggatgccg atgtcctccg agtaatactt ataatacttc tgcctaatta cggggctgag    139140
     aactcgtata aaatttgtga gacaattcga aaatatatct agattcttcg ctatctctag    139200
     ctatatttat gggagagagg ggaaacaaag ccctttttcc aacttgtcat cttcgctata    139260
     ccctagggac ttgatttctt atttcttgga tttctgctct gtctactata ggagcagagt    139320
     gtgaattcga cctctctaca aacaagggct agttagctaa tataactaac taactagtca    139380
     agtagttaac tagctatatg cctgacaaac caggcaatcg gtggcatgtc acaacgcttt    139440
     ccctttctgt cttagtgctt tttctttcta gaggccatca atgcccgccg tgtcatgatt    139500
     aaagacatta gaacattcac cgaagacatc ccctataagc cttggcttat gtggtggcct    139560
     ctcaaaccgg agtcatctgc actaagtcgt cttgccgaga gatgcccttc tatgcacgtg    139620
     cagattgcca ttgccgctat ccattgcgac taccgtggtc tgtatgaatc tctcaatatt    139680
     ccgcccagag ctggccccac cgaagccgca gaccaagttg gctattcttt ctacagggag    139740
     ggctggaaaa gcgtacaaaa gagttgggaa tgaatcctgt tgatcaagaa cctgtgatct    139800
     attccgggga tgagactcat gcaacattaa cccttgatat ggggtccact gggaatgagc    139860
     accatactcg cctccgcgcg gaccttatgg attagcgatt tggaggatac tttagacacc    139920
     gaataccgtt caggggctat gttgagagat atttctggct ttcattcgaa acagctcgta    139980
     aacttgtttg cgaatacgga ccggatgact atttcgaaag caatgatact cactggtgta    140040
     agacgccaaa tctcgaaaga tgagaatgga aatgatatga tgtacgacag cgatgagaaa    140100
     ccggagaggg acgattcaag tcacaaataa gcacacttgg atatcttatc cacgagaatg    140160
     cacaggagag ctgatatcca tctttgtctc gtaactgcac ccacaacgaa gtaggttcta    140220
     tagttaggtg aagttccaaa aaattgatag cttctcaaag tgactatgta cgcaactagt    140280
     gcctatctat gtaggtatat acgttaatcc tgactcattc cataatctca agggtatccg    140340
     caatggtgaa cttggcatcc gtcttactct gcacctcttc tacctcaaca cccggagcaa    140400
     gttccgtcag tgtgagctct ccggtagctc ggtcaacctg gaagacacac tgtacctctg    140460
     tcagccttgg tttaaatcaa ctgggatcat tgcacttacc aggtccgtga tgatagtgct    140520
     gacaacattg gcaccagtca acggcagact gcacttttgt acgatcttag gagacccatc    140580
     cttggcgacg tggctcgtag ccaccacgat cttggtcttc tccgggttcg agatcaaatc    140640
     cattgctcct cccataccct tgaagacctt gccggggatc atataattgg ccaaatcacc    140700
     gttggcactt acttgcagag cgccgagaat agacacatct acatgacctc cgcggatcat    140760
     accgaaggac tcactgctat cgaatgtagc agctccagga accaacgtca cggtttcttt    140820
     tccggcattg atgatatcgc tggtctgagt tagcgggagt tcggatcaac acgtctagga    140880
     acaacttacg gatccagttc ttgctcagtt ggataatcac cctggattca aatttatggt    140940
     tagtccagcc tgtggaagag attttgcaaa acttaccatt cccaagatgc cgttctccga    141000
     ctgaatccaa accttcacat cttttggcag gaacgacggt gccaacgtgg gaataccaac    141060
     acccaggttc acatagaatc ccggcttaag ctccttggcc gcccggcgac caatgagttc    141120
     tctttgaatc cgagcctcat cttttccaga accagctaca gtggtctcgc ccgagcgcag    141180
     cttcctgatt tcaatgtgct tgtcgtccgt ggcagggacg atccgatcca cgaagatacc    141240
     cggtaagtct acatcattgg gatcaatgga gccgattggg acaatgttct ccgcttccac    141300
     aatggtcagg gttgcggcct tggccatgat agggccaaat gccttggtag tatatctaac    141360
     caccgtcagt atccagtttc caggacgtac tagtacatat actcaccgga acacgcagtt    141420
     accagcctca tccgctttcc aggctctgag gatagctaca tccccagtca aagcttcttc    141480
     catgaggtat gtcttgccgt tgaattcccg cgtctcgcgc ggcttgccag actccagaac    141540
     tttaccggac tcgtccatac gaacgggaat ctttccctcc tggataaagg tgtcttcgct    141600
     tgtcagcaac aaacatggtt cgaggagatc tatacatacg gactcctgtt ggggtaaaga    141660
     acgccggaat cccagcaccc ccagcacgga gacgttcagc caaagtacct tgcggacaaa    141720
     gttcaatagc aatgtgtccc gtcaaatatt tcttctccaa tgccttatta ttcccgaggt    141780
     atgaaagtat cagacggttg atctggccat tctgcgagag cgtcgaaagg ccacccttgc    141840
     ccgcggcgcc ggcattgttc gaaacggctg tcagggagtg caattgatca gcgccccggc    141900
     ggtgcatagc attgatgagc gtttctatgc tatgtgtcag cttcgcttct tgcactggtt    141960
     ggttgttcgt ccacgtacct gcaactccgc aaagaccgaa cccagagcta aggattgtcg    142020
     atccgctctt gatatcggcg acagcggcat cggcatcttt gtataatttc gaaccgctgc    142080
     gttcgacctt aggagcgagg gattttaatg gcgtggttat ggagtatcta gtgctggtgc    142140
     tggtactgaa tggctgccaa gggcgcacac tggtgcggac tccgaggaag agtcgaggtc    142200
     gacaggcagt gagcgctttg cgcgacaaag tagtagatat tctaagagct gtcatacttt    142260
     atgattgttt agtccaaaac aaaaaaaaat acaaagcaag aatgaaatca tcgcgcagtt    142320
     aaaacattgt cggcatcggt tagtcggagc tacttctgga tgccgagggg ccactttcgg    142380
     aagcgccctc cgagcgcaac tttctgagct tctctctcta ctccgctatt cttctagagg    142440
     aaaaagaaat tccggttttg gtctcacagc acgatgccgg tttgtctaga acgaatatga    142500
     aaagcaagca cgtcgtataa ttccacgtaa aataccaaag gcggcccgcc aaactggaaa    142560
     gaagcccttg atcagcccgt caactgcttc ttaaaccgac tgggtttccc cttaatacca    142620
     ccatgctacc ttcaattacc actctgcttt gccaaagata cactagggcg tttagtacaa    142680
     gtgccttgca ttaatatggt aggtgacaga gtatcaaaat attccttggc tatatagaca    142740
     agctgatgat atggatatgt tcaaaaacga aggttcgttc aataaacgca agaaaaataa    142800
     acactggggt atgcaaatat ccaccttctg gtcctactaa aaattgaaat ccgggttggc    142860
     aaagtcaagc caatcccaat taagcatgtc atcaagaggc acgtccggaa ttgacgcacc    142920
     aaacgcggtg cccgctcggt tgactgcatc gacgatctga ttatctgaca tggcggagaa    142980
     atgcaatggc tcgaaccaca gatcctcggg tggtagtgtt actggcagcg gaccattatc    143040
     caggcatgtt gacgtaaata ccggctcggg tggatcgact ttgcccagat ttcctcggga    143100
     ttgtagaggc aaggctggtg cacgacggat caactcgcgc aggaatctcc cgtaaagcac    143160
     agatgcgccg tttcggtgac ttggtgttgc cccgattctc tctagaacac cggcagtctc    143220
     ttcgatgaga tttcggacgc ttggtgccag actggagttg ctgtcgccgg gtgttatgct    143280
     gaggctgagg gcagagcatg cggcgaagga gatcattatg acggtattgt ttggcattga    143340
     tttcagtcga gattcgccct ggatggctgc tcgcaggacg ttcagtgcag acgatagacc    143400
     agcggctcgg aagaatctct tgacttcgat tggggctgtt gggtgattga tgacaccgcc    143460
     gtaggtggac agctgagtat gcgtgacaag aatctcgacg tatgggggta gcgagcgtgc    143520
     tttagatggt taatatatag ccaatcaatt ttgggtatta gacttactgt ctccctcccc    143580
     aattgccaaa gcccatgttg cataccaccg ctcgtagaag gtttgaatag ttttcttaat    143640
     cctgttatat gatcagtatg taaatgatat tcatagaaag catgatatcg tacgactgag    143700
     cggcctccga gccagtatca acgatgcgat aactatcgca gcttgattta actttttgga    143760
     agagtccatc ctaaaaccgt tagaatggaa ttcaatagca taatacgagt attgcgagac    143820
     gagttaggac tggattcggg attgcaccta caaggtctct tcgaagaact gccatggaat    143880
     tcataggacc atcacgcggg tctgcaatgg tagataggtg ccaacgatcg cagttttcga    143940
     tgagtgttgt tggaggcacg gtatagcttc gtccacgggc aaggcaaaca ctgatcaaat    144000
     tagtttcagg tcgaggggca ctactgggag aatcaaacac accctctctc aacgacatac    144060
     agcgcaatcc aagctctttc acgtcttcgc aacagtctaa ggccccactc tgaagacgga    144120
     tcaacatcat caaatccatc catgtgcaaa gccctcttgg catcgataca ttccgctcgt    144180
     gccaagcgat tcatgagttc tgggtcgaag cttgaggagg gcgagacaat cttgttcaaa    144240
     gataggtcta gagcaacagt gagagccatg gcaatatagg agcaagtatc atcatcccct    144300
     agtctatcac cgggggacat ccatggaacg ttcgccatga aagccagaac tatctcaaca    144360
     gacttatggc ggtgtgtgat cactcgcttc gcgaggcatt tgcaatgcct cgacagtctc    144420
     ttggacaaag cagcagcaga cggcagaaat agggctgcac ctgccattat tgaagtaaaa    144480
     agaaaagccg actgggaccg tacaaagtac ggtgtgtgta ccaaaggatc gaggccccat    144540
     cgagtatgtg cgagattttg gtagaagctt gattcgtcaa ttatatatat atgtttggca    144600
     gtaaaaagga cagcccactt acaacgagaa caatgactcc gactcatcaa acgtgaccaa    144660
     tcctaactca atggggtcga cttcaggtcc aatatccaag ttcgctctcg taggaacaaa    144720
     aaaggatttg gcgcccggtt ctccttgaga ggtgctttgc atgaacgacg ggccttctga    144780
     caacggcact ggagactttg gcgcccgccg catcccggtt ggcgaaagct gaaggtcgga    144840
     agctctagca agcagctgga gaggattctc cgcatcgtca agagtaagac tctcctctgc    144900
     atgaatatca cgtggagatg tcatgcgcgg gtggtctgat gcctctgaga ctccacgctt    144960
     atgcccatgc tcattctgta ttaactggcc ctgagcctga ccaaggagtt cctggaggac    145020
     tgaaattgcc ctttgggcct catcgtcact agagtcgacc ttgggccgct tgattgcctg    145080
     ctcgatctga tgtatggctt tctccaagcc cttgcgcttg ctagatccca gttagatcag    145140
     tatttcattc cacaaccact tagtttagct cactttttaa cacccttttg tcggccgaga    145200
     tgatggttgg gcacaataca ctctgcatta gtctgtttac atttctcgca gctggactcg    145260
     cctgccaggc ggttgcaacg aatcttgctc cgccgacagt tcaagcatgc agcttgtttt    145320
     ccatgtggac tagaggctga acctgccgac tcgacctcca tgagtgagtg ttttgacctc    145380
     ggccatgggc actaatggga gaggcgggag ttgggggata atgaggagta gtggtttagc    145440
     cttatgaggc actttatcgc tactctcttc aacagcccgg ccgggctagc tcaatcggta    145500
     gagcgtaaga ctcttaatct taaggctgcg ggttcgaccc ccgcgttcgg ctattcctaa    145560
     aaccaaacct gagatttctt tttttgcttt catatattcg gcttttgttt tgttaggaga    145620
     tttgacttga aataagcttg accaatataa atatctaaat gattgtttcc atatatattt    145680
     gtgtttttac agattttcta tgtatgaatg gacgggatgg tagtagtgat atctacctag    145740
     gtatcatcaa acattgaatc taagctaaaa aagaaaaaag accttccctt tcgctctttg    145800
     ctttccccta gactcgtagc ctagtaccgt gcaccgatcc tttgtccatc cggaagctga    145860
     gtgaagattc caatgctatg tcccatttgc aacccaatta tagatctccc actatttagc    145920
     attacagaag ttaatagaca tatacagtaa tactatcgca ttcatttaat atatctccta    145980
     tgtcttctcg ctcagtcgtt ctaatcataa agatataaca catataatga gtgacgcaag    146040
     gcaatttggt gccgatgaac atacatggac tagcagcaca tgcatccaaa atactactat    146100
     gacatcttca gcttgcgcaa gatctctagt atatagctaa agggctggta tataaataat    146160
     actgggctga gtttgtccat gcgtcttcac agatacgtct gcctccccac tcaagccctg    146220
     cttagctcga gatagtatta gagacatagt gtcacatgtt aacttttttc tgatttctgt    146280
     agcggctatg gatgtatatc gagtaacgag tggtatcaat taaagattag tagctaaata    146340
     caagctccaa aacagtaagg ccgtttgtct tttcgtgact tattaatgga caatgaacat    146400
     agatcgaatt caacacagca aacgatcaca tataaatttc caatcaagca tagcgaacgg    146460
     gaccagtctc ctcatcacgt cccgctggca aagcaccgga tgcctgtgaa gcagcgtgag    146520
     gctgagcctg agacgcagga acctggctca tctcaggacc agcagccgga acaccctccg    146580
     ctgacgcagc ccgcgaaggc ataccggtac tgggaggagt agcatccaac aagcgcggac    146640
     cagactggtc gggcctcttg cttgccttga caagcgcagg cgcggggccc aagacagtcg    146700
     ggtatttgaa gcggaaaccc caggcgaaga acaagcgcag cttcgtccag aaactcattg    146760
     cgtcccacct cttctgaagg atctcagcgt cctctttact gcgggcacgg tatcccttgc    146820
     ggaaacaaaa cagacagaaa agagaaagag ggagccagat gaaggaccag aaaagaggaa    146880
     gaccacgacg ggtctgccag cccgtcatga gacgacggaa tcgcacccag gcctcgatca    146940
     tgcccaggat gaaaatgatg ccgatccagc ccagcgcgca gatcaataca attgcgagat    147000
     aggagatgcc gaggcctgat ccccatttgc tggtgaacca gttgtcgtcg tcgtagtagc    147060
     catagccata gtagtagcca ttggacgatc catcgccgtt tcctggtccg tcggacaagc    147120
     ctgtgtagta tccggagttg ccgttataat cgctgtctgt gtactgacac ctggcaccca    147180
     agtaccgaga ggtaggggtg ttgtaggagc tcagagagct cagagtcctg ctggggattt    147240
     gggtgggttc cacgaagacc acttcgtaga tgtaggtggt cgactggaag ggctcgctgc    147300
     tgtcaactga ggtcgaggtc gtaacatgat ccctgggcag caaggtcgcg atctcatagg    147360
     gaggggtgac cgcgacagca gtcgtggtgg tccattgggt agagcaggcc gtcggggccg    147420
     agtaagtcaa gttgaccttg tagacggtac tatgatagtt tccatcatca tccatagtgt    147480
     tatagtagcc atagccatag ctatcgtata ggccgcgttc ctcgccatag ccagtgggat    147540
     acagcttttg gacaacagtg tagtcataga cggtgtcggt ggaagtcgcg gtagacaggg    147600
     cctcggctgg caaagttgca gttggagaga tttgatgaat ctcagtgacc aagtcggaat    147660
     agtaatctgt attaacctct tgttcgtagg tatctgtcac gatccaaggg gcggcctgaa    147720
     caaatgggct caaaacgaat gacaagaaga gaataaatga gtgtgaaggc gccatcttga    147780
     atggtcctgg aggtttgcag gaaaaacaat caacgaggcg tccatggctt tataaaaagc    147840
     cctcgatagc gcctcttgaa gaccctgact ttttactttc atttgggggc gcttttgtcg    147900
     cctaagctat actggtttgt cctcgggtgg aaattgcctg cattagagta ggcagatgcc    147960
     ccggtgtgat tggcgatgtt cctcaatttg ccagggctaa gtggagggct tagcctattt    148020
     gggatcgact aagagaccct agacttttcg cctcatgcat ttaccaaatt ggtctttttc    148080
     ctttgttagg gaaaatgaca cagaatttga ctagcctgat gtatgagagg ggaaaagaaa    148140
     aaaagaaaag gaaaaaagga aaaaaaaaag gtcgatttcg cctaatcacg tatagaacag    148200
     cgcagaaaca aatacaagcg taacttcgtg gatcatcagt gtgttgcaag gtccaaagat    148260
     cgccaggaat ctatatgggg gattgacagg taaatcacgg attacccaga gcgtgagaga    148320
     gagagccact tgctcaatta gcagcccgta aggctcgtaa ccttgcaccc aagccatcct    148380
     caacctcggg atccacctgc ttgggctctt taacctcctc tttaggcaca gcatccgcct    148440
     cgaggttcat gcgcatatcg acacccgcat catctgccag ttgttccata agacgatcaa    148500
     cgtcagcctc accctccgca ccgtattcct gcatcgatac accctgagcg acatcctcga    148560
     tcgcactgct ggcgatcttg aagtcttccg accgggcgag gaagttgtta gcgtgggaga    148620
     cgaggtgttc gaggttgaca ctccgtgagg cagcatctag gccccgtgat gccaaagcga    148680
     gcgtccggga tgtgtcgcgg gtgctctggg cggccttgag ttcgttgatg atgacatctg    148740
     cacgcgccgc ttcggatttg agcgttactt ggcgtcgctt ctcgcgcacg gcggaggcgg    148800
     cgtgaatgcg agcgatctgg aattcgcggt ttttcatcgc tttgtcggct ttggccttct    148860
     ctgatttgaa ggtcgcctcc gctcggacgg cttctttctt gagtctgttg gaatgtagct    148920
     ggggagataa gattagccat ggcttcatgc acaggtgggg tgatgtacgc tgtgaggagg    148980
     gaaaacaaag tggagagcaa cttaccttga catttgtgcg ggcttcgaag atagggtctt    149040
     tgcgaaccat gatgtcggtt agagataata tagaggaggg tttgtaggtg ttgtggaagg    149100
     cagatggatt tgggggcgcg tggcaacgtc actgaccgca ttcagtgcat tcttagcggc    149160
     ccgaggttgg tttatttagg acaaggcgag attcaccgat atgtcaaaat aatatatctc    149220
     tactataact ttgtaaacgg actaaaccta cggtggcgat ttggcgactt aggagaatta    149280
     ttacatgaac taagtacgtc ttcgaaataa ttgcaagatg agccagtcga ttttgcatta    149340
     taaaaactag tatacaggcc aaaaaaaagg gaaccctcag cgctgtttgc ccatgagcaa    149400
     agatgaaaga gctttgctcg cgcttgaact ccggaaactc cgtgtacctc gatgcatctt    149460
     tccattactg cgttgccgac cggatttcat tgtgtttgcc cgctggtgtc gtttagacag    149520
     gctgagacta tcgattgccc aggccatagt taataacgac tcccaactcg gtcgagcctc    149580
     cgaggcgcca gccgaccagg tctgcgggga gaaagtctca ctaaccgcta gctgcaatgc    149640
     tctgcccgtc gcatctcgaa gtggacgcgc catggctggg ctgcaagcta gtagtctgga    149700
     gagaagtctc atccgaaaga ccggacggct ggacgccttc gaggacgaca gactcggggt    149760
     cgaaatcaac catagaatca aagggaaatg ctgatatatc tcctccgtcg agaacgtcaa    149820
     aggcaaaccc gtcttcaggg aaagaaggat ttggctcagc gggtgaatca ccgtggaata    149880
     ggcggcggaa gtcatcgtca gaaagaggag ctgcaacgtc atttgcagtc tgaggttcgt    149940
     tggagaggtc gaagaggggt agggcacttc cagctccttc gaggccagcg acggacactg    150000
     caggtcacac aacaccgctg caggatgttg tgtcacgtcg gaggcctcag ccagagtgga    150060
     aggcttgagg gtgggagagt agtcggtaac ggagggagtc gggaaaggaa tccgctccat    150120
     aggaagttcg tcaccttctt gtttgaagag ggtaggtgtg agggtgggag attcgacggc    150180
     gggagagctg gctttgggag tcacgctgcg agatccacgg acctcggcgg agagcttagc    150240
     cacttgttgg ctcaagcggt tgttctctgt ctccatctgc gatagacgct ggatcaggaa    150300
     ctggttctgt tgttccatac ggatcttctc ggtctcgagc ttctccatct cgagacgctt    150360
     gcgctcgcgt gatgtttgag cagcagcgcg gttccgaaga acccgttcta tccgacgctg    150420
     ctccttttca tcatctgtct tagcgcgttt tctagaggca gagttagcgg ggctcaacgt    150480
     tcaaagagac taaatgggca acatacctgg gaggaaggtt tgttttcggg gttgggagtt    150540
     cttgtcccca agactttctc ttcttggttg gtttcttctc gtcgtcttcc accttaacat    150600
     catcctccgg ctccggagac tctaatgatg tatccgcggg ggaaactgtg tacatctctg    150660
     gggatggtga ggttgggaga gtatccaacg ggttgatagt atccgccata gtgacagggt    150720
     caaatggata accggtgccg gacgtgaata ataattgtag tataacagac ttataatgac    150780
     ttgagtgaaa agaagaagtt caaatcagag gccacgttat catcacgatc ggcaccggag    150840
     accagactcc gaagaggatt gattgagtca gaatggtgag tcagcgaaga gagagaaaga    150900
     atggaaagga cagctgttca actgcaaacg ggggatgggc gagatgaggt ttaagtagag    150960
     gccagcgtgg tctgaaaggg atggactccg ggatggaaca aagggggggg ggttaccttg    151020
     gaacctgggc acacacgtat gtcaggtaca agcaacacca tacattttag catgtgccac    151080
     caagtacctc aaaagggggc tgagttcctg ttacgagaca cgtaaattac gttaatttcc    151140
     ccctgcattc cgtggttcag cccctgtcaa cagccaatca tatgatttgc cgctttgaaa    151200
     catcgctatg gagctccgta tggaatacgg agcacacctg ggcacatccc actcacttct    151260
     ctcttgagtt ctataattgg gatactggcc cccatactcc gtacacttgc attggattgc    151320
     attgagtacg gagtaatatt tacagagtac gtgcatattc agcttctcat ttttatatat    151380
     cgggtaatac aagatacatc cagtcactcc gagtcgatct atctgaatca tgatacgtct    151440
     gtcccacaat acaaatgatc cgatatcata gggagtctcg aacaatctag ggtggaccta    151500
     ctccgtagtc ctcatacgtt ctctcctgag tctgaaaacg ctatcaggat tgcccggaga    151560
     atgctccatt taaacgccaa tcgcagatgt tttgtggttc atggctgccc cgccccgtta    151620
     attctccgtt ccccctgact gagaatgtga cggtgattat gtatatgtat gaactagggg    151680
     gcccattgtg ccatttagat tggcggaaat catcctgggg tcgctacgga accccctcga    151740
     acacggcaga atgtctaggt caaggggctg aaacggacgt tacagcgtat actccgtaca    151800
     ttgcccctcc gttactattt agggttgacc tcgggagttt ataggagtga ctcctaccac    151860
     gtgctgtcta tgaaccattc atgagtttcg gtgaaaaaga taatataaat gtgtacctca    151920
     attcaataca ctatattcag tgatcggtat tgtcatccca ttttggaaac cctcgacacc    151980
     aggggaatta tatgcagtcc ctcaaacaaa agaagaagaa aaaaacgcca tcccatagaa    152040
     aacgtgctca tcacaatatc gtaagcaaac atgtgcgggg cgaggatcaa ttgacctcct    152100
     ctacatggtg acatccatcg tgtcatcgcc agcatcgaga gcattctgga cctccgggtc    152160
     ggggaccacc acaccacgtc ctcggccagc aatcagttcg cgtcgcactt caggtccaat    152220
     gtccttgtgt ccacggacga gaagcaaatc gagaagtgct tcacgctggt cctcagtgat    152280
     gtcgttacga taacgctggg caaagaccaa aagggactgg tgccagagaa ctggcagctt    152340
     gtatgacttg gaaccgagcc ctgagggtcc gtcgttcatg gcatcctccg aaggatcaac    152400
     ggcacggaaa cgcatgaagt ggaataccaa ggcgtcaata accttgtacg gcagggcgta    152460
     cttcttctct aggaagacac ggatgaacat gttgacagca ccggtgctct ccagggaggt    152520
     caatgactgt tcggcagcca gatcacacat gcggagcaac gcggctgcgg agtgcagcac    152580
     gggaacggag acacgggcga tcacagaaga gacaatgtgg gcttcacgca aggtgcaggt    152640
     accggtggac acgagcggga acaaaagtcc cttgaagaag cacgcgggct tgtacagggc    152700
     cttgcgcagc gcattgtagg tgtggacgtt caacttcttg gtttcgtgga tttcctcgcg    152760
     cacgcgctcc aaaagcacag cgttgatgaa ctcctgcgca actgcaggct tggacgaaat    152820
     gaagatacgg gttacagcgt agacggcgtt gccggtccat gactcagggc gagtgatatc    152880
     caaaagagtc tgccagttcg gtacagaggg aaggatcttg atgggcttgg ggagcgggcc    152940
     agacttgtag cgagaaagaa tcatgccgac cctagaacaa gttagctttg cctctcaagg    153000
     aaccatcgga aaacatactt ctcatatact tccacggcct tggcgggaat ctgcactgca    153060
     tcctcgggga caccaccacc ctggatgtat tgaccatagg gcccttcgcc agcctgcttc    153120
     gcctcgtgct cggcaatctt ctcgagaatc aaatcggcaa ggttggtagg accagcggag    153180
     ctgggatcct tggggtggaa tatagggtcc tcctcgtgag gcatgaattt gttgaacata    153240
     tctagatcat tgggatcgac ctccttgtaa aatgtcagaa gcaacatcat tactcaagga    153300
     ttcgggagtc tcacaacttg ctcgacttct tcatcaaccc aatcgtcagc ctcaaacttc    153360
     ccctcatcgt cggagaaagg ctcctcctca tcctcgagtc gggtatcaaa ttcaaatgca    153420
     ttcgacttgg gccgtgctga gttcttgagt tgctcagcgg catcctcgtc ggccaattcc    153480
     tgtccaatct gtagaatctt gcgcgacatt ttcgcatcga cgaaacgctg tccattttcg    153540
     ccatcctcat cgttttcgtc ggctttgcct ttgcctttct tgctgctctg tgtccgaagg    153600
     tgccccgcgg aagtaatatc ttcagcgagt gggttgtgtc tgcgtgcagc agcagcagcg    153660
     cgggaacttg atacctttgg catggctggt aattcttcag ataaaccgaa gaaagcgaaa    153720
     tgagtatttt gggctggctt atcgaagtac acacgacgat caaattgtgt ggtcatattt    153780
     tttttttctg ccaggcggtg cccccccaat tacctcaccg cctgtacccc acaccgcctc    153840
     tattcacgca ttttctgcaa tccatcattt gaccgccttc gtttcccaag gagattctgt    153900
     ccagcgcgca tgcgattgac tcttttcttg cacaaaggaa gcctgctgcc tattagtgaa    153960
     tataggagtg atcagcatac tataagagct taattggtgg agccacaggc tgccagcaat    154020
     ctgggtcttt cgcgtatata cgctggaaca gcttgacaga caagcttcac attgagtaag    154080
     gacctctaac cgtgcagaag cagaatgcta tgcagcaata ctcattggat tacattttgt    154140
     tcaaatagct gacgcccccc agatccacag attaatttac agaccacgac cccaacgggc    154200
     aatcaagcct ccgtcatggc atccggccaa gcccccgggt cttccgctcc gtcgtccaat    154260
     atcaactctc cgatcctacc cccgaatggt ggacctcttc tcaatgctca atttacagac    154320
     ttgaacccgc gatcgtctcc agctccgtcc gcccaaggcg atggtcgagc gaagcgcaac    154380
     aagcgagaca gtcgcaagaa gcgtgaagcc aaaggactgg acaccgagaa cgcaccacct    154440
     ccaaaaaagc gagccacagc tgcacccagc acggccctgc ccagctccaa gcttagcatt    154500
     cttcgtccat tgttgctcgc cgagccgcac gcctcggatc gataccctcc acaacctcgc    154560
     caattgaatc gcgtgacccg aaagacgtcg gacgttttgg gccagagctg ggatttctac    154620
     gaggttgttg ataaactcac caacaagaat ggatttcgtt atagctatgc cattgcagac    154680
     cccggattcc ctcatatcaa atatcgacag accgatgttc gcccgtacca tacccgcttc    154740
     agtttcgagg attcaccggc tgccatatcg ttttcggaga gcgcgacagc agtaacaacc    154800
     agtgatgcat ggcatactgc ccgtgccaat gtatgtgctc gagagggcac gtattattac    154860
     gaagctcgcg tgattagtgg catagtcaat gatccccagg cacctcagaa caacgggaga    154920
     tcgacaactt caccccgtgg ccatgtccgt attggatttg cccgacgtga ggccgacctc    154980
     gatgtgaatg ttggggtgga ttgctatggt tacgggattc gagacgtgaa cggcgaagtc    155040
     gtcaatcgca tgcgatgcga gttcttcttc cccaagggag aggccatcaa tgaaggcgac    155100
     gttatcggca tgctcatcac tcttccgcct ctttctctcc acaagaagat tgtcgagggc    155160
     acttacgatc ctgccgataa tacctcacca cagccggtag caaccaacat catccgagat    155220
     cggattccat ttcactataa atccgatttc tgttggcagc aatccaacgt cttttctacg    155280
     aaacacctac gtgactacgc tttcaatctt aaggaaacgc cgacgtttgg tcccccgtcc    155340
     cctttgaaca gcgaagacgc cacgctccgc acactcccag gatctagtat caccattttc    155400
     aagaacgggg tacaaatggg cacccccttc aaagaactct atgctttctt gccgcctgca    155460
     agtcgtctcg ccaatggcac aaacaacctt ggtattggcg agcgtgagaa tgccgacgac    155520
     ggcttgatcg gttattatcc tgctgtgagt tgctacggcg gcggtgccgt cgagtgccga    155580
     tttgagggtc catggtgggt cgggccaccc gagaagactg aaactgggga gccggtccgg    155640
     gctatgggcg aacgcttcaa cgatcagatc gccgaggacg tgctggccga tatcgtggac    155700
     gaggtagaag ccatgttcac atggggcggc attgatggcg atgtcatcaa taacaacacc    155760
     gagctcgacg gagctggagt tgtaggaggg gcagaggtgt tgaagggtgg tgtcggcgct    155820
     gcgctggatt ctacgcttgc ccatacccct ggaactgccg gggcatctga ttccgctgct    155880
     aatagcaacc gtgaaacacc cgccgcaggc gatgtcggga accacggtct tgaagatgcg    155940
     atgagcgtcg ggacagctgg cactcccaat gttgaagtgc agggtgacgg cgatgtcgag    156000
     atgacttagt gacatactca acgggaaatg aagtaggcgt ttggctttct caatagcatt    156060
     gataccaatt taccgattct gatttcgaag tctattcaca taatatacat ttcatatagt    156120
     agtcgtacag gtatgggtct aatccaaatt ccttccctcc aacatctctc ctactctcat    156180
     gaccaactga tcgtctccat attgaccgat gacctggatt cctgctagtt cagcatcttg    156240
     ctgcccagac accatcacgg ggactgaaat tgcaggtaag ccagccagac tggcgggaac    156300
     ggtgaatacg tcggcgacat atgcgtcgag gggtgatttc ttggtagagt tgctcatcaa    156360
     gtccgacagt cgtggcgggg atgagggagc agtaggacat atgataacat ctacctcatt    156420
     ttcttttgca attttatctg cgccctgcgc agcgagcgga tgcttggctg taaagacagc    156480
     atcaaaatct tgctggacca aacgacggac ccgttgtgct tggatgaaat agttgtcaat    156540
     ggcatcggca ctcaaagtga atgtgcccag aacaattcgt ctctttactt cctgcccgaa    156600
     cccctgtcct cgggtatttg agaataaata tccatcaggc ttgccgtcac catctggtcc    156660
     ttcggcgcga gtcccatatc gtaccccgtc gtatttggcc aggtttgaag atgcctcagc    156720
     aggtcccagg acataatagg tagataatgc gtgtttggtg tcgggtagag agacggaatg    156780
     aacggtgtgt ccttgtttct tcaggtgtgc cagagaaaga gcccacgccc gccggactga    156840
     tggggtcagc tcggaaacgt tgtactctat tggcacgccg accctgagag gtgctgaagt    156900
     cagtcgcgag gcaagttgtg gtgtttggag agaggcttgg attcgagagc gggaggatat    156960
     tgagaggctg gtagggtcgc ggtggtcatg ctggttgagg atgtctaaac aagctattag    157020
     cgcagtcgtt ttccaatcac actggtaaaa actcaccgaa tatatctcgc acattggcag    157080
     tcgttttccc aattatacca acggtatcta gagaattggc gtatgccgcc actccccatc    157140
     gtgagatcag tccgtatgat ggtttgaatc caactgtccc agtgtaagca gctgggagtc    157200
     tgaccgagcc tccggtgtcg gttcctagtg agctgtagaa gtcaataatc tgtctccttg    157260
     ctgacgactg gccacttacg caaggcattg gtcggcagcg actgaggcgg cacttccacc    157320
     agagctgccg ccggccgaga ggtcttcccc gctggaatct cgacgagggt tcttgacagg    157380
     accaaaatgt gaattggtcg agtttgatcc cattccaaac tcatccaaat ttgtttttcc    157440
     agcgacaatg gccccggcgg cctctagctg atcgacgacg gtggcattga acgggctcgt    157500
     aaatttatcc aggattctcg aagcgcaggt tgtcggaagg tcacgcgtgc agatattgtc    157560
     tttgatggaa atcaagcggc cgtccactgc ggacttgggt ttccctggcc atatcggtta    157620
     attcagaagt agagagcgga ggtgagtccg atgttgctac cttcttcctt gcgcacatcc    157680
     gcttccttta cacggtccag ccatggcccc gcgcgcgaca gcggggttat gaaggcattg    157740
     aaaccatgtg catattgatt agcgacgcat ctctcagctt cgcgcaacaa ggacatttag    157800
     acgaatgtgt gaggagtata atatagaaag ggagtgggaa cgcaagtttc ccgggtccgt    157860
     gctgcttttc tacggtatct attccggtct ctgttaccct tgaagacatg tatctacata    157920
     catgtaggtt tataatgcac gacagactcc atagcctaga tatgagtagt tatatgctcg    157980
     aatatagaaa ccaatatgga acaaacctga gtgacctcgg agctacaacg tcaacagtcc    158040
     cttcgggccg agcgaaatcg actaagacgt catccggatt tgctcgacac tttctctcct    158100
     cctccactcc ctcacctacc aactatgttc tcgcgaagtg tactacagac ggccacccga    158160
     agtgttcgcc cggcctcagc tagagccgta ccacagctcg gtaaagctcc attcggtcgg    158220
     cgatacgttt cggtctatgg ctacacacag gcaaaagctc tcatctactc taaatatggc    158280
     gagcctaaag atgtcttgcg gtaagtcatc ctagctgcaa ttgagccaat aaaaactgat    158340
     caatttagcc tacacaagca ctcaatctcc gcgccgcacg caacccaagt gaacctgcgc    158400
     ctgttgaccg cgccgatgaa cccagccgac gtgaaccaga tccagggtgt ttaccccagc    158460
     aaacctccct tccaaacaga gctcggaaac gtggagcctg ctgcagtcgg cggaaacgag    158520
     ggcgcattcg aggtgctgtc aaccggtgcc ggtgtcaaga accttagcaa aggtgactgg    158580
     gtcattatga agcgcacagg cttgggtacc tggcgtaccc acgcgcagct ggacgaatcc    158640
     cagttgatca aggttgagaa caaggagggc ctgaccccgc tgcaggttgg cactgtcagc    158700
     gtcaaccccg tcacagcgta ccgcatgctc cgggatttct gtgaatggga ttggatgcgc    158760
     gccggtgagg aatgggtgat ccagaacggc gccaacagtg gtgtcggacg agcagctatt    158820
     cagctgggcc gtgagtgggg aatcaagacg ctcaatgtca ttcggcagcg caagacaccc    158880
     gaagagaccg aggctctcaa gcaggagctt cgggatttgg gagctaccgt ggttatcacc    158940
     gaggaggaga tgcttaatgg caacttccgg gatatggtcc acgagttcac tcgcaagggt    159000
     cgggagccca ttcgtctggc gctgaactgc gtaggcggga agaatgctac cgctctggca    159060
     aagactttgg cccctgattc gcacatggtg acctacggag ccatgtcgaa gcaacctgtt    159120
     gcattgccct cgggcctgct gatttttaag aacctcgcgt ttgacggttt ctgggtcagc    159180
     aagtggggtg acaagaaccc ccagttgaag gagagcacca tcaaggatgt gcttcaattg    159240
     actcgctctg ggaagttcaa ggatatcccc gtggatgagg tcaagtggaa ctgggagacc    159300
     gagggcccgg agttggcaga gagtgtgcag ggcactttgg gcggctaccg cagcgggaag    159360
     ggcgtcttca ccttcagcgg tggcgattga gtgaatagcc agtatgaatg tatcataaag    159420
     ccgaggtggt ttcctccgat atttacttcg cgatcaattg ggccgtatga tatggacctg    159480
     gaaactagga atgaattgta acaaaatgaa ttgaactaga aatcatatct atcaacactc    159540
     ccagttcttc tttacccagt caaggatcag gtttgttaga gtcgtgcctg gcatgtacgc    159600
     atcactttcc ttcgcaatat cgatatcgag accggcaaac ttggcggcca atatcacctt    159660
     tttctctatg aaatcaaggt agaccaaatc aactgtcttt ggtgtctcgg atgtgttggc    159720
     aggtatgagg gttcgaatac agttcggcac gcgataaaag ttgatgggtg aatggatggt    159780
     atcgtcacca tctgtgcccg catcatcttt tgttgtatat ccgggcacga ggtccgaacc    159840
     tgacatgggg atttgctcgc tagccgaaga ccatgtttgg gcaatcacgt cttccggata    159900
     agcaagttgc tcgggagggg ccaacgtcgt caatgaagtt tcttctgtag atagaacttg    159960
     aggctgctcg ttcaaaacgt cgacaacaag ctgtgccttg tcatatggaa catctttcac    160020
     gtagcggaag gtgctggtga atggagatac aataaaagcc gagtcttcgg taaaaggccc    160080
     cttgaagata tcgaacctca tagcgcccgt attgacaatg gctagtctgg gtacgtcgcc    160140
     acgagactca tccctcaagt cccccaaaac ttgagtttca agccaggtgt agatactgtt    160200
     ggggtccgga tacttggccc gcgacatcca taaatcatgt ggagcacatc catggacgtg    160260
     gtccagatga agatcggtcc gtgcttcggc gatcaattcg gagacattaa tgcccttttc    160320
     ggttgggaag gtctcttgat caagaccggt gtgatgataa taagaaagaa ggttgttgtc    160380
     aatgtatctg cgcttgaaga caggcccagc agcagactga tggcttgtct tactggcgag    160440
     gccatcgatt gacatgaaac caacagtttc catgaaccga ccgctcgcta gcccaaaggc    160500
     tttggaatca aactgcgcat agtcacgcac atgctggtgc ccgccaaaga attggattgg    160560
     agtatcccaa cgaattcctc ggatctcctt gaagatcgcc cggtattctg gcgaatgaac    160620
     aggcacatgg ccgatcacca aaaacagatc cacttcttta tctcgaattg cttcttggaa    160680
     ccagtcctct ttgatagtag aagataccct ctgcaccaca gtgttgttgt aatttccgtt    160740
     gaaatcaaag agaaagccaa atgctactat acggatgcct tgcttcttgg tagtgaactt    160800
     cttaaaccgt ggggccagag gcacaagctc tttcgtggtc gggtgaataa tgtcaatatt    160860
     cgaagccaga tagttgcccc ggaaattagg aacagtgaca agaagctcag cctccgatgt    160920
     gttttgcttg tatagctcgt gatttccaga cgtcaatagg tcgatgtgct ggtgccggag    160980
     gatgtctgaa aggtaaatac ccttaggctc ggacgaatca tatagaccat tcccttcaac    161040
     tcggtcaccg gtgtctataa ctagtagatc ttgtccttgg gcttctgcct tttcccgcat    161100
     gcgcgtggta aacgatatat agtcccccca gtctgcggaa taggacggtc tgcgattgtt    161160
     agcgcaactc aaagcttagc aggacctaaa gcctactctt gcaaatgacc ggccagccag    161220
     ccatgagtat cggtagtatg aatgaaattc agttgcccga attcgaggtc tcgtaacgga    161280
     gcggagatgg gatcgggtgc ggagggttga gcggcgagtg ccgacggaag tagccagagc    161340
     aaagacaaca tcattaccaa taatacaccc ttggaagaat gtataaaagc atgagtttgt    161400
     aaggcaaaat attggaagga cttcaaagac tggaaggaag cacgtagtta tgcataagaa    161460
     cctaaaaggt agatagctcc ccaaaagata tatgaggaga gtaaacaaga tgcctccgag    161520
     ctcctctcca atttcttgta tggttacggt tacagtaccg gtgagctctg atatcacgtg    161580
     ttgcccaaca tcttcggatt tgcatctcga ttattcggac ggcgataagt tttcccttca    161640
     cttttatcta taacgttctt cgattcaatt gcttttgcgg tccgaatttg gtctgtgatc    161700
     tttgattgaa tccttctttt ctttttttta gttttacata ttctccaatt cgatcatatt    161760
     tccgcaatgg cagctccccg acttttccgc ccaacagctc gtctgttttc ctcgcgcctt    161820
     gcttccaccg ctttgcgctc gaatcttcgc cagtccgcct gtgctccctc aattctgcgc    161880
     cgcggatatg ccaccgagac cggtaccaag gaggtcactg ttcgcgatgc cttgaacgag    161940
     gctttggcgg aggagttgga agccaaccag aagaccttcg tcctcggtga ggaagttgcg    162000
     cagtacaacg gagcgtgagt aatcattgag gtccggttga atccagaccg acgctgaact    162060
     tccgcctcta cagatacaag gtgaccaagg gtctgctcga ccgcttcggt cccaagcggg    162120
     ttatcgatac tcccatcaca gaggccggct tctgtggtat cgccgttggt gccgctctcg    162180
     ctggtctgca ccctattgtg agtattttcg gaagggaccg ttgatccaag atgcgcattc    162240
     taatcgttca caatctagtg cgagttcatg accttcaact tcgccatgca ggccatcgat    162300
     cagattatca actccgccgc taagactcac tacatgtccg gtggtatcca gccctgcaac    162360
     atcactttcc gcggtcccaa cggtttcgcc gccggtgtcg ccgctcagca ctcccaggat    162420
     tactccgcct ggtacggcag cattcccggt ttgaaggttg tctccccctg gagctccgag    162480
     gatgccaagg gtctgttgaa ggctgctatc cgtgacccca accccgttgt tgtgctggag    162540
     aacgagtaag gtcccatcca ctcattttgc cggaattcgc gtaaactaac caatgctagg    162600
     ctcatgtacg gtcagtcttt ccctatgagc gaggctgccc aaaagaacga cttcgtcctt    162660
     cccattggaa aggccaagat tgagcgccct ggaaaggacc ttaccatcgt ctctgtgtct    162720
     cgctgcgtcg gtcagtccat gaccgccgcc gccgagctca agcagaagta cggcgtcgac    162780
     gctgaggtta tcaacctgcg ctccattaag ccccttgatg ttgagaccat cattgcctcc    162840
     ctcaagaaga ccggccgcat catggtcgtt gagtctggct atcccatgtt cggtgtttcg    162900
     tccgagatcc tggctctgtc catggagtac ggcttcgatt atctgaccgc ccctgccgtc    162960
     cgtgtcaccg gtgctgaggt tcctactcct tacgccgctg gccttgaggc catggccttc    163020
     ccccaggagg acaccattgt cagccaggcc gccaagcttc tgcgcttgta agccaataaa    163080
     tgagggcgag tgaggagctc gcaataatat agctatgtgc ctagtaccct ttcatctgtt    163140
     ccatcttatg ttgttttatt ctgcttttgt tgtccaatcg ttttagacag tctcttggaa    163200
     agcatgtacc attacatcca tatcaggacc agcgtaaatg tgcttaaaca gcttagacgg    163260
     aaattcattg ctgcccagta acgtaaagat aaaaagtaaa aaaagataac cccataccct    163320
     tcaacgccat tgcatatgca tatgcatttg atacatgata ctcggttcaa ttcgcgagcc    163380
     atctccggcg tcaaggtatc tatccatcag acccttgggg cagtacaccc agcgaaacag    163440
     tccgttggct ggcgaggatc ataatatcct tcttggccat actcctcatc ggtgtcactt    163500
     tccatatcac catattcacc ctttttggct ctcctcacct gggagggatc atcggattga    163560
     ggtttcgggc cattatcttc atcgtcgtct cctaggacgt tcttcttgac tggggctgcg    163620
     ggggccaccg ttcccttgac agcagcgaat gagcttttga aacctccctt cttgaaacct    163680
     gagcttcctc cacttgatac attgtccaca ggagtctcga tgacttttag accggcctgc    163740
     gcatcggctt tacgttctgc gcggcggttc ttctcgacgg catttggatc acgtgttagc    163800
     tgtttgagat cttgcaaacg ctttctgtgc tggtgatcat atgatccgat gtgtgcttcg    163860
     tattccgggt ggcgcgaata agatttattg caaagggtgc aggtgaagga gctgagtgca    163920
     gaccgcgctg actcggtcta taagggttag cttggcgata acagatatgg cagagatata    163980
     tgattgatta ccctaggggc gggattcgtg aaaccacgct atattcatta gctgggcatt    164040
     atatttggac caaaaaaaag agcataccgg cgccattatt cttgaacaag agcactaggt    164100
     gaaattcagt gagagagcgt tttgtacggc tgagcgttgc gaccatctgc gtattaataa    164160
     ctgggcgtct aacgcgtcgc tgcctgtgga gtcaggcata tatgggctca tgatcgtgca    164220
     ctatttttag tcattagcta gctagtatat gggttatgtt ttaaccatgg caagagttga    164280
     acctacactt aatttccaac cctttatagt acattaacta ggtaacgcaa gctgctctag    164340
     taatatacct gcattaggta cgtacaacat atatataccg agtcacatga tcctggatcg    164400
     ggctatcgtc ttcacccgca aaggaagtga ccaatcatag ccgccgtatt ttttagcgac    164460
     tcagccttgg agctccaaca ttccctgttc ttccctagtt agcccaatat ggatgcatga    164520
     ttgacgaatt cctttcttac gagttttatt tttatgcttt tccgcagctc ttgaatccaa    164580
     aaatcccgaa aatcaaaaat gccgtcccac gtgccctcca aaccggagga catcgatacc    164640
     aagtccatca tctctttgca agaattagag ccgtcgcctg ttcgtgattc cctggacgtc    164700
     gaaagcggcg aatacttccc tagggccccc tctcccgctc aacatggaat tggaatctca    164760
     gtgcccaaac tcggccttag tggtcatggc tgggattcat ggcgtacgtc aagcgaccaa    164820
     agctagttga tattctctaa ccacaatcat tatttagtga ctggtattca aagatactca    164880
     acgtacccac ctacagcttt cttcatccta catctcgcca acacctctct tatcccactc    164940
     gtgactcgct ccgtatccgc gagcgaatcc taccttttac tcacacgacc catatatcag    165000
     gccccggggc tagagcatct tgtcttgact attcctataa ttgcgcatat tgcctcagga    165060
     attgctctcc gcaacattcg tgctacgcgt agagcacgtc tgtacggcgc cgagactcgc    165120
     gcacagcgga gcacgttata tttctggccg cgcatgtctt tacaggcacg cacgggatat    165180
     tttgtcacgc cgctgattgc attccacgca ttcgtcaacc gtgccacgcc attgatcgtc    165240
     gaaggaggaa gctctggcgt gggacttggc tatattgccc atggctttgc tcggagtcct    165300
     gtgttctgga atgtcttcta tttcttcttt gtaagtgcca gtgtatggca cttcgttggt    165360
     ggctgggcga cctggatggg ctggagagtg accacagcgc gcaaggagcg tggccaaaaa    165420
     ggctcgttgg atggttacct tagacttaca gaaacaaagt caaggagaca gcgcaagatg    165480
     tggtgggttg tgaatgggat tgccactgct ggcgcggctc tctggcttgc aggtgctctc    165540
     ggcgttgttg gacgtgctgg cgaaggcgca ggttgggagg ccaaggggtg gaatgagatg    165600
     tatagtcacg tcccgatcat tggggagtgg ctgtaacagc tttgtatgat tgtgcatatt    165660
     atctatatag acttaatcct aatgtataaa aagaacctga agacgtgatt gaaattatct    165720
     ttctctacta tgaaaattta tttaccaata tcaagtcttg tactcggata tcaccacgac    165780
     gattgcctac agcaatatgt atatactcaa tataactcgg acttcttagt ctctcattgt    165840
     gagagtcctt acatgtatat gtacacatgc agcacatcaa cgttttatag tataaattac    165900
     aaaacaggta ttgttgtgta ctgtatgctg gtccgtgcgt agaatctttt tctccgtcgc    165960
     attgaatgtc ttgttgcgac atgctgtgaa aggcttcgct catgaacccc tcgttgattt    166020
     ttggttcagc aacgaaatgc gctaaacgga tattccttcc tacccttatt cccacccaat    166080
     tcccccgctc gacgcccact gcgatccaat cttttatccg aaccctttcc acttctagag    166140
     ccatggagga tcctcagatc cagctggtgg aacaccaggg agaaaaatac aacgtcgtca    166200
     aggaaggctt ggccaggatt cttaatccgc ccgcccaaga ggctgcttcg aaaggcacga    166260
     agaaggatct caaagacgat gaccaagtgc aatccgtctt ctacaaccca atccagcaat    166320
     ttaatcgcga cctcagcgtg ctagccattc gcgctcacgg agagcatatt atcgacctga    166380
     agaaacaaaa agcggcccag aagctgaaga ggcaggcagg caatggggaa aagaaacgga    166440
     agcgtgagga cgaccaggcc gaaaacccga ggcccgcccc gaaagcagaa cacaaggaaa    166500
     acacagagac aaatgaccag caggtccccg ctcccccggc cgatcaagaa ccgaaaccag    166560
     aagcccggcc agagcaaccc gcagcttcct tcactgttct tgatgctctg tctgcaactg    166620
     ggctccgcgc tctccgctat gcctcggagc ttccgtttgt cacaaaggtc gtggctaatg    166680
     acctgtcaag gtcagcaatc aagtccatga agaaaaacat tgagtacaac aatcttaaaa    166740
     caattcaacc caatctggcc gatgctcgag tttatatgta tgggctcgac gatgcgagca    166800
     agttcgacgt cattgatttg gatccatatg gcacagcatc tccgttccta gatgccgcag    166860
     tgcaagcagc caaagatggc ggccttttat gtgttacttg cactgatgcc ggtgtctggg    166920
     cctcgaccgg ctattcggaa aaagcattct ctttgtacgg cggtatcccc atgaaaggcc    166980
     tccactccca cgaaggtggc ctgcgattga tcttgaacgc catcgccatg tccgcagcta    167040
     agtatggagt ggccatcgag ccattattgt ctctgtctat cgacttttat gctcgtgtct    167100
     ttgtccggat ccatcgatct cctgcacagg tcaagtttac cgcgggcaac atgatgctcg    167160
     tttacaattg cgatgtcggc tgtggcgcat ggtcaacgca acccattggg tctactagat    167220
     ccaaattaga ccgcaaggga aaccccatat accaccacgg actagcccaa gcgcccgcag    167280
     ttggaccgca ctgcgagcat tgcggcacga aaacacatct tgcaggaccc atgtggggtg    167340
     gtccgctaca caatcccgac tttatccaga agattttgga catgcttcct ggagctgatc    167400
     gcgacacata tcagacctgt gatcggattg agggaatgtt gaccactgcc cttgaagagg    167460
     atttggacct aacgccatct aactccgagc catcaagtcc taaacaacct gcctcaagca    167520
     agaagaacct gcatgatcct gcataccctg ccatcatccc tcgaatggac gttgccgctc    167580
     gggaaaaata ccctttcttc cttacactca gtgctctcgc gaaggttatc cacgcaacca    167640
     ccattccaat cgacgagttc cgcggtgctc tcagccacct gggatatcgc tccactcgta    167700
     gccacacgaa gcccaactcc atccgcacag atgcgccctg ggaggtaatt tgggagatca    167760
     tgcgtgagtg ggtccgtcag aaatcgccta tcaaggaaac ctccttgaag cctggaaccc    167820
     caggtgcagc gattatgagc aagggccgcg aaaacctgcg taaattgggc gatgaggatc    167880
     aatggctatc gcttctcaaa caggacctga catctgccgt tgacgctggc agagatgtcg    167940
     gtgacttggt caccaaagtc gaagcggctc tctaccggtc cggatcgcga acctcctggc    168000
     aacgtgctcc tgctcctgca gagactctcc cagatgccga tccccagcct gtaccggaaa    168060
     aggaaaaggc acctgcacag cccttcaagc ggcctcatcc cagtgccctc gaggtggtgt    168120
     ttgatgaggc tttaggtcgt caggtgtctg ctgcccatac caagaaacga ttggtgcggt    168180
     accagctcaa tcctcgtgct aactggggtc ctctcaatcg tgcggggcgc tgatgtttag    168240
     atatcccata gttatacatg taaaagtcct ctgtacggtt tatgtttttt accaccttcg    168300
     tatacatcta cacaaggaca tctaaaagga acagtgtgtt cttacatata ccgtccttag    168360
     tatcgtcttg ataaatcaga tccctaaagt acgtcgttaa tgatagaggc tatgcgactt    168420
     gagtactccg tgctatcagt cctacctaca taggtattcc tatatccacg agtcatcgtc    168480
     ccaatggttg aaatggcccc aagggcttga cccaatactt tcttgttggg gtcaccaagt    168540
     gcttagtcac aggttaatta agaatcttga acctcggaat cgacgtaagc actaaattgg    168600
     aactatttat gtctgtctaa agctcttctt ggattgattc tgggataaaa tactccatac    168660
     tcctccatat tctacaagaa tggctgttgg tggttgtttc tgcggcaaag tccgaatcga    168720
     atatagtggc cagcctctag catcggttag tatgacctat tatacctagg caacattgtc    168780
     ctacgttaaa cgaagctaat atatttccca ttaggcattg tgccactgtc tcgactgtcg    168840
     caagctcacc gggggaccat atagcttcaa ctacatcgtc caaacagcag agctgcatgt    168900
     ttctggaaat ccgaaagaag tgccaaagac atcggacagt gggaacgaga ttaagaatta    168960
     tttctgtcct gactgtggtt tgtgttatac taagatgtgg gaagatagca cctaactaac    169020
     gtaataggta cgccgcttta tggactgaaa ataaagccca acggagatcg tgacgagact    169080
     acagtcatcc gggcagggat acttgataat gttgggattt tgcacgaacg gacgccggtg    169140
     gtggagatat atactgagca acgattgaag tgggtgagtc ctattgaggg ggctgatcaa    169200
     tttactggca tgttgccact cccataaact ggtgaccatg tgtctgtcat cttgatgctg    169260
     ggtacattgg gtgaggttcc atttatatac atattgtaaa acacaggcat cattctagaa    169320
     agcgaaagca cggtacgact gatctcgaaa actgtattaa aatgcaaact gaaactcata    169380
     tacatgcaca taaacacatt tgaactccaa ggctctgaga catatcacat aatgacccat    169440
     ggaaacgaaa gaagaaaaaa agaagaaaaa aaggtctatc aaaaacaata cattataaag    169500
     aggtatcaac agagatggat catttcgcaa cattttcgtt gccctcttcg tacttctccc    169560
     agttcgccaa gatagaggca atgcggggcg agttggtgag gcggtagaca tcctcgaagt    169620
     attccttggt gatctcgaag ggacgggcag tgacgttggg gatgtacttg ccgaccaact    169680
     tgctggggtc gatggtggtc ttgttgatct tcttcagcaa gaaggaacgg aagggcttca    169740
     caccagagcg caggaaggtg ctgtggaaag gaacatcgat acccttgaga ggaatggtgg    169800
     cgaaaccacg ctccagggag ataggacggg gcttggcctc ggtttgcttg acgcactcct    169860
     ggatgatgct gaccaggtgc tccttgacgt cctccagaga catactctcc ataagagcgg    169920
     ggatgtcaat gttctgcgcc ttcaagaagt tcagcaggtt ggtgaggcag tcaagagcac    169980
     ggaggtcacc ggctgcgacg tattgcatgt tggcgacgtt gtagttgaca atctccagca    170040
     gccagccagt ggtctcggaa atgttctcaa caacgtactg cagtgcctgc tcgttgaaag    170100
     tcttggagat acggctgggg ttgacagcgc acatggagta gttggagcga ccctgtgcat    170160
     cacgctcgac agcgacttgc atggtcagac cgcggtagaa cacaacagac accaagctct    170220
     caataggcat gacatcagca agggcggcca aagccgagta ttcaccaagt gagtggccag    170280
     cgaagctgct gtcgcgctgc accaatcctt tggcgcgcat gtcctcgaag ctggctttct    170340
     ccatcagagt caaggctggc tgagtgaact gggtggcaga gagaagaccc gtgggagacc    170400
     ggtaagtgta cgaggcggta ttctcatcga cctccttgaa gatcttctca gacttgatgg    170460
     acccgtcggc gttcactgac tcgaaggtca tggccatgta gttttgccga atggccttac    170520
     cccgaggacc accgaagtag actgtcagct ccttggggtt gttcttgaca atgtcaataa    170580
     tggagagacc gtagttctcc atgaagtggc gatcagcccg gtcccagacc tcctgggcca    170640
     ctgggctaga gccatataac tccataccca tgccctgctc ctgagagccc tggccagtga    170700
     agacgtagga agtgacgggc tgctcaacct cggcctcacc ttgcagaacc ttctcttcag    170760
     tctccttgtt gctggcttca accttgatga tcttgcgacc agcaatcatg ccgacatgct    170820
     gcagcttgac agtgatcatg tcgttgggta gaaccatacc gaccagcgag acttggaaac    170880
     cgcgaacacg gccaatgttg ttctcagcgg cccaggtctc gaccaggctg cgaacagcgg    170940
     cactgctgta catgccgtgg gtgatggttc cgggcaagtt ggcgtagctg gagaagacac    171000
     gggacacgtg gatggggttg tagtcaccgg acacgcgggc gtaggtctcg ttagaggcgg    171060
     gggcacgcag ttccagagcg gtcttgccac tgagcgggat ggggttctca aagtacaccg    171120
     gctgctcaat ggaggttccg ttacgctgaa ggtagtcaac cacggggtta ccgtgcgagt    171180
     cgcctgcctc gtattcgaca gacgcaactt ggatgacctc cttggtggga agctcgagaa    171240
     gaacctgtcc aacggtctgc acgttgctaa agacagtggc attcttgaaa cggatcaagc    171300
     tctgcaagcg gaatgtcagg gtctggccta gaagctcaat ctcagcatca tccatgcgga    171360
     accattcctt cgaacggagg atggcgacgt cccggctggt tgcaaggtga acctgaatgg    171420
     ggacctcatc cttgcgctgg aaggtgttct cgtagtccgt gtaagcaccc cggtacagga    171480
     actgactggt aacatgcatg atggctttgt tctctcgctt gatggtaccg cagacctcga    171540
     ccattttacc agaatcctgg ttgatgacag agttaatctg ggctgttgtg tccagaacgt    171600
     cgccaacctt taggggctgg gcgccgggaa ccatcttgaa tccgttggac aagtgaacaa    171660
     gcttcagcaa atctccgtca atggtgcgag ggaaaatagg cttggtgatt gcctgccagc    171720
     ctgccacgat ggcaaagtcc ataggggcaa agacctcctt gctaggacgg tcaacgaaag    171780
     cctcaccggt gttgccaacg gcgtgaacaa agtcggcaac atcctgggca gtgatggtct    171840
     tctggccacc gctgaaagtg gcagtggtgg gggtgtcgaa aggcacgtcc ttgttgccga    171900
     accagacccg gtagtagaac tccttaatgc gatcgttgcg gtcacccata acttcacgaa    171960
     tgggagcgta tccagtctcg gggtgataag tgaacaagaa gttcaaagga acaacgccat    172020
     tctcggcggt gcggccctcg aacaggctca gactaatctg ccccttctcg ttgatcttgg    172080
     cctcgactgt cttcaccaat ttgccagact ggtacggctc gcgcacactg ataacagtct    172140
     tggcaggatc attggggttg gatacttcca catacatgcc tgcggtggga gcgacaatcc    172200
     gcttcatggg gttggtctgg aagcggtggc cctgaacgta aacatcagcc aagaacagag    172260
     catgtctcca ggagtagacg ttgccggcaa gaaggccgag ccagcggtcc aagtctggca    172320
     aagctgcagt agaagacaag cggaagctgg tcttgcttgg ctcttccgag ataatcaaac    172380
     catcagagtc cgagtcagtg gtgctcataa gctgcccgcc gaagtactca atgacaggaa    172440
     tcttggtgct gtcgccaccg tagacatcgc gcaggaggcc agcgatgtgt ccctggtgaa    172500
     caccgtcaag aatgtcctta acaggctcat caatgacgtt agagaagcgg gcagccatgg    172560
     gaccctgaag aatacaggtt cggccgacgt cttgatcgac aacggcctca agatcctcac    172620
     tctgccacag agaatccttc ttgaagaaga actcaaagtt ctcatctagc acagggacga    172680
     aaggaacggg cttctggcca cgcttttggc agagcagcag gaagtgctgc acatcctgcg    172740
     cattgatcag ctgattggca gcttcggggt aagcagacaa aatattgtca acggcagggt    172800
     agggggtatc aatatcagaa taactctgaa gaagcgaggc ctggccttgg gcagtagtga    172860
     aacgctcctc gacacgacgg atgaagtcac ccgtcaagcg cttgagcgag ggatcgatcc    172920
     atcgcgactc gtgcttgatg tacatgaggt ccaccatgcg gcgaacgacc tcagcataag    172980
     tcatatcttc tagatcaaca gtctcgcctg cagcattgcg accgaaccag accttgtgga    173040
     agtcatcatt cagcttcttg atgatgtagt tccgttgctt cttcagttcg gggacacgct    173100
     tggccttgtc gagcttgaag atcttctggt ccatttcctg ccagaacagc acgccgcgag    173160
     tggccagctt atggatgggc tcacccattt cagacagaac agtgatcaca ccacctgttg    173220
     ctttctggta ggtcttctcc cattccgcat cgtccacacc aggggcatca gcaattgcct    173280
     tcttagcatt gtaagaggtg tgtgcctcct ttgcaatcat catgcgagag ccgaagagac    173340
     agccgtcgaa gggcatagga gggtagccat acttggcgga ccacttaccc gagaggtaag    173400
     ggtaagtgtc ctccgaacca ccgaagccac tgccggcaac aagcacaatg ttatcttgct    173460
     tgcgaatacg gctgtacatc tggagaatgg gctggtggaa gtcctcgaag gagtggtgac    173520
     caccgccacg gccaccagtc cactgaagga tgatggggaa cttagggttg gccttggcaa    173580
     cattaatgac ttgctgaatc gcatcgacgg agccaggctt gaaggcaatg tgcttgatac    173640
     caagagtttc aatgtattca ttggcaacct caatggatgg cacaccggcc ccaatggtaa    173700
     gaccctcaat cggcacgccc tctgcgcgca accgaccgat caacggaatc tgccaggcca    173760
     tcgcccgggg gttgacatag atcaggttaa tagtgatgcc acggccagga gggatagcct    173820
     tctcaatctt ggtaatggct tctgtcatcg tcttcgcgtt gtagtagcca ccaccagcca    173880
     gctcgatgtg ataaccggca ttcatagtag cagccacaaa gtcccagggg acggtggtgg    173940
     gtgtcatacc agccaccatg acagggggga ttcccaacag acgactcatc ttggtgtcca    174000
     cgtaagtttg accggtagat gtctgtgtca ggcgagggcc gtgctccttg acccagtcaa    174060
     cagcaaactt gacggaatgc tcatcacggt caaagagctc tggcttgtaa ccgacctccg    174120
     cgttggttcc gtccatttca ccagcgagaa tgacccgaac accggtacca tccttgttcc    174180
     tgttagtcag gacgcccaga ccagagatgc cacctgggcc gaagtcaacg atgtgagttg    174240
     cacgggggaa gacagtggct tgctcccagt tgaccgcatc gtgggtgatc atgcgaacca    174300
     gtgagggcac aacgtccttg tctcccagtt gccgcagatc ctctccagtc ttggtgtgga    174360
     agacggggat ctccagtgac ttggcgggga tctcaacaac atcttccaga tcctcgagaa    174420
     tgcggtcata cgcagaaaca aggtactggc tgtggaaagg agcagtaatg gggaggaaac    174480
     ggttcacaaa gcggaccttg cgctgggtga agggcatacg gttctggtca agtccggtgg    174540
     ccgccttgac tttacgcaag cgaacattca gaccgtaaag cgagatggga ggaccagtca    174600
     cgacaaagtt gcgagcactg ttcactaggg aaatggagat gtggcggtcc tcgggcaaat    174660
     gttggttggt ggcgtcgatg tgctcctgaa cggcggtgag cgagaggtcg cggatagaca    174720
     gcatgggagt aggggttccc tcgccattct caatcgagtc ctggagaacg gacggggcga    174780
     ttgaggtgcg agggtaggcc tgctgactgc gcagaccaat ccagaacaac atggtcaggg    174840
     cattctgggc cgctgtggca aaggagtccc agctggtagc ggttgcaata acggcagcgg    174900
     tgacgactcc ctgggagtga cctgtggtac cgaggatgcg ttctaggaca tcaccaggtt    174960
     ggcggccaag gaccttgcag gtaaccatat agtgggccaa ctggaccaga ccaatcaatg    175020
     gcagactgac gggggcggag accaggtaat cgatatcggg ctgtgcatcc cggtcttgca    175080
     gccattgcat gatatccatg cccttcgggt agagcttgct agcctctggc tcacgagaga    175140
     gcgtttggag caattcggcg gaggtagtaa tgagctcttc gacaaaggaa gggtacgtgg    175200
     tgtagatgtt gcgcaattcg tcgaagtact cctcaatatt gccttgacca ccgaacacag    175260
     agtagatacc tgcagcctcg tcggatgccg cacggaataa ggcagagtcg tagggcttgg    175320
     tgggcctgcc cgccgcagct cgcccggcat agtaggcctc gacgacttgg ttcttcttgg    175380
     caacaatgcc ggggagcgca gctgccacgg cgtgaacgtc attaccgcgc atgaaggcac    175440
     gttcaaattc attcaacacg agcttcagaa cgtccaggta gttgccctgt gcatcgtctt    175500
     cctcctcgag ctcgtgggcc acatgcccaa tgtagcgggc gaccaactcg gtcactgatg    175560
     atggctcatc atcttgggcc aattcgtctg tgggctcggg taaagaggca gtgaagctat    175620
     ctttcaactg cgatgcatgg aagtgaagcg aggtagggac gaggaaagag aactcgaggg    175680
     atccatgcga gaggatgaga gggcggagag attgagagga tcgaggggtg ttgataccgg    175740
     tttggggacc ggtcgatgtg ccgtacatga tgtggctctc tctctgttga aaggaataga    175800
     aggagattaa gaaaaagacc agagggaccc taaaattgaa gaggggtttc ctgttgctgt    175860
     gttagatttc atggaataac accatctcga ggggtcaaac tcactggggt gacctgagtc    175920
     ctggaaggtc taaagtagaa aagggggggt attatcaaag gaataaagac aagtaaaggg    175980
     acacaatttc aacagatata caatataaaa taaggaaaga ggtccagagc acaattgagc    176040
     ctgaagggga aagcaatagg gaaagaaaaa aaaaggtctg gttgaactgc agacagctca    176100
     aaggggttta gcgtggtagg agacccgccc caatgggttt tgacttgggt tgaacccgtt    176160
     gggaatggtt acactgtgtt acccatgtat tgtaattgag ccttgaaata tcggttttta    176220
     tagtttgggt tttttatatt ttccatcgta tcacatatat acatgtagta acatctaaat    176280
     atcaatctaa ctatatctaa tctacctaca tatgtggtcc attgagttgg tgattgctgt    176340
     tgggatctct tcaacatctc cccgtagtat attttccccc ctgaacccca gctagctatc    176400
     aaaaatgatc cacgcaatgc cgcaaatcgt tgcttagtgt cagatccttc ggccgaagct    176460
     ctggaacccc aacgccctca ccaatttgac cttgtccctc cccattcatc cgaacatcgc    176520
     tgtctatgac ttgataattt ttataggatc atcaaattat tacttttctc attctcccaa    176580
     tatcatcttt acaattccac cgttgtctat agggtgagtg gttcttgttc cttccttttt    176640
     tatttttctt tttggccatt atttccatgt tgataaaact ggaaaattac catccggtat    176700
     tatttgttac cacatctatc tccgtgctcc atttcctttc ccaccttttt tttcccttct    176760
     tctttctgga tcaatccaat tgtcttgggg actttcactg atacctttca tacataggat    176820
     tgactcctat tctaattctc tcccattact tcttcttcga gtcatcctcc cctactcact    176880
     cctttctccg cttgggcact ctacgacgac tccgtcgcgc cccccccaaa cccggacatt    176940
     tgtcctaatt tcgtccttct gtttaatcaa ttgataccca ttactttcta tcatgcgtcc    177000
     ggaagttgaa caagagctgg ctcacacctt gttggtggag ctgcttgcct accaattcgc    177060
     ctcccccgtc cgatggattg agacccaaga tgtgatcctc gccgaacagc gcaccgagcg    177120
     cattgtcgag atcggtcccg cagataccct tggaggaatg gcgcggcgga cgcttgcctc    177180
     caagtacgag gcctatgatg ctgccacttc agttcagcgc cagattctct gctataataa    177240
     ggatgccaac gagatctact atgatgtcga gcccgtggag gaagaaccag aggctgctgc    177300
     agagcctgct tcctcgcctg cccctggggc agcaccagct gccgctcccg cagctggagc    177360
     tcctcctcca ccccccagtg caggccctgc tgccgcagtg gaagatgtcc cagtcacagc    177420
     agtcgatatc ctgcggacac tggttgctca gaagctaaag aagagcctcg cagatgtgcc    177480
     attgtcaaaa gccattaagg atcttgttgg aggtaagtac aggccaaaat tataaccttc    177540
     gttcggtcta acatgtgaat aggcaagtcc acattacaaa atgaaatcct aggtgacctg    177600
     ggtaaggaat tcggttccac ccccgaaaag cccgaggacg tccccctcga cgagttgggt    177660
     gcctcgatgc aagccacatt caacggccaa cttggcaaac agtcttcctc gctcatcgcc    177720
     agaatggtct cctccaagat gcccggtggc ttcaacatca cttctgttag aaaatacctg    177780
     gagacgcggt ggggtctggg atccggccgc caggatggtg tgctcctgct tgctctcacc    177840
     atggagcctg ctgcccgtct tggatcggaa gcggatgcta aggcttacct cgacgacgta    177900
     tcaaacaagt atgccgccag cgccggagtc agtctttcca ctccggctgc cggtggtgac    177960
     gccggtggcg gtggtggcat ggtcatggac cctgcagcca ttgatgccct gaccaaggat    178020
     caacgagctc tgttcaaaca gcagcttgag atcattgccc gctacctcaa gatggacctc    178080
     cgtggtggtg aaaaggccta cgtgacatct caagaaaccc agaaagcgct gcaggctcag    178140
     ctggacttgt ggcaagcaga gcacggcgat ttctacgcct cgggcattga gccatccttc    178200
     gatcagctga aggcccgtgt ctacgactcc tcatggaact gggctcgtca agatgccttg    178260
     agcatgtatt acgatatcat ctttggtcgc ctgcaggtgg tggaccgcga aattgtcagc    178320
     cagtgtatcc gcatcatgaa ccgctccaac cccctcctcc tcgactttat gcagtatcac    178380
     atcgacaact gcccagctga gcgtggagaa acataccagc ttgccaagga acttggacag    178440
     cagctcattg agaactgtcg cgaagtgttg gaagtggctc cagtctacaa ggacgtggct    178500
     gtgcctactg gcccccagac aactattgat gcccgtggca acattggcta caaggaagtt    178560
     cctcgcacca gcgctcgcaa gcttgagcat tacgtcaagc acatggctga gggaggcccg    178620
     atctccgagt acagcaaccg cactaaggtt cagaacgatc tgaagaatgt ttacaagctc    178680
     attcgcaagc agcatcgtct ctcgaagtcc tcgcaaatcc agtttgatgc actgtataag    178740
     gacgtcgtcc atgctctcgg catgaacgag agccaaatca tcccccagga gaacggccac    178800
     tccaagaagg gcggccgtaa tgctaccaaa cgcactactg ccacccgccc tggaaaggtg    178860
     gagaccattc cattcctgca cctgaagaag aagaccgaac acggttggga ctacaacaag    178920
     aagctgactg gcatctatct gaatgtgatg gagtcggctg ccaaggacgg tctcagcttc    178980
     cagggcaaga acgttctgat gaccggtgcc ggtgctggtt ccatcggtgc cgaggtcctc    179040
     caaggtttga tcagcggtgg tgctcaggtc gttgtcacta ctagtcgctt ctcgcgcgag    179100
     gtgaccgagt actaccaggc catgtacgcc cgttacggtg ctcgtggttc ccagctggtg    179160
     gtcgtgccgt tcaaccaagg cagcaagcag gatgttgagg ctttggttga ctacatctac    179220
     gacaccaaga agggtcttgg ctgggacttg gactttatcg ttcctttcgc tgccatcccc    179280
     gagaacggcc gcgagatcga ctctatcgat tccaagtccg agcttgctca ccgtatcatg    179340
     ttgaccaacc tactccgtct tttgggctcg gtcaagacac agaagcaagc tcatggcttc    179400
     gagactcgcc ccgctcaagt tgttttgccc ctttcgccaa accacggcac ctttggtaac    179460
     gatggcttgt actccgagtc caaacttgcc ctggagactc tcttcaaccg ttggtactcg    179520
     gagaactggg gccactacct cactatctgt ggtgcggtca ttggctggac ccgtggtact    179580
     ggtctgatga gtggcaacaa catggtcgct gaaggtgtcg agaagctggg cgtccgtacg    179640
     ttctcccagc aggagatggc tttcaacctt ctcggcctga tggctccggc catcgtcaac    179700
     ctttgccagc ttgacccggt atttgcggat cttaacggtg gtctgcagtt cattccggac    179760
     ttgaagggtc tgatgaccaa gcttcgcacc gacatcatgg agaccagcga tgtccgccag    179820
     gctgtcatca aggagaccgc tatcgagcac aaggtggtca acggcgaaga cagcggagtc    179880
     ctttataaga aagttgttgc agagccccgt gccaacatca aatttgaatt ccccaacctg    179940
     cccgactggg agaaggaagt caagcccctc aacgagtctc ttaagggcat ggtcaacctg    180000
     gacaaggtgg tcgttgtcac tggtttctct gaagtcggtc cttggggtaa ctcccgtacg    180060
     cgatgggaga tggaatctaa gggcaagttc tcattggagg gctgcgtcga gatggcgtgg    180120
     atcatgggtc tgatcaaaca ccacaatggt ccccttaagg gccaggccta ctccggatgg    180180
     gtcgatgcca agaccggtga gcccgtcgat gataaggatg tcaagcccaa gtatgagaag    180240
     cacatcttgg agcacactgg tatccgtctc atcgagccgg agttgttcaa gggatacgat    180300
     cctaagaaga agcagctcct tcaagaaatt gtcatccagg aggaccttga acctttcgag    180360
     tcttctaagg agacagctga agagttcaag cgtgagcatg gagacaaggt tgagatcttc    180420
     gagattcccg agtctggaga gtacaccgtc cgtctccgta agggtgccac gatgctcatc    180480
     cccaaggctc tgcagttcga tcgtcttgtc gccggtcagg tgcccacagg ctgggatgct    180540
     agccgctatg gtatccccga tgatattatc gagcaggtgg atcctgtcac cctcttcgtt    180600
     ctggtctgca ctgctgagtc catgctttct gccggtatca ccgaccctta cgagttctac    180660
     aagtatgtcc acctgtctga ggttggtaac tgtattggct ctggtattgg tggtacccac    180720
     gctttgcgcg gtatgtacaa ggatcgcttc atggataagc cgttgcaaaa ggatatcttg    180780
     caggagtcct tcatcaacac tatgtccgcc tgggttaaca tgctgctgct gtcctctacc    180840
     ggtcctatta agacccccgt cggtgcttgc gccacggctg tggagtctgt ggatatcggt    180900
     tacgagacca ttgtcgaggg caaggcccgt gtttgtttcg tcggtggttt cgatgacttc    180960
     caggaggagg gctcttatga gttcgccaac atgaaggcca ctagcaacgc tgaagatgaa    181020
     ttcgcccacg gtcgcacccc gcaagagatg tcacgaccca ctaccaccac ccgtgccggt    181080
     ttcatggagt cccagggttg cggtatgcaa ctcattatga gcgcacagct tgctctcgac    181140
     atgggtgtgc ccatccacgg tatcattgcc ctgaccacga ccgccactga caagatcgga    181200
     cggtccgttc ccgctcctgg ccagggtgtc ctcaccaccg cccgcgagaa ccccggcaag    181260
     ttcccgtccc ctctgttgga catcaagtac cgtcgccgtc aattggatct tcgcaagaag    181320
     cagatcaagg aatggcaaga atccgagctt ctgtatctcc aggaggaggc ggatgccatg    181380
     aaggctcaga gcgacgagac cttcaacgag gctgattaca tgcaggagcg tgctcagcac    181440
     attgagcgcg aggctcttcg ccaggagaag gatgcccaat acagtctggg caacaacttc    181500
     tggaagcagg atccacgcat tgctcccctc cgtggtgcca tggctacttg gggtctcaca    181560
     gtggacgaca ttgacgtcgc atccttccac ggtacttcga ctgttgcaaa cgacaagaac    181620
     gagtccgatg tcatctgcca gcagatgaag caccttggac gctccaaggg taatgcagtg    181680
     atgggtatct tccagaagta cctcactggt caccccaagg gtgccgctgg tgcctggatg    181740
     ttcaacggct gcttgcaggt cttggagagc ggtctcgtgc cgggcaaccg caacgctgac    181800
     aacgttgaca aggttatgga aaagttcgac tacattgtct accccagccg cagcatccag    181860
     accgatggtg tcaaggcgtt ctccgtcacc tccttcggtt tcggtcagaa gggtgcgcag    181920
     gttattggta tccaccccaa gtacctgtac gccactctcg accaggctca gtaccaggcc    181980
     tacaagacca aggtcgaggc tcgccagaag aaggcttacc gctacttcca caatggcctg    182040
     atcaacaaca gcatcttcgt tgctaagacc aaggctcctt acgaagatga gctgcagagc    182100
     aaggtcttcc tgaaccccga ctaccgcgtg tctgtcgaca agaagacctc tgagctcaag    182160
     tactcggcca ctgctcccga gaccaaggag tccgaaagca ctcgccagac cctcgagtcc    182220
     ctcgccaagg ccaatgccgc cgagaactcc aagatcggtg ttgacgtcga gcacatcgat    182280
     tccgtcaaca ttgagaacga gaccttcgtc gagcgcaact tcactcagag tgaacaagac    182340
     tactgccgca aggccgcctc ccctcagtcc tcgtttgcag gccgttggag tgccaaggaa    182400
     gccgtcttca agtcactggg tgtcagcagc aagggtgccg gttctgctct gaaggagatt    182460
     gagatcggag ttgatgccaa cggcgctccg gtggtgaacg taagtgcatg attctcccat    182520
     ttatcccatg attctagtga caacgctaac atatctccag cttcatggtg ctgccgccgc    182580
     cgccgccaag caggcgggtg tcaagcaggt cagcgttagc atcagccaca gtgattcgca    182640
     agctgttgct gttgcggtct cgcagtttta gagcgccgtg cattttctgt ttgtattcgc    182700
     atatagatcc cagggtctaa atattccctt gggttgagac gtaatgattg tgatttatgc    182760
     ttttagattt cgaaccagct tcgtctcctg gttcgttgtg tttataatgg gaatgatgat    182820
     attgtgtctt tctttgaatt gtcatttaga gtctatgttc taacgatatg atcttctttt    182880
     tcttaaaaaa aaggaaccaa gcccatcgat gtaaagggat tacggttagt tcacgcaaca    182940
     ctctgcactg ctatcacaaa agcgcacgtt ctggtaattc tctgattctt gtagttattg    183000
     attccatcaa taaatctcag gttagagtaa cggagttgct tgagaaagca tcgtccgttg    183060
     cgagcttcac agcaccacta gcatggttgc tagggcgtaa tatatgtact ccagtatata    183120
     taatcggacg tgccgattgt tgtgatcttt tggtctagca ggaaccatct atgggtccct    183180
     ctactgaaca tcccgactac tgactggcct caagctccta tcaacatttg atacctccac    183240
     atggagttag ccgggtggca gtgggattcc atcttatgtt ttgcataggc acatgtgtag    183300
     aggatggttg ttcatggtaa gggtattaga tgtatgttca actatggact atgaactatc    183360
     aacaaccagc atagatcgca tacggaagat attcatgtta aagtattcca gggcaaaaaa    183420
     gaaaattcaa aatgaaaaga ggtatcaagg tgtctgctgg acagcgatta acagatagga    183480
     aatgaaagta aaaacataga aagtatccga catctgattt taacttgtaa ctaccttgcg    183540
     caaacctcag ttgcccttcc agggaccagg tcgcagcatc cgatcctcct ttccgtaaac    183600
     actgacatcc ttgacaatgg caatgaatct ccggtgattc tccttggatt cgccaatacg    183660
     aggacggaaa actttcaaga ggtcgctgct gaggatgcca gatgctggga tggctgcatg    183720
     aatctccccg gccgtgggga aggtctggtt tccagaaact ggagtcgaca cacgagggcc    183780
     tgcagatggt tagcttattt cttgtaaaga tagatctgga ccagaactga cctctggggc    183840
     cgtccggact gttggcacgg ctcccggggg gtcgaggcaa aggacttgcg gcgcgggacc    183900
     cttgtggggt gccaccacga gagactgaag taggggggtt gagtttcagt ttcttgatct    183960
     tgccaccctc ggtcatttca gctccagagc cggcaccggt gtcgacatca ctgccagatc    184020
     cagcaccgcc aggaatgttt cgcacgcgct tcttgccctg ggtaaatcag tacatattgg    184080
     ccaaagggga atggttgtac atacctgcaa agcggatgga gagatcggac gggatggggg    184140
     ttgagacgta gacaaatgca tgcttttggc cttctttcga gatgtatcgg tgccactcgc    184200
     atcggaagcg tttggtgatc cgattctttt ccgagatccg gcagctgaag ctttcttcag    184260
     ggcgtccgta tgcttggggc gaccggaggg ggtatttgtt cccttggaga gagcttcctt    184320
     ctgattcttt tcttcttctg ccttcttccg ttcctcctcc ttagcccgtt cggtttcgct    184380
     gtcgtcggag ctctgtctaa attagctttg gacttgctag cgaagatggg tgaaaactta    184440
     cctcttcatc cgtgtacgga ttgacatccg aaccgctgct gtagtcaaag ttccgttctc    184500
     tcctttttaa agccttgcgg acacccttgc ccaacacacg tcgggcctcg cgttcacgtt    184560
     tctctcgcat ttcttcagcg tcgtactcct tctcatcctt gagattgaag acattcgcct    184620
     tgagctggtc ctctttgatc ctcttttcgg catccttcgc atcctcatcc tcattgaaga    184680
     ggtcatcatg ctcttcatcg tcggcaaatc gatcctcttc gaaatccatt tcaccagcct    184740
     ccaatccctc ggttttgata cttgtgccct gctttccggc ataaaccttg cgctgcttgg    184800
     cgtatgtttc caattccttt tcttgctcca actgctgctg tttttccatg aaccatcgag    184860
     ggtctttcac tctcttggcc atgaatttct ctgcttcatc aatggtcaaa gccttgaagt    184920
     tactcttagc gttgaacttg taccactttt cggccggaac cattctcatc tttccgttgt    184980
     cgaggataaa gactgcatgt gtttcggaca gagctgcttc gtagtttcca acccaggtgt    185040
     gtcggttgtc gaaatcctct aggtgccatg gcaaagcctc ttcgtacttt atccgtgctc    185100
     ttgcgatctc ttcaggagtc atatccgact tgaaaacctg ctgcgtcttc tgcttcgggg    185160
     cattcggtct tttcgaggta gagccgaggg cgggtgcgat ttgggaaagg ttctcagcgc    185220
     gctctttttc gcgtgctgcc tttcgagcat caaaggcttc gcgttcagct tcatccatcg    185280
     gctggccatc gatctcagac cttcctgcat ttgggtcatg agttcgtgca cgcgggtcgc    185340
     ggcgatggag tcggacaggt cgtgtaaatt gtgattcgtc tcgtggatcg acgcttttct    185400
     tcgaggcaaa acgcgcgatg tggtgtttca gtccctccat cagagctcgc tttgttgtca    185460
     ctaccgggta atccacgtat ttatcgctaa gcaaaggacc gctgaatcca ttcgctgcca    185520
     tgttgttgtt tgaaagctca agcataggtc gctcggacgg aaaaatcgcc ggggtctggg    185580
     acggtcgtga tggaagagtc ttggtggctg ttccattggg ggcgggagcg gcgccagctg    185640
     gtttggggac aggtcttctc ttcggtcgaa ccagtggatc cgctgctttc ggacgacgca    185700
     tcctcatcac cggggcacca tttggcccag ttggggtgcg agcattcgaa ggattcgttg    185760
     gagtcgacat cttgccgacg tacaaaacag agttgtacga gtggtcaaag acaacgcgac    185820
     gaattacacc aggggtggaa atgcgtaagc aatgcagccc tttgcctgtc ttgtgttgcg    185880
     acaaggagcg gtagatttga aaaagagtga gagatgggta agtcactttg aaagagctga    185940
     ggcactgaac cggaggtatg acggtagacc tcggagcaaa tgtttacccg tcccgcaatg    186000
     cgatcacgtg cttcgggcag gtgtccgggc cgtttggtcc gtgcacccgg aggctcctaa    186060
     ggtttactta aagatcacct ctatgttcta cctaggtaca gggcatacct cagtaacctt    186120
     caatcgcaat tgagcaagat agaaccggaa aggaaacaaa gaaatcaacg attgacaggc    186180
     gcattgtact tgatccaacc cgtaatgtct cttttatacg atacccttga gccaactaca    186240
     tatactgtct aagtctcaag tcgtcaacga caggcagtac aagcagccga ctattcttgc    186300
     ttttctttaa ctaggtaccc atgtagcata tttacacagt ttcgtattat ttcactggaa    186360
     tttccgttta ttcaattaat gcaaaattta ctgaccgaat cgttgacccg gttctagtgg    186420
     cttgtacgga caagcaaccc aatcacagcc cttgacacag ttagcagaca tcaaacaacc    186480
     agaatatcga ggacttacct gtttatagat ctctgtaccc caccatttga aaccatcaac    186540
     caagcctggg taaatgaagg caaagaagac aacaaccact gcaaatgcca acccagaatc    186600
     caatgcggct gacaaggtca ttgcgtactt ttcccaccag gccgtcctcc ttcgccggat    186660
     cacatagttg aagacaaagc atacaagggc ccagatggaa aagttaagcc cggttgcagg    186720
     cggtatccag ctcagactgc caaacaagat agggaagttg accatacgcc agaagctctt    186780
     cttcctgtgt ctccccagaa gccacgctcc gagaggggcc acggctccca acaaaaaggc    186840
     ccagacaagc ggacgatata gccctcctgg gccaaagaag cgctgtgggc caacgactcc    186900
     ccagagaatg ctgccgttga aatggactcg agcaatggga caattgaaac cattgatggc    186960
     ctccggggtg caaagtcccg ggacgaaagt gaacatccag ttcagaacac caatttgggt    187020
     cagacttgag accaacgtcg ccatcatctg gacgccaaac agaatccgtg gtgggatctt    187080
     catgtaatgg ccgagcttga ggtccgaaga aaacttgatc ccttgtgcag aactgatata    187140
     tgagtacgtc acaaaaatca tgttcgctac aggccttccc ggaaatacaa taccgcaaag    187200
     gagttggcag atcagataga ggctgctatg ttgattggtg acggccatga tgatgccaac    187260
     tgggatgaaa aacacacaag taataccaag ggccaaaagt agcccatacc aaggtaggtg    187320
     tgttggataa ctgtaggctt gggtcagctg ctataatagg ttaaagagag ggggaaacgt    187380
     actattccac cgtgaatatg gcaatggcga gcatagagat gaacacgaga agataccacg    187440
     tgagaggagc gtccttgtag cgcctcatca agcgacagtg aacatcctcc cctcccaatg    187500
     gaatctcctg gctcggttca tgtgagctgg tccttgggaa ttcaaaactc tgtcgagtcg    187560
     tatcattgct tgcacgaagc ggctggtacg tctccatgcc tggcacatct cgtctttcct    187620
     caaaagcctt tctagtctga tgccagatgt ccttcccata ccagcaaacg gtgtgagtga    187680
     ccagggatgc caaagcggca aactgaacgc cgtaggatag cacataggtg attgggagat    187740
     aaactgggga gtaatcttga taggcctttt catcgaacaa aaaatctgcg gtcaggattc    187800
     ggctcacgtt gtatggccgt ccggtattgt cgaacactgc cgttgaaact atgggcatat    187860
     atgcagagaa aagaacattt ttataatctt cgtttggtca gcagagttta gcagagttaa    187920
     caagataaga tgggtggggc cttacagagt atcggggcgg ctacccagat gacaaccacc    187980
     agtcccgtca cgatattagc tgcggcccac caaggcgtga gtaatgggga gccaatatag    188040
     gcaatctggg cccaatcgaa cgtcaagggg aacatcccga gaccagaggc aacaccaaac    188100
     taggagagtc agtcaaagta gcagaaaagg gcctgagtgt cttaccaagt tcgaaatcac    188160
     cacatttttg ggtgccaacc aagtgatcac attaaaataa cttagagcag gcatcaacag    188220
     ccccggaaca aaataccaga caaatgcccc tgcccacacg acaacgaaga atttatatcg    188280
     ggagatgctc caaccatttg ccttcttgtt gacagacttg tgcattgtag agaacattgc    188340
     agtggacatc agagttcccg gccagatcat agccgatggc cgcacgagga atcgtcgagt    188400
     tagacccgcg aatgcgtatc ccaaaacctg ggtggatatg atgagcagca gctggtatat    188460
     aatcggaaca tcctggttgt aaaatttatg ttgctcgaca ataacctgtc ctggtcagct    188520
     tcgtcatgaa tacttcgttg gtgtactaac atcagtcgcg aaagcaaatc caaaagaaac    188580
     attgctgcta atgtagacgc aagcatgctc cttttcgttc caacggccct ggccaagcca    188640
     aagtctgaca cgggacgcca atggaacagg aggggcatcg atctcaccgg agagaaattc    188700
     gcggtggtga agggatccgt tctcgaaaat ctcgagaggg tcatctgttt gtttcaaaag    188760
     cacatcccaa aactttccca gtggatggac tagaacaagg gcaatgattg gggtaatggc    188820
     aacactggga tagcgcaagg aaaagaaaag attggcggct gaacccgtca aagagaataa    188880
     caatgaaaga atccacatcc gaggtgctaa aagacgttag atataagcag gaaaaagcat    188940
     taggaagata gcctactgtt aatagaaaga gagatatcat ccgtggccgg aactgaagct    189000
     cgtacttggg catacggcga attgtctgga ggatcctcaa ccgaggattt tgaatcatca    189060
     tcatcaatct cgaggacatt ttcatcgtca cttgtcatat atggtgaaga cgccggtgtc    189120
     tcctgcatca ccgggtttcc cggcacagcc aatccagtgg caaatgagta tttagaatca    189180
     ggacccattc ctatatcgga cgcggcggat gaaggccgac gattgtgcct ctctgcgtac    189240
     aagctgtttc gtcgcctggc agaggaatgt gatcgtctcg gagtagatcc tcgcacgttg    189300
     gaagagctcc caccgccatt ttcgaggctc gctcgttgta aacccccacg gacattctga    189360
     ccatgcgaga tggagatatc ctcttccgag tcgtctggac tttgcaatgc tccgtaagag    189420
     ggagccccgg ggacgggcga cgagcgaaga agaggggtgc gcgacatgaa ggcccgaaag    189480
     cgctgaacaa tccctgtgtc ggggttcacg tcgggtggta gattgtcaat ttcggggtag    189540
     tttccatcgt cgctcgggca atcatcgaaa ttagaatcac tttgatccga ttcagcggga    189600
     agccacttgc gcctcggggc cgaggggcaa gacagcttcc gcgtctgcag tggaatattg    189660
     gccgacgtga tggtgggggg gatgattaaa tactttcagt atttcagact aggtcgtgca    189720
     ttagctcgag atcgatctgg gcattgagga atcagaagag gcggaatcac ggagctagtg    189780
     gaggactaaa gtcgtagtgg gctgccccac cgacatcggc agatttatct tccctttcca    189840
     ggttacatac tacatactag gaatacaagg tccaatatac aacctcggaa gtttcaatat    189900
     tttcaaaggg aataatatac agtgttgtat agttgttcat ttccatatgt acaattgatt    189960
     tggtatctaa tcgctaaaac agttctacaa ccttttcatc ctcgttctga ggcgcctcga    190020
     tttgaggttg ttcgggctcc ccttcgcctt caccttcctc gtctcgcatc agaacctgca    190080
     ctaaccggtc gcatgcttct gtcacattct catcctcaac atgcagatga gtttcgcgga    190140
     tcaaagggta aaccttgacc gctcgcatct tatcacggcc gtcccgggtt gtggtcaaga    190200
     gaagcaaggt ttccaggtgg gtggtgatga tactggtgtc gctgtcccgt tgcttatcgg    190260
     gcggcagcag ttggagatct ggcagcatat ccgccgtatc ctcttctgac agctcctctg    190320
     gacctgcaag cgggagcaac aggtaaggca aaaggttgac cccgtcctcg tcaaagagca    190380
     ttgggtgcga gtccacttca aaagccacgt tcttgattgt ggatgcaacg cccttcctcc    190440
     ggatatcgct tcggtgctcc gtgaagaccg tcagcttggt gatggggacc acatcatcgt    190500
     actcctggcg ttgggtgaaa taggctctgc ccttttcggt ctgcgacagg tccgcaaaaa    190560
     cgtatgatag ataatcataa ttggcgtgct tgttaagagc gccctcggcg cccttcacga    190620
     aacagtccat cagctgatcg atcgcatttt cggaggtaga tacggattcg ggggctttgc    190680
     gcttgaggga taacagtttg tgtagggttt cggacttgac gagattggcc agaagcatgg    190740
     ccacttcatc ggcgttgggc tccttgggat tctgagatca aatacattag tcccattact    190800
     atccaaaggt atggtatggc atccgagatg actcactgtc aatttcgcaa gcaaggtttc    190860
     aataaacttg tcatcctcgg cgagaagctt caacacctct tcatcgccag acaagttgac    190920
     cagcatagtc aatgcattct tcgcaattgg ctgtacaaag atatcagtcg agagttgccc    190980
     cccatgatgg cagataacgc acaatgtaat cacgggctag aagcttcaaa tcgcggacgg    191040
     gtaggagttg atggcgcttg aacagatcag gctgggccgt ggagaagccg acgaggtttt    191100
     cgcaagctac gagctgttag gtcatatatt cctgtctgag agagcagttg ccgtaccgat    191160
     ttgtctgatt tgggtgttgc catggtgcag gaattccacc agctatagaa agatgtgagc    191220
     gagataatcc atatcatagg ccgaaattac gcacctcctc gagttcggac ggcatattgg    191280
     agtataatca acaagccaaa aagggctgag tgtgtgttat cgtcaattcc aaaattatcg    191340
     aattcccaaa agatttttct tccgcggaag tgggggggtt cgacgtcact ggaaacgtgg    191400
     agataaaacc ccaagggatc ttgtgtgatt tgtaagacac atcttgctac atgtaggtat    191460
     agacaatcct aagaataata caggtggtta tttagcagta gataatacat ttgattaatc    191520
     tatatttata caatttacac gtcgacgtta cgatcttcct tcaaaagagg tcggaattgc    191580
     cccgcctcta gcgttcccga agatcgtctc ctccgtcttc gaccttcaaa ctagctatac    191640
     acctaggtag gactcaattc taccatctca gtatttcagt atctcagtat ctcaattaca    191700
     ccatggagaa cccaaacctc aatgaaatcc atgacttcct agtctcattg gccttcaaag    191760
     ccggggacat catcaacaat gcgctccctg aaaccagtgg cacaggatcc aaaatgaata    191820
     gtccgtatcc atacaagcag caaaagaagg gaaaaagctg atcccagtag gtgccgatct    191880
     cgtcacggaa tatgaccgtg ctgtcgaaaa catgatctcg acctcactga gggagaaata    191940
     cccaaactac gagtatgtgt ttcctctttc gtgcctgcta gcatggccct gacgtgtatt    192000
     ccctcagatt ccacggcgag gaaacctacg acccagcacg tcctttgacc gatgccccta    192060
     ccttcatcgt agaccctatc gatggaacag tgaacttcgt gcatggcttc ccatttgcct    192120
     gtgtttctct cgggtttgct gttggacgca tacctgccgt gggtgtggtg tataacccct    192180
     ccaccaaaac cctttactcc gctattcgag gccaaggcgc gttcctcaat cgtgaaactc    192240
     gcttgcccct taagggcgac aacgtcgagc ccctgtcggg actagctaat gctcttattg    192300
     ctattgaatg gggtgcggat cgcagcggga acaattggga cactaaggtt cggacatatg    192360
     agaagctggg caaatctaag gaaaacggtg gggctatggt gcgctcgatg cggagtttag    192420
     gctcggccgc gttgaattta tgtgctgtgg ctgatggcac cctggatctg tactgggagg    192480
     gtggatgctg gtcctgggat gtctgcgccg ggtgggttat cctctctgaa gccgggggca    192540
     ttatggtaga cggcaacccg ggagtctggg aggctcgtct cgatgggcgg aagtatcttg    192600
     ctgttcgagg ttctccaggt ggatctggac aaaaggagat ggtggaggag ttctggagcc    192660
     atgtccaagg tgaattgaag tattgattac ctgcccagca aatcctctcg gattaggtga    192720
     atacgatatg ggggagaaga aaccccaatc tcaatataac aaatataaca ttcgcataat    192780
     tacagggtat atgtctaagg gaaccgtatg tacaatgaaa accaggatgg cactattata    192840
     tgtgacggaa accagcgttg gtttccactt cgaagccgga ctcgctgtca tcctcgacaa    192900
     cttcgcgatc agtccaccgg gcggaatcct gcctcgatac aagacttctg tcgttggtgc    192960
     tcatgtgtga ttcgtcttcg gccggtaagg tgtcactcgg accagaaggt acgtcttccg    193020
     acagatgaag atcggataca tttggcaaat cgtccgtatt tcttacggaa ttttgatcga    193080
     cagattggga ctgcccttca acctcatcgc cagaactagt cggaccaaca tctggagact    193140
     tggccaactc cacattttgc ttcagagaat cgtccatttc tgcagtagac gtttggccga    193200
     aatgtgtatc gaccaagtgt ttcacaacag gccatccgta ggcattagtg aacatgcgcc    193260
     gcacaataat gttgttgtgg gcatcgggct caagtcgaac aagaacttta cgccaagtca    193320
     gatcacggtg ataggctcgc gcaatctttt cctcgacctt gaggccactt tcgctgtccg    193380
     cgatgctagc aggtagatcc tgagtaggcg ccggcttcga ttgcttgccc tgtaacgaac    193440
     caaatgctac tgtgcgtcgc tttgtcggta gagggggtgg tatatcccct gggtggtaga    193500
     tgcggtcgtg gaagattgtc cggggtcgcg cggcagggtc caaaatgaaa tccgcgggtg    193560
     gtaaaggagg catcaacaag tctcccgcag actcgaaaaa tgttgtcttc gggggcgtgt    193620
     gcactccttc gtgctcatgc gatgacggcc catgaggaat gggcattgtg ccatcgccat    193680
     cgccagtctc aaaagtccta agagtctggc tacgtttata aatcttagca ttcttgctat    193740
     taggggggtt cttcccctga tttaggcgaa atagcgaaaa gaagccgtcc aggggactgg    193800
     aaggcgcact gcccgagaca ttttccttca cggcgccctc ctctgggatt ctccggttgg    193860
     acacgcgact aggcggtgct agaaactgtc ccggcgtcgg agaggtcgta tgctcatcca    193920
     agatgtcgcc tttgggactt gcggtgacat gagtcgtcga atacgcattc cgatgatcgg    193980
     cctccattgt cgaaagactc aaaggcgatt ctccatcggg gcgagcgagt cggggggatt    194040
     tcgagttggc gcctgtcaac tctgcccacc cccattcggc catagttcca acaagtccat    194100
     tgtcccttct cgccttttca acccgatcca aacctttcca gtctaggaac aaaagagaag    194160
     acgtccgtag tgggactatc ccatcattca ccacgttcga gtagactgta cgatgatgga    194220
     atttcttaag aacctcgtgg gcaggaccac agggaagaat ccgtagaagt ggcttggagc    194280
     caggatccga atggccggga tcttttgcag actctcctct tccggcaata atggcccccc    194340
     agccacttcg aactttcggt gccgtccaac tcagcccgag atcctggccg gtacgaccaa    194400
     ctagacctaa atccaatgca aatcggacat acattgggtt ctcattgctg agaccaagaa    194460
     aaggggttgc aagagcaata aagttaacag gcctgatttg ctcaaagaac tggggcgagt    194520
     gcttttggat atacgcgatt gcatatgtct gaatcagccc tccaagagaa tgaccaacga    194580
     aactaatgct cgtaacctgg taagcatggt cttcactttg aaattcttgg gcattctctt    194640
     gaggggttga ttcagccgaa tgagaaaaag gttgagctcg ctccttggga gcaccgaaag    194700
     gccgagaaaa tgggttcgac tttgagccct tcagagggaa gtagggttga tcgggatatg    194760
     tgagaagcag gacatatttg gccagccgtt tgcccagata ttgaatccca cgttcagtcc    194820
     gaacagcatt tccagagaac cctctgacaa taacttgctc ttcatcgtca tcatcggggt    194880
     tatcttcaca ctggctattt cgctcctgct taacatgact ggaattactg ccgacaaaat    194940
     caggaatcgg aaatttcgga tgcctaggca ctcagaaagg gtgttcatac cttgttgggt    195000
     cttcctgatc cacagggttg acatggggag ctctagcatg actgtcttcc tttttggact    195060
     ttctcatggc tgcatcaatg ctctccttca aatagagcat gtctgcaccg aggttgctgt    195120
     gcaacccgtg tgtcagtaac acgagatgaa ccttcttctt ggcgctcttc atcggagctc    195180
     gagtagagtc ctccggcgct ggattttcac agaacgcttg ggagtcctga ctctcccggt    195240
     cagcgctttt ggaacccagc ttggccgaag ggaatggcgg actgctccat agactagttg    195300
     tatcgtcgac atggagagcg attgcttttg agtacacgcc tttcgatgca agtacccggc    195360
     tacctctagt ttcaggcacc caatgatctt gtaacttcgc cggaggcccc ggggaaccat    195420
     ttccgctacc ccaagcaccg cccgagaaat gagccagcga cttttcatct cggcccacca    195480
     acagctcaaa atgcaccgct gcgctacttg agaatatcac ctgggattgt atctcaacaa    195540
     tccagctaac gctctgtcca cttgccggtc cgccttgacc aggagagcca aagtcgtggg    195600
     cttccaggag attggccggc accttgatca cggcgtccca accacctccg gctttaagat    195660
     agggttcaaa ctgcggtgtc ccctccagat cctgtcgctc atacttggta ttgggatcaa    195720
     aatgcgaggg atagcaagcg gcgtatagcg tgtacggacc atgaaggtat gcggcgcgca    195780
     atgggatggc agatgtgttc ttcactctca cgtaaatatt cgaaggaatg ggcaagatcg    195840
     ggtcggctgc tggagtgtat gtaatagtgt atctgatgga cgatttactg tcagcgatcc    195900
     agaaggactt gagacttgca aggcggttcg gactagactc acctaacgac ttccccaacg    195960
     cgaacgctac caacttgatg gattaacaac atgtcggtca cttcctttgt atccaccgga    196020
     tttgtttgcc agccggaaaa ggtacgaaat cgcgaccttt tatggcaggg ttgtgctgcg    196080
     ccttggtctg gggtctggga ggctgaatag gtacgcgcag tgatcagcat cgaatcgaac    196140
     gggctgttcc attataatca agcaaattcc aaggcgctag agcgctagat aagagactag    196200
     cgagacaaca atatcatttg ctagcgcatg ccgtatgctg gcatgggtgg agtgtggtgg    196260
     tctacggggg tccaatctcg gggatgacgg aaagcacatg atttcattcc ctttacggga    196320
     tcaacaactc catggactgg cccttactta taacatttga aacaatatat cgatgtactc    196380
     ttcagttcta atctaatata tatttcgatc gcaatctagt gaatctctac ctaatggatc    196440
     aagttcaaca aacggctagg ttgtttacaa atctccaccc aaccgtttct ttcgacagcg    196500
     acgatcttcc catcaataca aatgcgtcgc cacctctcct cgtcttctcc aaaatcgatt    196560
     cgaacttgct caacgtcagc ataggtgacc gtatcttcca tcacatgtcg accgccctga    196620
     taggctagtg tcatcaggtg catcgcgtct tccgccgaca tggggccgaa gcggatgaac    196680
     ctcatatgtc catcgagcgg cactgagtct ggggaaatca agaactcctt ctcaagtcgt    196740
     ggaacgagtg cagcaagcgc atacatgtgc tcaagtccac ctacggcctc tgtggaacgg    196800
     gcctcgcccg ggccatccga ggtggttaat gtgattttgc ctttgaattg gtgaggcgga    196860
     gtgccgtccg aaggatgaag tagctcattt gcagccatct taaaacgatc gactccaaat    196920
     ttgcggtatt cgaatgtatc actgtctgca accaatgcag catggagccc ccagctcgca    196980
     acaacggccc cgtatattgt gtggtgaaca tcggtgtcga tatcggctcg ctgacgacct    197040
     tcatcaatga ccagccggct gccaggtgag aatttggcag caaagaccgg tatagaagat    197100
     agactgcctc gaagtagtgt tgaaagacct ggcaccggac cagatcgcaa tccaatagaa    197160
     tttgccatgg cattccctgt cccacaagga atcaacgcaa tattgggaga tacaccaatt    197220
     gccgtcttgg atttgtagaa gccctcgagc atgtcgatga ggcccccgtc accagaaaga    197280
     aggatgatgg tctgagggac gccattatga gcccgctcca agaatttcga tcgcgtgagc    197340
     tcgctgatag tttgcgccga ctgtgtttcg tagagctcgt aattctctaa cccaatgtat    197400
     gtaagtagag gccgtacaac atcttgaaag attgtcttgg ccctccctgt tcctgatcca    197460
     ctagatacca caacttggat gacaggtggt tcatcttcat gccgaaggtg gctggggata    197520
     ttgatcacaa acggagatag tgctgcaggg agggactcga tatctatctt tttcaaagaa    197580
     aagttctcag aattggggcc atctggttcg gttttctgga agaacagcac actatacgtg    197640
     ggtacatggt tggacaacac gcagagaatg tcgtcgaagt caaccaaaaa ctcaatccct    197700
     gcgtgagatg tgtatttcag ggtgttgtcc actattttga cgaccaaaga ttcagacatc    197760
     tctggtatct ctgagcatgt aggtgagggg gaaaaaacca acaactgaca gggcggggtt    197820
     tacggcttac ccggacttcc acttatgtcg tactacttgg gtaaaaagac gacagagttt    197880
     ctagctatca agatattata atatcacttg gtcatcgatt aacatataat gtacacatag    197940
     atcattgatc cgagagagaa aatagatggt tggattcttg tactcttgcc tcgatctata    198000
     tggactagga ctggaaggac tagcctggta tgcaatacct gaatgatgca tgaatatgca    198060
     agtgtagatg tcagacgtat ccaattcgag attgctaata ttcgtcttgc taggtacatt    198120
     gttctactag atacatgata cagcctcgac aaggcagtgt ggtacataag aaagcaactc    198180
     gatccaaata tgtcacaaaa taaagtaaaa aaaaaatcat cacgaataca atgtccctgg    198240
     gataccgatc ttagtcctga gatggggaaa gaccacgtgg aggcgatggt gaattcccat    198300
     catgatggct atgcttgtca ctgaggttta ccgcgatgaa ggtcttgggt agttccacac    198360
     tgcatgcggg gatcagtaaa gagtccagaa aagttaagag agcaggcaac ttacgtattg    198420
     aatttcgcct tcaacgtttc gatcacctcc ttccaatcct gatgggctgt taggcttcgg    198480
     cgtggggtgc aaccaatgga gtgcctggaa tcaagttgca cgtcaagcgg gtcgaatgcg    198540
     tgacaaccag gactgactga gatgcggatg gagtaggagt aggagtccga ttcactgtcc    198600
     cgagcttcgt acagctcaaa gcaaatctga gagagataat caagttctgg gatggcactc    198660
     ctggcgatct tggtttgaat tccaccttcc aagatgcagt tcaagagggt gtagatatga    198720
     gattccttgg taaagtagaa gaaagatttg gcatccggcg aagcctgcac ctcttctaga    198780
     tctcgaacaa tctcttgaag aaggggaaga gatgttagga ggccaatctc gagtttctcg    198840
     ctgtcggtga taccatattc ctggggcgtc acgtagtcga acaaaacctt ggccagcttg    198900
     tacagttccc ggagctgcga aagccgctca tccaccttgc acttggagga ttgggagcca    198960
     gggaagagtt tgaaataatg atcgtatgaa tcatctaatg cccgaaggtg cggcagcgac    199020
     tcggaagcaa agatgcgctt cttcaaccca aagcgatgag caaacgtctg gctttcggta    199080
     cgctcttcgg atttgtcgct cccggattcc tggccaggtt tcccctccgc gctcgcgtct    199140
     gccttagctg cgttcttgca tttctgatct tcatcagagt cacggggact gtcctgtggc    199200
     atgaaaaccc attccaaaaa ttgcctattg tggagtgcat cgaacttcat actgtcgtat    199260
     aactcggaaa gcttgcttgg gtcgaccttc tcggtgtcac aaaactctgc aaagagcttt    199320
     tcccaccgtt ccttaaagag tcgaggatct tcacccgcgc accaacggcc ctgtatgtcg    199380
     gatatgccag ggggatccaa tccgtccacg gatgttggtt ggctcggggt ttcaggctca    199440
     ttggatgagg tcgggaagat gtacggtgcg ctgtcgagtt tctcaaagtt ttgtcgcatg    199500
     acactccggt ggaacttcat cagttcaact actctagcaa ggacaaccga aggttctgga    199560
     atatttttgt ccttgggcca agcaaattgt gagggcgcag acccttcccg caaaagcaat    199620
     ttcagctttt tcttgacttt atccatgaca tccttggcgg catttgagtc gtcaagcaaa    199680
     tctttccgaa cttgtatcaa gtcttcaggg atatccttct ggtccaaaaa tgagcacgcc    199740
     catatttgcg ctataagaat attattagct tgatgaaggt ctcgaggagg aaattaaact    199800
     caccactggt gctcactcta cgttctgagc tggtaaatac gcgaacgtta ttcaacgcct    199860
     ccctgttcat cagcttcaga tcatcacgca tgttcactcc aagatcctgt gattgataac    199920
     gcgcggcatg tgttggctcg ccgccccact tgatcacaag ctgtagtttg tccaggatca    199980
     agtcattctc ggcggcggag aaccgagaaa aagtcgcacc tgagatagaa tcgcttcgtg    200040
     tctgtgatct gcgcaagtcc tcggtctctg gcgtgagtcc tccaccctcg ttgggcacag    200100
     gtgcaggggg ctcgtcaaag ggcttgccct cggacaatgg agtggaagct tgcagtgggc    200160
     cctgttctcc catttcttct ggctttcgtt tgcggaacat tggcttgatc tgaactttgg    200220
     taccaggcca accgcccttc ttctctaaag atgtccggag caacttgagc ttctctatgt    200280
     cttcgagacc cttctccata gcaatcttga cggcatcaga aacactggac aatgcagctt    200340
     cccccttaat caccacctcg ttctggtgcc ctttcaacaa atccacaaaa ggttggctat    200400
     ggaatgtgaa cttaaacttt tgcttcgggg tacgatctgc gtgtcgaatc accgccacca    200460
     tgcccttcag cttccaggag tgtttggaag caggaagagg gggaagggct tcatcattgg    200520
     cgtgctgtac cgaaagagct ggagatttcg tgttcgaggg actatatcca cgactagtgg    200580
     agtgggcttc ccgggaattc aacttgctga tagcagcgct aacatcagta ctctctaccc    200640
     cagatgacgc cagtggtgga gtacatgact ctgaagcatc agtaggtttc gggcttggac    200700
     cgtacagcct ggaagtgcta ggagacttca gtaatgtctt cagcgtttgg cgatgggatc    200760
     ctgccgtgct ccttctggat gagcctatat ctggtgaagg aggctcggac gattccgata    200820
     tcccctcgca tctgcgcctt tcttccagga aaatatccct gagaatgttg gcacacttat    200880
     cgtaataatc gttgttgtcc ttgacgaagc tccagccgtt gacgtcaatg acataacttt    200940
     tgtctcccac gcggagcatg tcaaagccac aaattctttg accaaatcca ttcgagatct    201000
     tcgatgcgat tattgcctcc tccttgccaa gtttcgtgat gtatcgtatt tccttcccgt    201060
     gggtattgcg ccgcacgaga ccgtcgacca cgggggattt gcgcgtctct gcgtgacaaa    201120
     agtctggccc cacggtgtag gctttgacat cttccgcgtt atcaaccctg aggaactgct    201180
     cgtacagata acttgcgtcc ttctcggtga cggaccttgg aacagtgaga ttggggtcat    201240
     attctgagct tttgttgccg acctttcgga aaagtcttct tccaccgccg ccgtactgtt    201300
     gatcgttggg gaagtagatg tgaatgttgt ggtcctcgcc attgacaggc ttttcaacaa    201360
     agggcttttt gaacactttg ccgtcaacaa tcaaggcctc gccatcctcg gacattgaga    201420
     cattcttggt ctgaggagca ccgccaccaa ttccgctctc tgggccttcg agcttcacgc    201480
     cagtcaggcg atagatatgc tggcctagtt cagcagattc tagaattgga ccgccgtcgc    201540
     ggttgacctc cagtcgcttc ggagtgggaa cacccatgtg atccagaatt ctcagacaga    201600
     gccgcctatc ccacaagacc ttttgcatag gcagatcatt aacacagagc ggtttgcgaa    201660
     gtttagcata cgcaatggct ttgtccaggg gaaatccatc ggaaaagaaa gcgaccaaga    201720
     agtcacacac cggccaattt tcgactgctt cgtcgagaat aaccttgtct ccaaaaacga    201780
     tcacctcgaa ttcgcctttg gattggagtc gagtcaagat attctggctt ggtttgctgc    201840
     gtgctttcac atccaaggca cagactccga tcctccatgg ccttagggag caggattcca    201900
     cctcactgat agagcttgca gcagtactgg ccgccgtgct tccactgaat cttctagctg    201960
     cgtggcttaa agagcgtgaa gattgtcccg tccgactgag ggagcgatga tcaaatcccg    202020
     aatcggcttt tcctggttgg ctttgagtcg actttgagtg tgacgtaggc ttagttgaca    202080
     ctgctgtagg ttcggtaacg gggcctgtgg gcgtctggtc gttgtaatcg gagtccatat    202140
     cggctaaaga cgacgagagg ttcggttgag caggtctcaa gggtccagca tcggcggaag    202200
     agccgttgct gcgctcagcg gcattatcca tatgaggggt caattgtctg gacagtatcg    202260
     tgttttaaaa tcaattctga tcgcatcaag ctaaatttga tcaatgggaa tgggcgatat    202320
     ggggaaacag aaattcttcg acaatcaaga ggaacctgga agctcttggg attccaaggt    202380
     tgtattacca aatatatgat gggggttacc gcatttgcat aggcggagag aaagaacggc    202440
     cttttcgctg gttcaagttt gtacctttcg ctcatgatca gattgaaggg cttggaaatt    202500
     atgctaaatt gcgtattcga ttcattgggc ttcctcgtat tcctatagtg tacggcatac    202560
     tagattcaaa agtacaattg ccccatctac ccagatactt tttgctaaag tctccaatac    202620
     atcatgccac tatttgatag cgtcttgata agaccaagca gtctccgata aggccgtcgg    202680
     cgaattgatt ttagagggaa gaatatatgg aagataaacg agaactcaaa attcatgtca    202740
     agtcatacta tttccaagag atattcttca taatcccatc atctgaaggt attctgtacc    202800
     cgagtgaacc gtacatcatc cgctcgaagg cggtctgagg cctgcatgac taggcggggc    202860
     agaaaaaaaa acatcgggaa aaaaaaagaa gacaaagcta gtgagacgac ttggactact    202920
     tagatacatt tcgtgactga cttggtgttc acgtcagaac aaaattatcg tctggaaggt    202980
     taaggggttt attctgatta ctttgaaccc tctgacatat ccattgtcgt cagtgtgtcc    203040
     ctcaatatca gcatgccttc ggccgataat ttcgatctgc ctcttgcgaa gaggcagaaa    203100
     cgagtatcgc aagttaaggc tggaacacgt ggttccaaaa tctttgctcc tttccgtgta    203160
     agttgagaca cacatctgga tcgcttgttt tctctaatct gacttgtcgc tataaagacg    203220
     ctaggattgg tgtcgccaac gcccgttcct tttacatcgg tgcgcctagg taaatcgacg    203280
     tttcaaatca caacctccgt gggccattcg ctgcagactt atgatttgcg ccgaggtttg    203340
     aacctcatct tcctgagtcg accgcaaaca ccggagatca ttacggcaac atgtgcgtgg    203400
     caggataagg tattcgcagc ttggggccat ctccggtcac agtcccccgg aggtgtctgg    203460
     gttttcaagc gcggcaaaag agttgctgtc cttgagggcc ctgcagatct aaatggaccc    203520
     attgagcgct tggtggtgtt tggttcatgg gtggttggtt gctggaccgg tggcctcgag    203580
     gtttggaaaa cggacacata cgagcactat gccagtctgc ggccacaatc ggctcgtgga    203640
     gagaagatct acaccggggt aatgtgcaat atgccgactt acctgaacaa gatatttgtg    203700
     ggccgatcgg acggagcggt cgatatctgg aaccttcgca gcggaaagct tcttcacacg    203760
     ttgccttcgt tgtcgtcaga tgctggggct gtaactgcga ttcaacccac gcctgctcta    203820
     tcacttgtcg ccattgccta taagggcggt gctttggcta ttcagaacgt gagctcgggt    203880
     caactggttt tatctctcaa gaacgcatca tcccggggtc tcccggtaac atccatcagt    203940
     ttccgcggcg acggactagg tgctggtcac gatggtcgca gctcaggtgt tatggccaca    204000
     gcgtcaagtg gtagcggcga tatcacgctt tgggacttga acaatggagg tcgtattgcg    204060
     ggcattcttc gcggggccca tcgagtttca agtggtgaaa agcccatggg cgctaatcgt    204120
     gttgagttct tggatggaca accggtactc gtgtcatcgg gcgacgacaa ttctttgaag    204180
     acttggatct tcgacgaaac gccgttctcg cccattccca gacctcttca tagaagaaac    204240
     ggacattctg ctgctatcag cgctctcgat tttctgccga catcttcgga tggttccgag    204300
     tctggcggca agtggcttct tagcgcaagc aaggattgca gtctctgggg gcttagtctg    204360
     cgcaaagaca gccagcatac cgaggtctcg caaggtagct tggaacgcaa ggctaagaag    204420
     ggagggccat cgaacatttc aagttcagag gatctcaaag ctcctgaagt cacatgcatt    204480
     gcctgcagcc tcaaccgtga tggcggaatg ggagtcaccg cttctggtcc gatctggtcg    204540
     aacccgaagg ttacaaacgc cgatgcttcc aatgcaaccg gctgggaaag tgtggttact    204600
     ggtcatcgcg gagacaaatt cgcacgtact tggttctggg gcaaaaagaa agcaggccgg    204660
     tgggcatttg caaccagtga tggaacagaa gtcaaggtgc gcaagttcta aatataatca    204720
     aacaattttc tcttttgcta acattcttga cagagtgtga cggtttcgca atgtggtact    204780
     ttcgctgtca ttggatcagc tggaggttct atcgacatgt tcaatatgca gtcaggtttg    204840
     cacagacaaa gtttcccagc tcgcgcccca gctggccgta ccaccaaatc caatgcccag    204900
     gcttcggtcg ctgcggcgtc taaacacacc aaagctgtga ctggcttgat gattgacagc    204960
     ttgaaccgta ccgttgtgag ctgtggtctg gatggcaaag tcaaggtacg ccccgtcccg    205020
     ccattccgtc cttttactag agatttataa attgaccttt gctggaatat agttttggga    205080
     tctcctctct gggaaattcc ttgatgagct agactggcac cccatggctg ccattactgg    205140
     acttcgttat agcaaggcga gcgaattagt cgccttcagt tgtgatgacc tctcgatccg    205200
     tgtgattgac ctcgagacca gaaagctcgt tcgtgaattc tggggatgtg tgggtcaggt    205260
     caacgatttc atcttctcaa atgatggacg atggattgtt gctgcctcca tggactcggt    205320
     agtacgcgta tgggacatgc ccaccgggca tttgattgac atcttccggg tctcaagcac    205380
     gtgtgtcgct ctggccatgt cttcaaccgg tgaattcctt gccaccgcac acgccggtag    205440
     cattggcatc agcctttgga gcaaccgcag ccttttcatg cccgtgacaa ccaagaatct    205500
     tgacgagaat gttattgaga acgttgggct cccggcaacg tcaggagaag gcggtgctgg    205560
     tcttattgaa gctgcctttg cggatactac cgagcaagat gaggaagagg gcccagtact    205620
     ggcgacggaa caactacaac acgatatgat gactctgagt cttgtcccca agagcagatg    205680
     gcagtcattg cttcaccttg acactattcg cgtatgtttc tatccctatc caagtgcaag    205740
     tccctagcta acggttcaac aacaggaacg caatcgtccc aaggaagctc ccaaggcacc    205800
     cgagaaggct ccgttcttcc ttccttctct cctcggttcc agtgggcccg aggccgccaa    205860
     ggaaatcccc ggctctgagg atactgatgc cggatcggtg gccaaaatcg ccgaagccga    205920
     aagattacgg attgccaagc tgcaaaatgg tggcaacccc agtgctcctc aatctatctt    205980
     cactcgatcg ttggcgtccg gccatgattc cggtgacttt aactcattca tcgaccatct    206040
     caagacctta tctccggcca aggcagatct cgaaattcgt tcacttgatc ctcgcgtacg    206100
     tgatggacac tctgagttgt ccgatttcgt tattgccctg actgctcgcc tgaagtcaaa    206160
     gagagacttt gagcttgtca atgcttggat ggcggtcttt ttgaaaatcc atgccgacac    206220
     tgtgaggctc agctctactc aagatgagcc tcagtattgc ctattgcaag aggctctggc    206280
     aacttggtcc gctgagcaac agcgggaggg aaagcgcctg gctgagctgg tgggctactg    206340
     tcgcggagtg gtcggattct tgcgatctgc tcggtaattt gaattggact actgaataaa    206400
     tatcacgggg cgtcagtgcc tttcgttttc tctcttatct agggatgctt gttatgttga    206460
     atatatatat gcgttttatt ctataaatct ggtgattctg taggaatttt cccaacttgt    206520
     gctgatcctg atcctatcta tctcgatgcc atcttctttt ctttctcggc agcttctaag    206580
     tccattgata tgtttcaatt ttaaagagag acgagaaata cccaaagttc ccgccgcctc    206640
     atcatccctg actaatacga tttttttccc cctaagaaaa taatccacaa cccacaacca    206700
     gaagggcttt aacacgcatt tggctatggg gatccctcac ttaacccggc acctgctccc    206760
     atatgccgaa agtgtcttgt tagatgggag ggcaaacgat tcaggacttc cacaagtcca    206820
     agccgttgtc attgacggac ccagtctagt atatcatgtc taccgtcgac tcctaggctg    206880
     gatggaccca aacagcgatg tccttgatta ccagccaacc tgcgacgaga tcagtcgtgg    206940
     ggtgagcagc ctccttctcg aattaaccag actgggtgtt aaaatgtaag ccctcgcact    207000
     agtctgaaac acagctatcg tctgattatc attttccttt ctctctctgt tctttagaca    207060
     taagatttgc ttcgatggtg ccctgcctat ctccaagcga gaagtccgct tttccagaat    207120
     tgaaaagtca cgacatcgac tggaattggc tcgtcggaac ctgtctctgc ctgcggcgcc    207180
     caaatgtcgc gatgtgatcc cgactaaacg agggcaggtc tggtgcagtc ggggcttgcc    207240
     tcagcgacgg aaaggtcttc cagagaatcc tttcatggta tcggcggtct ttgaggactt    207300
     gcgcagccgg tggaacaagg aacagattcg gaaagaggtt gacgatgata tcagctgtct    207360
     tgtcgcagat actgattacc cctgggccga catcaccgtc atggtgccgg gagaagctga    207420
     tgtcgagtgt gcccgtgtgg caaaacttac cggctgtgca gtgttgacag atgattcgga    207480
     tctcctgctt cacgaccttg gccagcacgg cgcagtcttg tttttagact cggtgcaaac    207540
     gtcctcgggt gtctgggatc cggcccagcc agatatccgg gggctgagaa tctgtcctca    207600
     ttcgctctct ggccggttgg ggattccaag cattcagtgg tttgcttacg aattgcaaag    207660
     aaatgctcac ctgcgttttg ctgaacttgc ccggatatct aaggagagca gtaaggcgac    207720
     tcagctttcc tcggattacc tggagtttct tcgagagtat caacacgaga ccgccgataa    207780
     tgaggtgata cgtgaagcag cgcagtccat gcaatcattg gatccgaggg tatcagagtt    207840
     attttggcag tacgaacttc ctgatatata ctgcgtggat gaacagccgc acgtctatct    207900
     cggcattctg aacgaagact cttccaggcg atgtgcctgg gaacaaggcc gaacatatag    207960
     gtctcttggg tactcttttt tcaacatttc ccgtcctgct tccaaacgct tcccggttgt    208020
     ccatgaattc gttcgcagag gtggaaggat cgtggccgag gagatcgctt taagcggaac    208080
     aaagaccgtg acctctggcc tggaactcct ccgaagacgt ctcgccgttg cacattctac    208140
     ctttgacgat ggcctggcag cggagagctt ctggtttttg tttgttcttt ccgatatcta    208200
     tcgtgatgga tccggcacaa ccacagttcc tagtgcaaag gaattagaga gttttcttac    208260
     aaatgggtat atggcgcaaa gtactaaatg ggcggacatt caccttcttg cccaaatgca    208320
     agctggactg tactctttac gaatactgaa gcagctcgtc gatatcgcag ctcctggtga    208380
     tgacttggtt gattccagct cactactcgc ggatttacca ccactacaca taatgatgtc    208440
     gcgacaaaag attatacaga gctttgccag cactcgtctt gtccggcatg cggttcatcg    208500
     attgatagaa acgtatgctt aacaaataac aatatacatt gcaagccaat gcactacgtg    208560
     cttcgcaaag accgcacggc tcacgagccc tcggatcaat ggccgtaatc agctagggat    208620
     ttgacatcca tgcgtctttg taaattacaa aacatttgca ttgtggtcat catagacgga    208680
     gaagacataa atgtgccatt gtataacctt gcctgagaag ccccgggtcc ttcaaatgat    208740
     tcattccatt ggcacatagg tttaaagttc tagaaccagc cctgggagga gtgacgctgc    208800
     tggtcctcag tgcagtcatt ttgtttgatc ggatacgggc gattgacagc ataaattggt    208860
     cattcggtct tgcgtgttgt ggtcggttgc ttgcccggtg tctgaaggcg aaaattgtct    208920
     gatatgttgt tttacacctt tctggcaaag aaagaaacgg atatttttgt gggtatcatg    208980
     tggatggtcg caacagcgat aggcgactgg gataaatcgc tcaagtcgct catttttcgg    209040
     gggcatcggg aagtcgttca atcacatatt tgccgcgagc gacactcatg atgggtgctc    209100
     ctggaatttt gctattgtgt tgttagaaat ttggctgctg gagcgaaatg gggtcaaaat    209160
     gtaggttaca taccgaatac gtctcttgag atcacgatcg tttgtggcga taatgtagac    209220
     acggtgctta atgactcggt cgaccagaca gtcatcggca tatgttccct tgtggtcgca    209280
     cttgactcgc tcaaaccggg ggtccttggc tacacgtaga gcaagtcggt atttcgggcc    209340
     aagcttctcc aactcggcaa ggacgcagtc ggtgacgata gggatacatt tggcgtacag    209400
     gcaatcgagc atggtcggaa ttacctcgag cttgtgctga atggtgtggg agatgaaatt    209460
     ggtatcaacc agcacggagt atgggggggc aagggccgtg ttgaactgga agaacattga    209520
     cgagggagct tgggggctag aaacgaactt atcagtacga ttctttcggt agtacgtata    209580
     tggtgtactt acgcctctct gacgagatca tccttctttg cctctttgcc tttctctgtc    209640
     ttatcttggt tttgcttcct ataaccgatg ttagcaaagc gcaacagaac tgcgcttcgt    209700
     gattgggacg aacaggcgat tatcgcgcat ggaaatggcc ctcttggcta gcgcaaactt    209760
     gcgagtcttc ttctgaacac ccatgatgac gagatgtaga tggtgataat agtgaagagg    209820
     tttttttttt ctcttctctt atcggggaaa tctatctcgg gttcgggctg actaatcgtg    209880
     tcgagggcct catcccgcat cctgcggaca atcttgtctt cgaaactccc tcgtactcag    209940
     caataaacca cgaacactca tcatgtccgg accggatgca gactttgatc tgtcgaaagt    210000
     aagtccccct ccctcgtcag ccaggacggg catctatttc cttaaactat gctgctaggc    210060
     agcgttatcc ctcttacatc ccctcccctc tagcaccaca gctaacttat gatataggca    210120
     ctcgcagatc ttgcaaagta cgtgagtcca cttatagttt acataatgtg aattcatgat    210180
     atttacatca ttctaggggt gaaatgactg cctcggccct ggaaaatcaa ctcaacgcaa    210240
     ttgaaagcca agttgatgaa ctcttggcat ctttcgaaaa gcagggtact gctgcagcgg    210300
     agtctacatc tgtcgataaa acagaccctc gtcaaccatg cacagatcat gatcaaaaag    210360
     tagagccatc gaatagtcca cccaagtgat acttctcatc ggctcccttc tctacaactc    210420
     caacctctgt gataatccca tctatcagac tcgcaggagt aatgtcaaat gcggggttcc    210480
     agacattgat cccaggcgcg gcaattttca cggtctcaat cgcaatctga tcggtggcct    210540
     cagaacccgc acggggacct ttgatgctgg tcacctcgga tgctgcacgt tgctcaatga    210600
     caatgtcctt ccctgatgct gtggccatat cgattgtcgt gcgtggcgct gcaacgagga    210660
     acttgacacc atggtacttt gccaagacag ccagggcata tgtgccgatt ttgttggccg    210720
     tgtcaccatt ggctgctacc ctatcagctc ccaccacaat tgcattcact cccactttgg    210780
     tatctgcgag caaagcggct gccatagaat ccgtgatgag cgtagctgga attttgtcgt    210840
     gaaccaactc gaaggctgta aggcgagacc cctggttgta gggcctagtc tctgtgcaat    210900
     aagcgtgacg tagggtgttc ttttcggcca gtgaacgaac cacacccaat gcggttccat    210960
     atccagaagt ggcgagagag ctagtgattt agggttagtg acaacatacg acggataacg    211020
     gataatgcaa tgaatcagcc ctacccagtg ttgcagtgag tcaacacagc aacttctgaa    211080
     ttccccttgg ctgcatgaat ggcgatccat tctgcgccat tgtgtccaat tctcttgtta    211140
     tcctcaaggt ccttccccat catatcttct gccgccttaa taaatgctgt cgcgacttca    211200
     tggccggtag aacccggtgc tttcgtgcaa tcggtcacca cggcctccag tttgcgcgca    211260
     gcatcagcga gattgacggc agttggccta ctcgtcacca gataagcaag cttctctgtg    211320
     atatattggc acacctcttc tggtgattgt gagagcttgt cactatccac agcagaggtt    211380
     agttccgcgg cgagggcaag cattgcgacg atagcaatag caggtgcccc tcgaactttc    211440
     atatctttga tggcgtgcca tccatcttct gtagtccgaa tgggaatata ttcttcgacg    211500
     aagggaagtt gtaactgatc caggatctca aggttgccct tgctgaactt gattgcctgt    211560
     aacatcttcg tagatgacgg tcaaaagttc tgtaagtcct gggagaggcg cgaggaaaga    211620
     accttaagtg ccgcggggac ttgggacagc ttacttaatc aatgcctatg gccccgggga    211680
     tcttcggcgg agggtagaat atagtacaac ctttccagga acgaaccttc aacgtacata    211740
     tctatgtata taggtaggat aactaagtca tcgcagggta aaatgtcatg tattactgtg    211800
     tgactgtact ttgcattaaa acacgaggcc aatggcacat tgccgcatca caagaaaata    211860
     ttaccaagca gcctgggcaa cagttgatgg gcttatagtt aagagctcca atgttgagct    211920
     catacaaagc aagatagaaa agtaaccccc aggcacgtag cctccataac cccaggctcg    211980
     cgagtctggt caacagtctc atgagaagtg ttggtcaatc ccaaccaggc ttgtattctg    212040
     tcctcctagc tagaagtttc caaatcattg cgattacact caaagagtgt ctttcttatc    212100
     cacctgcagg ttctcgtagg tgggcgcaat caataacatc gaacagtgta ttctcggatc    212160
     aactggaaga gatgtacagt actgtaggtt ccggtcagaa atccgtcgcg gccctgatgg    212220
     gattggaata caagaagggg tcaacaaacc attatttccg cgcacgaaag catccccgta    212280
     gtttcgtcgt agttttccgt tcacatattc ctccgtcttc tcgagggcaa tgttcatgta    212340
     gccatcaacc gattgcaatt cacctatagg cgcattagac gtgaagccag tgggaattat    212400
     aagaagagcc cgtacccttg tataccactc cggaattcag cttcacgatc accggcgcgc    212460
     cgatgatctc actcaaaaag agagagggat ctttcccttc ggaggctggg gcgttctcca    212520
     tatcgatagt atggtctaaa atttatcaaa tgtcagccag agaaaagttc aagtagaaat    212580
     ggggagacat acctggttga gatgtgtttt gaagtaggcg gagggatgaa gcattcgcaa    212640
     gtgagatacc aggaaggcgg tgagggagat gaactatcgc aagcggggcg ggatctcctg    212700
     ataagttttc agagggaaat cggacaccgc cattatattc tgccggtatt gccagtcata    212760
     aaaatactat accttttata acttggaagc ggccttgaaa actactgaaa aagttggata    212820
     ttagaagata cgagttagtc atagctatct ggaggtcaat tggtaagaaa ccaagaggag    212880
     aggtgtctta tattgacaaa tcttacactg gttagaaagc gcgctagtac atttttaatg    212940
     ggcggtaata aagacggtgt catctgaggt cccactgtat ctatcccaag tctagaagat    213000
     gcaatacatt ctccttccac cttagctgcc aattgtatgg cttatgccca ggtcctcatg    213060
     tcgcacattt tactgcctca ctaacatatc actgattata atcaggtgcc tgtcgggcca    213120
     cttctaaaat ccattcggtc atcctactat acttggattt ttaacctgac cgattccggc    213180
     tccgagtcat gagctttttc aaaaagccct cgtgggcaat caagaatacg ggggaagcca    213240
     gcactgattt ctatcggcgc tcagaacaaa cgtactctga tatcattgct gcgagccgtg    213300
     aagcacacca gaagccgaaa tcaccagaaa tcccagaaca taccgaagac accaaagata    213360
     ccgaagaccc gaagcaaaaa aagcggcgcc ggctttctag ggaaaagggg aaagagcgca    213420
     gcgatagcag tctggcgcag gatgtgaccc gtgatgttga tagcgataaa attgtgctat    213480
     cagaggcaca agatatctcg gcttcctcgc atgattcctc gctcgagcca gtcagttcaa    213540
     tgaaacaacg cgagacaacc aaaagtgact tcccagaaaa ccactcgtct ccgtcaccac    213600
     agaaaccccg tggtccggaa ccactaggcg ctctgcctgt tcgaccagtg attgtcctag    213660
     ccgatgactc ggaaactcga agccctcgac ctgttcaacc tgctcagccc attcaaccgc    213720
     cagaagttcc agcggatgac ccggttgtcc aaatcatgat cacatctgaa attgcaaaca    213780
     ccaaaccatt actcgtccat cgaaaaatgt cacagcgact aagggatgtg cggttggcat    213840
     ggtgcaatcg ccaaaatttt gaacctcata tacaggcatc catttacctg acctggaagg    213900
     gccgacgtct attcgacgtg acgacttgca gaactctagg catagaaaca gggaaaaact    213960
     ctgcggcgat ccctggcatt gatgatgatt cctttgcaga ccagaaagag ctgcgcgtac    214020
     atatggaagc ggttaccgat ttacctcttc cggtcaatca gcgaatttct tcgcctgata    214080
     atgataaccc ccctacaaag tcacaatccc cagaagatga ccagggtgag ccgatgaaac    214140
     ttattctgag gagtcctgga tacgacgatt tcagaatcaa agcaagacaa acgaccctga    214200
     tctctcggct catatctgcg tttcggaata aacaaaatat ttctgtggac cgtgatatct    214260
     tcctgttgtt tgacggggat aaactcgacc ccgattcatc tcttggcgac tatgacattg    214320
     acaatctaga tctggtggat gtccagatca gataatcggc cttgaaggac ctgaactgaa    214380
     tactagctaa tcagggctaa tcaaagctaa tcaaaacttc cagtttgaac tagaaacctc    214440
     tgtaagatac cgtgtacata tgtatatagg tttccaggta aacgtcaact ggtatgggct    214500
     ggggtagtag tcagggtatc catatcgatc acatgatatc tgataagccg tggggctctt    214560
     atttttttct ccctcggagg gaccaccgac gttgttcatt atcctttaaa ttggtctcct    214620
     gtctagacct aaatcaatat ctacccactc gagcagcatt ctcaaaacct tcccgtcgat    214680
     aattcatcaa gaatcacccc gaaaccacca caatgaaagt gatcaccgcc aatttcgtga    214740
     catgcgccgt gaaggaatgc aagacatcac cggcatcatt cccgttacat ttccaggatg    214800
     ccgagctcga gcaacaagaa ttggatttcc agcccgaatt catccgcaac atccttcccc    214860
     gaattgactg ggaagccctg cgcaccattt ccaacgaggt atgaagatcc aaacccgggt    214920
     acctaggtaa ttcaccgaca attacaaata atctgacatt tgcaatctca gctgggattc    214980
     ccaagtcttc cggattcgaa acccgagggc gatgctctcg agaatgagca gacattgagg    215040
     gacttgcacc ggttgctact tgagacgcag gtcacagaag ggaaattgac ctgtgggaac    215100
     tgcggtcatt catatatgat taaggaagga attgcgaact tcctgcttcc aagccacctt    215160
     ggtgagaaat acatattatc tttttgtttt gaccttattc gttttgctaa ttgctactat    215220
     ctttccagtc tgaataacac acaatcccac acgcgctctt ctcccaaatt gcttcgcaaa    215280
     tcgataccca agggctagga accggtcttt gagaaccagt ctctcagtct ctcctttcct    215340
     ttcctttctt cgaaagagga ccctatgcag tgcactaggg ttatcagaca ctcgagtcga    215400
     gttctttgga atatgacaca tctacgctct cacattggtt tctaaaaagg actttgctcc    215460
     gggccacgac ttgaaccgga aacaggcgaa attcttttgg aattggtata ttgtacaaga    215520
     gagttggtag tttatgaaat cacgattgcc attgataaat gcgtcaatgc tcccacgctg    215580
     aaaacgccag cctgattcaa cgccatccgg tagaagggag tcaatatgcc tcccaaagag    215640
     tcagctagat agatctcggg aggtgggctt aattgaggaa tcctttgcag cccgttgaac    215700
     cacagaggca ggggattcgg tcatcgctgt cccactctct ttcgaatttg tagtcgtaag    215760
     ttaactcctc atctgataaa ttttattagc cagtgtttac ttgcaaagag agcgcggttc    215820
     acaaacctct ttcgatatcc ctgagcgcat aaatcacaat ccgtttgctg ccatcaacct    215880
     tgatgatttt agcagtgcag ttgggcgtac agctgtgatt gatgaatcgc gcaattcctc    215940
     ctctctttgt ggcatcgatg acggtgttct catcgattcg gaatagatag ctgctgccga    216000
     tcccgctctt caggtatcgt ctttctctca tatcggcgac ctgctgacgc actttttcgc    216060
     caacatactc gatgatcata tcattcgcag tgatgttttc ctcagcatac aacccccaat    216120
     tgtgaatagc agagcgagcg aagcgcacag gtttcttgcg ttttttgagc tgattaaatc    216180
     gaagaacgtc tccttcgccg ttcgcagtgg gaagggcctg tttttgcgca ttgatgtctg    216240
     caatgagccg gcggttgttg actcgggttg accgggacgt cgactttgat attgttttgg    216300
     cggcggcaat cctggcagct tctgctgctg ctgcctgggg gtctgccttg gcattcgctt    216360
     cacgctcctc ccgagccttc tgaaccttga tacgatgggg cagatatttg gacttttctg    216420
     cctcaagaat cctttttcga ccttccgtcc gcgcagcacc tgtggtgttt ggcacataat    216480
     aaccagggat actgatagcg tcatgggtcg tgccagtttc caggccattt agagctttga    216540
     tctccttctg tttccaaccc catgcagcaa gattttggat aatggattct gactgatcca    216600
     ctaggacttc tcgcaaaaat tgtagatctt catcatcctt gaccaggtgt tgccaaccat    216660
     ccaaatcaag cacaatgttt tcatcatctt ccaccgtggc gcggggctca tccttggaaa    216720
     caccccattc aatctctgtt ctcggctcat caataggttc ggcctgccac gtttcgctga    216780
     cggaaacatc atccccctcg ggatgtttgt gagtgacatg ctcggtgaat tgttctgcgg    216840
     gttgatcgtg cgttgctaat tcgtcaccgt tctctgcgag atcatcgcca atagccgcgg    216900
     gcgtcttcag atccttggcc agatcttcat gcttggccgt ttccgagtca atgccaaata    216960
     gctcatcctc ctgccgctgc cgctttcgtg cttcgtcatc ttcggtcagt cgctttctct    217020
     tgcctgtcgg ggacacctga agttcatgag aaagatcgct gatttcattt gtggcatcca    217080
     aatcgtccat aacttgagcg ctgccctctt cctcttgatc gtctgaccgg taccccccat    217140
     cccgttcaaa ctctgacgac gttgaactgg cgcgactagg gggtcgactc tctcggtcat    217200
     cggcatcctg agtagcagga gtgcgctgct cgtcgtccga atcttcatcg tcgtgcaact    217260
     gctgcaagcg atgatacaag ggtcggactt ctttctttcg tagtggttgc ctgcgccgtt    217320
     cgtctaggaa agcagcacct gcatggtcaa gaccatgggc tttccggata cgaggaagag    217380
     caaggacatt cagacctgat gatttgaggg gatctcgccc ggcagacatt tcaccccgag    217440
     agccaggggt gctgtcgatt tggaaaacag atcgttttgt tccttcgggg tccgaaatac    217500
     ccagccgttc ccttctagac gcatgcttac tcggttccaa atagtcgtaa agagctggag    217560
     cagctatgcg tgacttcaca tcctcaagaa gcttgtccct caggtcacga atgatgatag    217620
     acaatacctc tcgacatgga tccaaatcaa gcgcccgctg ctttttctct tcttcgatat    217680
     ccaattcggc ttcttttttg gcccgatcct tttcggcttt gtcacgtcgt tcggtgcgaa    217740
     ggcgttcagg gctgggactt cgttcgtagt tcggattccc gtagggctgg ctctccatat    217800
     tcatgatata cgtgaacaat ggttgcatgt ggcatagtcg gtagcagcgt tcagtttcct    217860
     cctcaccccg gcgcgagttc tcgaagatga tatagtagcc tgttttgtca caacgaatat    217920
     gcttgtatgc aaagagcctg agtcttttcc tcaagtgtgg aaccgttgtg ctgagaaccg    217980
     ggacgtaaca atgcgcaatg aaaatgtatg gatcgcgttt gatctgactc aagataggag    218040
     tttcttcgac caatgattgc acaacaggag atcggacacc ggccctaggg ccttctggga    218100
     taacgacccc cggccgcaag gatgatctgc ccgagggacc tttgggcgca gtcggtggtg    218160
     gttcgctttt cttgatctgg acatctggtc tcggttcact tgcgggcgga aggttgattt    218220
     tggaagcctg tcgctgggac tcgactgctt tcgcggccat tcgatctgag acaatcccgt    218280
     cgcggtccag ttcgacccta atcctgcgtg tgccaatgcg ttgttctttt ttgcattcga    218340
     agtacgcacg tcgggctgcg ctagacgctg aggctgggcc atttccccgg gctgaggtgc    218400
     tatctttgta tttgatggag cagatcccca gaaaccggcc ggtgatgggg tctgtgcggt    218460
     ttttgatctc ggccacatct ccaaagctcg agaaaagtgc gctgatcggg gcgatcgggg    218520
     tcaaaggatc aaaccctgtc accacgacct ggatcggagg ccccgggcca atgctcgttg    218580
     ccacgtcgta tgaccatggt ttcaaattgt aaggtgcggg tcggtatttc gttttctgct    218640
     tgcagccgga tccacgggta taattggcaa tcgcgaggcg cggatcgggc ggtgcatcgg    218700
     attggccatt attcacgatg tccacatact cgagctttct ccgcttttcc tttgacgagg    218760
     tccgcttgtc cagatcgggg tcatagacaa ccttgcagcc tctcacacgg agctcgaaat    218820
     gtcgggtttg cgattgaggc gtcggaggtg tgtggattgg agtgatggaa gatttggtga    218880
     tttcagggtt cggcctggaa gaagtacccg gagaacctcc gcctgctatc tttggctgtg    218940
     atggactagt taatttgcaa gggggtgatg attccgcgtt agtgagcggt gtcagtgtat    219000
     cgatttgtga tgggacgtga tttgcggcgg gtgcaggtgg cccagtctta tcctccgcgc    219060
     ttttcgcctt ggcggaaatg gtcaattcag gtacgttggg gaccgatgaa gtgcgagctt    219120
     cctcctcgtt tgtatcgggt ttgagaggtg tatcgatggt tgttggtgtg ctcggagcaa    219180
     gtgacactgg acaatccggg accctttcag aattttgatc accctcgaca tgtaatttcc    219240
     gtcgttcctg cgctgttttg aagcgcttct gctgaaggac tgatggggcg gtggggaaga    219300
     agtctgcgaa gccagccgag gcgcgtgaca tggtgagagg ttggctacac gccagagacc    219360
     gtggcgcgat cagaaggcag catccttgac agtggtgatc cggctattgc gaacacatgc    219420
     gaccgagaag gtcccggcac tgcagaattg aggaaattga gatgaagggg ctttatacag    219480
     gaatgtcggt gtcaataaag agatgacaaa agagaaagag atgagaagaa aaggactgga    219540
     aagcgatatc cagaagctgc tgagtctgtg ccagtacgcg caattcaaga gtttgcagga    219600
     ggctaagacg cgatcgagcg gaaggaagtg gaatggtggg gacgcgggag attgaacttc    219660
     acgctttcaa gggatatgaa ctcctataag aaaacagaga aaacagagaa aagaaataat    219720
     ggaaatataa ttaggtgatg aagttgaagt tcaagttcaa gttccccggg gccgttcacc    219780
     tgcgcaagta acatttgaat gattcagcaa tcctttttgg ccttttttct ttttcttttt    219840
     cttttttttt tccttttttg ccctgaaagg accccagtga cctcaccgcg acttaatcat    219900
     tcactatgag aacgcccacg attgaggtac ctaacaagta tcttttgggc actacactat    219960
     agtaatcaat ttaatctttc ttttgtcgct ggtagagacg actgttggtg gctattcctt    220020
     tcacagcccc ttcgacgttt gaacgcgttg ataggagagg ctataagtat tattccgcga    220080
     tccttgagta ccctattaat gggaaggatg ggcgtcatag agaagagggt ctatctagct    220140
     aaagagccat ttgaatagcg ccctctttag tagaaggata cgcgcttaga gattattatc    220200
     ccaaatgcgc tggaatagtt agtaccggga tatcacagta actggttaaa caatgcccta    220260
     gcactgctct cagccatgac gtaaatgtcg atgcagcgtt tccccgtttg aattgaaacc    220320
     cgctgcgcgc ggtccttctc tgcctcctcg acacgtttct cgcacgtgga aatatcgatc    220380
     cctagcacgg tgtcgcgcag gaactctgtt agcccgccta ctacctcgac gaggttaggg    220440
     acggggacgg ggacggatct ttgttgttgt tgctcggatg cgatctcggc agagattcga    220500
     cggattctaa taaaagaata tcgtaggaat acgtcttcgt cgtcgcttga actacggctc    220560
     cgttggtcca aaagaagcac ccagctgccg ggctgtatct ctctgagtct gactcttgac    220620
     tgatcatttg gtgcgaggtg attgccaaag gatccggtgg gaacgggacc cacagcgaac    220680
     cgtcctgacg atgacgatga cggcggtgac ttatcgtcgt cgtcggtggt ggtggtggtg    220740
     atgagtgccg aggagggccc cctgtatgcg aatcgtagga tggccttgtc agaatccgaa    220800
     cgcacggaac ggaggtatga tagaaatcgg acggcaaagc actcggcgtc tagaagggtg    220860
     ttgcctatgt cgtagtagca actgtaactg taactgttct ggtattgttg aaggtagcgg    220920
     tctgcgtatg tgacatcttt atgctggtga cccataaacg tgaacatatg tatcacgaga    220980
     gagacctaga cgacggggaa attgaaagtg acactagtag tcgagggcga cgtgaatttg    221040
     cgggtataca aggatatcga aaagggcgca agtcagatat atggttttat cgcggagcca    221100
     tcccaagtct cctagtgaaa ccgcccccca cccccgtagc agctgcgtgt agaaaccagc    221160
     agaggcgtcg tcgctgtccc tatccggtct ctgtaagaaa cagagctatt tgatggtcgt    221220
     ggactgcgct agggccacta ttagatacca aggtctccct tgtcttcctc cagcttgtac    221280
     ttatcgacgc agaagctgag cgcagacgcg ccccgaagct cgtccgatat aacggcggta    221340
     gcgataacac cgggcgcgag gtttctagac gtaacccagt taaggtgcat atatccggtg    221400
     tacgcaacgc gcagaatata ggccgaggct gtcgggcacc tcttcgagcc gccgccgtag    221460
     ctagtcgcgg aactcggcga gctttcgtgg tcaagcgcga ggctattgtg gtcgatgcat    221520
     ctttggctcg gttcgtggac tttgaaggcc agaagtctgt tttataagtc agcaaatgcg    221580
     atagatatgt gcgagtatat cacagacagt cggagatgct tgagatgaca ccttgcgaag    221640
     atgctctagc ctgatttcca agctctggcg gccaaatgtc taccaagtca gcacatgcac    221700
     atcatcctga tcccataggc ggacaggtgc tgcgccctat cccaagtatc taatagcaaa    221760
     aatgcctcat cgacgatctc ttaggcttat atctaaacct gtcaaccgag caagtagtca    221820
     ataccaacca gcgctctcca cctctcaacc cttaagaggc cgagaaccag caagcgctaa    221880
     aacaatcgat cccgcaaccc tgagtcacca tacttgatta tctcaggttc ttcattaaaa    221940
     gacttcgctt gaccagaagt gataggcaat ttgcataacg ttgtgggatg gaatatgtgc    222000
     ggcacaatat cctagtgtct cgagcctgac ttggcggcac atatcatgat cgggtgtgat    222060
     aagctggaga taggtaccta ggtagatctg caactaaatc gaaacgttcg agagcatgaa    222120
     ctgatcacca atgcattagc gtgatcctgt gacattttag caagtcactt acaaggagtc    222180
     tcgagaggac gcgccctgcc cccaaatcag acttgtgagg ggaaccctgc gtcttggcag    222240
     ggtagtctgg gaaaatggtg atatgacagc tgttcagaca tacctagcag acctgttcaa    222300
     ttggcattag gaagagacat tgattggcca ttaaatttgg ggcatatatc gtttcaggag    222360
     gatgatggtg ggggtgtgga catctccgtt tgattaagac tctcttggcg caaacaatcg    222420
     ggagagaccc gcaaggctat cattgggttg acatcgcttt cacccttggc aaaggacggc    222480
     caccatggag ctgctcatga tggatttcat taataatgga cctctctaag acgtacacgt    222540
     gtcggtgttg tagcgagatc tatgtgaggt gagcagctta tctcgcaggt atgtcaaagg    222600
     tactataaaa agcacatcaa ttctttgaag ctacgcaagc tttgattgag ctaattgagt    222660
     cggtccgcgg ttgacgattg ccagttctcc cagggaattc cacgcataga ccacggacac    222720
     tcagagcccg gatcgtgcat tatacctacc cgccaacaga tgtagtcggg gccatgaagc    222780
     taacgcctgc cactcccgcc aagatcgcct ctggagagct gactggtcta gcggtctagc    222840
     gaaccctagt agcggaagac gcggcaatcc cagggtctac ggacgtacga atcgggccca    222900
     gttgcatcta catacacgag tgtgcccata gtgcatggga ggaggccgtg cattaccaac    222960
     tccgtcgagc ctcacacttc cctgtacctc tcctgcgaac gccgtctatt tagtgtcctc    223020
     catagaatca ccggaggacc tttatatcac caccatcgct cgcatccctt gtgtacttct    223080
     aaagtcatcc ccgctcctgt ggacggaatc ctcaccagcg tctgtcattt aaaggagggg    223140
     cctccaccac tccaggtctt ccggatgatc ccttctcatc ttacaaatct tctacaccat    223200
     gctgcgccat gcacctgatg gatcacactc cagcgcggcc tcagaccgaa gcgacaacca    223260
     tcacagagcg cactcgtccg ccatcaccaa gaaagaacgc gcgtcgcaac ccgcaggaag    223320
     actggcctgt gacatttgca gagaacgtat gcaaagcctc ccgaagagtg aacaaagtac    223380
     cgtgctgaca ctggtccaca ggcaaggtcc gttgcgaccg cggggacccg aaatgtggcc    223440
     gttgcgcgcg gcttggctac gactgcagct accagggacg gaagcgacat cgtgcagctc    223500
     aagcggatat gccacgccaa ttatgtgaac tacagacccg actaggtaag tgccccaatc    223560
     tcgaataaat tacgaataaa ttccaccctc gctcatcctg gtcggttgtc tcagcacatg    223620
     cagaggcgct cctgcgcaca actccctccc cagcatttac tcccactact gctcgacaga    223680
     tttcccccta tgtggactta tcctggccgt tggtgacgcc ttcggaccgg ccaggcgacc    223740
     atgaacgact aatgcagcgg ctccaaagcc atgtaacccc tccgatagat cgtgccttcg    223800
     aggggctgga catgttagcg aacttgaccg aggatattcc cgatttctgg ggggtgatgg    223860
     acccggctct gacgccggac gctcttccac tcctgcccgg cgatacgcct cagctgccaa    223920
     cccccttcga cacgggctat ctccatactg cgaacggtaa tttggttcct cctactttcg    223980
     aaaactctct cttctcaacg catgaactag aagagccaat ctcaccgtct gacctcgccg    224040
     tcctgtaccg tattcccatg tcccctttgg ctggaacagg aaactaatcg atcgacccag    224100
     acaccagaag tactttgata ttttctatcc tgttctacca atcctaaatc aatcgcgatt    224160
     tcgccgagaa tgggcccagg atccagcttc cccccggatc cgaggattaa gttacgctgt    224220
     ggccctggtc ggctcgatga ttgcgccaga atacgcccat ctccagtcac gttgttacag    224280
     cgatgcccgt aaatacatcg agctctgcga gcgcgacgat gatgagacga acattatgag    224340
     cttgaatgcc tttcaagcgt tactattcat tattcgctat gagctaacga aaaagcactt    224400
     tgttcgcgcg tggatgactc tcggccgtgc tgttacgctt gctcaaatcc tcaacctgca    224460
     ccacatcgat ggcgtggacg cgactcgaca tcaacgcact gggtccccaa aaaatgcaat    224520
     agagacaggg tacgttagcg atattcgcga tccagcctcg atggaggaaa tccgacgttc    224580
     cttctggtct ttatacatct tcgagagtta tggaagcgtt cgcaccgacc gaccttgcac    224640
     cctagaagag gacaccttgt gtatctatct tccatctcct ggtgagctca aagaaagctt    224700
     tctgcctagc ccgatgcctt ttatcagcga atcaacgaaa cttactgggg ttgggtacct    224760
     gacctcctac gctgcggtga ccatcatggt caagcttgcc cgcctctgct ttgaacacgt    224820
     gagtattctc tctcgcagtg ccagcgactc gggcttctgg gatcgacatt accgtctggt    224880
     taagacgata aacgactata ctgccatatt ccaacgatac ctgactgcga aggccgtccg    224940
     agaagaccca ttggcgtttt cgctgcacct caatctctgt gcaacacata ttagcctcca    225000
     cgaggcagcg atacgcaagg ttgaagagca agacctgccg aagcttgttg cagctgaaag    225060
     tcggaagtgt agtgccgccg cggcatttaa gattcttgga gccattcgca tgaactggcc    225120
     tgtacaacgg tcggaggtaa ctctttccta ttgcttcatg ctctgattta tccgtgtcca    225180
     atctgactca ttgtagcgcg accacttcac tctccaagcg acattcatcg gctggcccat    225240
     ttccatgagc ctgatcgccc tgagccgcag tttagccaat ggtgacacca ctccgatcgg    225300
     catagtggac tctctgcgtc tgctacgtgc tgctctcgac caggtggagg aacctgatgg    225360
     gtattggcac caagccagcg gtgctgcggt gactgccttg gggaaatggg acgagcaaca    225420
     gcgcgagtcc cgttccgttg aatgacttga tgtcgcctga tatgcgttca gcggatatgg    225480
     aactcataga aatcaatcga cgatctcggc tttaaccaag cataagccaa tctaggtttg    225540
     atacctcaaa gtacctgaga ccggggtcca cagagaaaat tgcaccgaca gtcgtagcac    225600
     tagaggctta aagcagcgga agaatgtgat aggcacgctc atttgtaatt cggctcgact    225660
     cgtcgaagtt gtcatccatg tcctccaggg tcccggggcg gggctactat tggcttagta    225720
     accaatctta aatacctagc cctacctagg taggtaggta tcttacctag gtacctacat    225780
     aggtaggtag gtcccttcgc cagcagacgc ctgaagcgat acatggtcat gaaaatcttc    225840
     tcctttcttc tacataatct taccttcttt gtgtatctac ttcatgagac gtatggaccc    225900
     cagaccacaa atgctgggaa tcactaggca aaagccacaa cagcgtcgaa ccgagacaca    225960
     gaaacaatcc catcaataag ggccaaatct gctgcagctt cccgttccaa ccccaccatt    226020
     tctgtgctcg ctccacttgt tgcttgcgcc tagccagccc tgcttctttg cctctgcggc    226080
     gatagtatcc tgccatccga gaagaccctt ctgctcagga aaatcgacga agcccaactt    226140
     tgtgccggta ctgcacagcc tagcgatatt aattgccagc gtatccaggc caatccatgg    226200
     ggtgacccag cgctgcatga tgtaaaagta ccacccgtca aaggcctgca agcgcgtaag    226260
     atccccgcct actttaacga tagccttgac gcgctcgatt cgcgaaccct ggtactcctg    226320
     catggcagca ctaatctcca ccgtattggt ggcaattctt aggggtttag tgagatgtgt    226380
     tgggttgttt cgtagaaggg tcagaagggt ctcagtaact ttgccttgtc tggccttcta    226440
     gtcctgaggt cgaggtctat agcttcaatg agagatttgc ctgggtgaaa acgttttgtt    226500
     ccttttgctt ttgtttacta taaatttgta gtaatccttt tcattttgtc atcggatcga    226560
     cccaagtcat atattttaag taccaacaac agcaagttca tgataagacc ggcaacgcag    226620
     tacaaaacac acaatagctc cgccaatcat gaggtaacta aggcagaagt gacaaatttt    226680
     ccctagaaat gcaacaagta cctcaatcca taccattgag gtgatttcct cggctctcaa    226740
     caaccataga tcacctctat ctggaagttt caagcctttt cgtccccgga atccgctccc    226800
     ttcatcctcg ttttctacaa aaccagttgg ttagtccacg taattgcatc ccaagtaccc    226860
     cgaaaggact gaagcttact cccaaaggcg gcgttaggac gaaactcaat atcccagcca    226920
     ccaaaaagaa caaccacaca ttgctcatcg catctgtgat ttgcggcgct acgagcgctc    226980
     gctccgactc cgacagcgcc ttatacgtct ggctactggt accagcagca aggttagaaa    227040
     tatcggctgc actcagcttg ggcatcgcct gtgacacttt ttgcaatgca gtattctgat    227100
     aaattgatcc acacattgcg aggaagatga ccatgccgag gtcttgggct atattttaga    227160
     atttatggtt agtgtatctg ttatttgggt ttaatagggc cccattggtg tctgaaatcc    227220
     tcttacaaat agccattgcg cccacggcat tcggaatatc ttttggtgca acaagagatt    227280
     gtacaacggg gaacccggcg acgacgtagc agcctgcccc ggagccgaca agaatggagt    227340
     agccgtagat cctggcgttg gaggtgtgaa tgtctgcagt gtctgtaatt tttcccttct    227400
     cattagtggt cattctatct gcgcgttatg atgcaaacaa ataacgaagg agggagacga    227460
     acacatcaat gccgttccag caacgacaag ggcactaccg aagatatgcc atggcaggac    227520
     ataaggcagt ttcggcatta atgccccatt ggccatggcg aagatgacca tagagatgat    227580
     gaagggaagg aggcgaactc ccgcatccaa gggaccgtct ccctatccgc gagcacactg    227640
     tcagttatat atgcccacgg gaataagtaa gtgccacata cccgtgagaa ctggaagaac    227700
     aacggaatat agtaagtcat tgcctaggga ctattgttag tattagacag tcctatttat    227760
     tggtacggca gggggcaaca caccagcaca acacctgaca ccaagaacat ctgcacttgc    227820
     agatttacct ggataggccg tcgaaggaaa tgggctggat agagccggtt gtccttctcc    227880
     acacctggat ggaacttggc cacggcaata cagataagta ggagcacccc cgctaccacc    227940
     cagagggcaa tttcacttcc agagctccag gaatacaacg tgccaccgaa cgtgatagcc    228000
     atcaccagac aggcagctcc tgcaaggaaa gtggtcgcca tcacccagtc tatcatacgg    228060
     cacttttctg tccagctttt gagcggctgg gggtcaacgc ttggaacaag gaagaggtag    228120
     gcaggggcga agacggctcc aatcgggagg tttatgtaaa acgcctacat acggatatgt    228180
     taaggatagc tcccaaaaat gtgtcagacg gtgtgagaac gtacccatcg ccaggtcgca    228240
     gaactatctg caaaagcgcc gccgacctat tcatcagcca ccatggtcag ttacgctgta    228300
     aaaaaggcaa gtgatgactg aacctaccac cggacctaga acacttccga ttccccagat    228360
     aacagtgctg ccagccatat aaataggtct ctctttaagc gaagtcaaca tcgccacaaa    228420
     actcaacgtc cccgagtaca tccctgatcc tcccacgccg gcgataacac gaccaaccac    228480
     gagggcagtc atattcggtg ctgcgccaca cacagcactt ccaatttcaa acagcacgat    228540
     attaaacagg tagacatatt tggcgttgaa cactccgtag accttgcccc atggcaaaac    228600
     acacatggtg ccgagggcaa agccgactcc gatccatggg aggagggaga cttcgccgaa    228660
     taggtcgaga atcacgggtt ggatgtcggc gacctatacc attattatat gctattagct    228720
     aattcccctt ggaccggtct aatatgagaa gctggtggga ggggtatgag gacgcacgat    228780
     ggtgttgtcc aatgcgaaga gaaatgttgt cgagatcatg gaggcgtatg caatggccca    228840
     ctgcatgcca attagctacc attttcactc cacgcagaga gatgcagaga gatgcagagc    228900
     gatacagtac cttccatccg tgaattggac gaggcgatgt ctccttaggg acgtcattct    228960
     tgctagagtc ggtgctagca aggataccgt tgctaccttg tctttctggg tccgcatcta    229020
     tggcagacat gatgaggggg gagtaaggat tacagtcttt ggatacgata tgagaattca    229080
     cgaaagaacc attgacgggg gcgttgctgc ttctatatgt tgattttata ttgtgcccca    229140
     aaggggcagt tagggctccg agcggccgct ccaactccgt gtcttggcgc ctcatcggcc    229200
     gccccaagtc cgtataagct caccctcacg cgtcattcct tgttgtgact cctggagcag    229260
     cccccgatag tcctgcggcc agtacgggac gaaccactcc tcaaaaacag tctttttccg    229320
     acggggattg aggccaagat ctctcatgag aatgtccagg tactaatcca tgcaagcaac    229380
     ccctgtcagc atttgcatac caatagccta ttaccactta agcggtaacg ggtggccagc    229440
     ttaccgaggt atagtcgtaa ataaaatacg agtgcttctt cccctgctca atatatcgct    229500
     tgcgagtcca tgcattgaag gtcgctgcct ctagctccat ttcctccttc ccagggagat    229560
     tcatccagtc gttcagaaac gcaaaccccc acaatgcatt gagttccgct gccagtggtg    229620
     tgaaggcaga gtgaatgtga ccaggaaaca cgatggatct cccctttggc cgccagttcg    229680
     ggaacaatga gacaacgata atgccaattt ggtccctggg tgtgctttct ctgctccagt    229740
     gcctcgaaag gcgacttttt caggataggt agctcattgt ttaccttctg ctcggcctgt    229800
     gcgtccagta ccgtccactt ggagaatacc gaggagtcat aatggaggcc tagttcttcc    229860
     tgcagcgggg ggctgaacgt atcgtatccc ttctcaaatc cgatacagtg aataacaatg    229920
     tcagtcggca cggaaaagcc gttcttgaag ttgacaacat ccagatgcga gagtgatttt    229980
     atctccgtgc ggtgaaccgt gacatctccc tcgtggatga cttgccaaag gtcgggcacg    230040
     gtcgctattc cgatacctcc actgccccag aaaagcctat atccagtgac tggttagccg    230100
     tgaaattccc gagcaaagca tacaaaagag acccgtaccc atctgtgtga ggccagggcc    230160
     gcagatgctc ggtatgctca tcatcgccga agcgcgcata tctaactgcc agacctgtgg    230220
     cgacttgcca atagacacgc atgagtgatc tgccgattac actccgctgc aaaaagttat    230280
     cccagagccc attacagctc atgatgcttg ggctaaagct ggatgcgaat cgggtggaga    230340
     tatggtccga tatatgccat aagcccatga acgtcggggc aaacatggaa aacgctccgg    230400
     aggcactcgg tcggataaca cagtccacct tcttccccgc tttgagtagc tggtagacgg    230460
     tgtcatagga tgatttcgag gctcccacca cagtggctcg ctggatcacg tcgctctcga    230520
     tcaaggacag gttaggggcg atgtctagcg agtggatgac gggcttgtgg aagttttctc    230580
     gtggccattt cggtctaata gggcttgaat tggcaccggt ggcatagatc aactttttgc    230640
     attcgatttg tcgctcccca gaatgtgttt ccactatcca gccttggtga ttggcatttc    230700
     gacgcacttg agacacgcga gtccgaagac gaacaggtcc ctatattcta gttgtaataa    230760
     agaagacaca gtaatttgct acggtatcaa aggctcttgg gttgtatggg atagactttc    230820
     aaactccgag gtcatccaca cacaaactgg gactttgttc cttggcttcg atatccttct    230880
     catattgtgc atggggacct aatcaagttt tacggaattt atggagttta tggagccaca    230940
     attgagcatt tacattcaaa ctatctcgat gtttcacata actcgttcga ccgaggctca    231000
     cttttgtgga ctctaaactg gtatcgcgct cgcgagaacc aatcaatcga tccatatact    231060
     agagctatgc catagataac cgtgatataa ttcatgtctt taggaataag tgtctgttta    231120
     gtgtgtttga aagacttggt gggagacgta cttgatgggg tgacgggcat cacatatggg    231180
     aacgaataca tgatgaccgt aaaactgcag aaaaccaccg ttatgacctt ggaaaccacg    231240
     cctatgattc cgagattgaa cggtccacgt ggctgatttt tgcctctcca gatcgagctg    231300
     atcattgggg ccagatacgt cagatatggg aatacaatga cgccagttat cagacttgtt    231360
     gatttggtca gtcagttcga acattacgca aaagcgttgg agaaccttac ctattgaaag    231420
     cagtgctgga cgcaatgtaa atgagcccaa tcgcaaacac tatgcacaca gaaagtatgt    231480
     gagctcggag tggaacgtgt gttgaaggat caatatggga ccagtatttt gaaaagggca    231540
     ttccattatc ccgacagaaa gcccaacaca tccgagcttg gtaggcatgt tgcggaaaga    231600
     gagagcagat gtaagagatg gtcacaaacg ccatggttgc caatgccgct gactggcggt    231660
     tcccatacgt aacgtagaaa agctgaagaa tgggaacatt ggttgggcta ttgacgacgc    231720
     tctcaaagtc ggttaggcag tacatcaaga cgcatgcaaa cggaaaggca gtcacaaatc    231780
     ctataaagac tgtcatcatg attgccttgg ggacatttcg tgcaggatcc ggtgtttcct    231840
     ctgcgagatg tgccgcgcta tcaagtacag cgaatgagaa gttggcgttg atcaacccca    231900
     caataaatgc catgccatcg gaagaccagc cattgcttcg ttctaaggta ccgaatatga    231960
     atttggcatc agtgtgatca accgcagtgg caggaaggac aattgtgatg agaacgcagg    232020
     tcagaagact gatgacaagt cccacaagaa cgctcttggt gacagccttc tcccatatgt    232080
     ttaccaagcc ggcaacaagg ttaagggcaa cagctccaag ataaacacgc catgccgaca    232140
     gtgcactgga agatttgtta gaccatgatt gcggagtccg agagtattgg attgtgcggg    232200
     gaaaagaaag aagccaaact cacaaggccg gtacagcgag cttaacggat ccaaagataa    232260
     acatactgac agcgattgaa gaactcgctg ttgtgcaata tgcggcaaat aaattgcata    232320
     cgcctgtaat gtaggcaaat gaccgggcgt acttgcgcgg agccagtctc attgcccaat    232380
     agtattgtcc tccggaattg ggcatcgcac tgattaattc actcaacgag attccgacaa    232440
     agaggttgag gataaacatg aggatcagac cgtaaatgat tccagcagag cccgctgcgg    232500
     tgattcccgt agtaaatgct cccgccaccc ccaaccatga gtttgtcaga gtatatgcgc    232560
     tgccgatcaa ctgtatcaga ctaaactctc gtttcatctg aggcacgtag cccatctcta    232620
     gcatgtgatg tcagtgcagt gcttagtttg aatggtccat tctgtcagaa tgaagtggat    232680
     ctggcatacc ctcaaggtca aggtcatcca tggcgccagc taccggttca ggatctgcta    232740
     ctatcatcgg gtcatcggta atcttcttct ctggggtaag aggaacaggt ttggccatgt    232800
     tgtcgtgggt ttttttaacc ccgaatgctg tggacgtcgc gtcaagagaa ggatgtaaat    232860
     aggtatattg gctcagttga cagatgatac ctccggaatt tcacaggtta gggatgttat    232920
     ctttcgctct ggatgccatg gaatttcccg atgtatagga gcacaatcag tggaatattg    232980
     tgaattgggc ttcatatgta ggacatcaag aagccaactt atatataatg atttcataca    233040
     tttactgata tcatgtccac gggtagtcca tactccgtaa tcagtaatcc gtgcccaggt    233100
     ccactaagaa ggttccaaag atccggttgc ggggaaactt aaaatggcga agataagacg    233160
     aaacaactct cgcttccatt cccaatatgg aatacgtgaa gcttaaaagg gtaagcgtct    233220
     atgaagctat agagcttgcc taacactaat agtgctaaac taggacccat ggatttggac    233280
     tatattttca gtaattccgg agcccgtatc gacgcccaaa acggcaattt ttgagtgtca    233340
     gtaggtgtcc gacacggttg gctaaatatg ccgaatgtgg agtgaacggt gttactatcg    233400
     ttacctaggc tatagcccct ctccactcgc ctattggtgg ccttggtcgg cgatttgcgt    233460
     tatagacgac tagactagac cttgccaacc ccgtgggacc aaaagggctc tagtcctata    233520
     tcctgaccct gttaccctaa tagccccata ggggccccat agtgagttag taagtaaata    233580
     gatagaagga agttatttat acgctagata aggtaagtca attatagcct tcgatgactt    233640
     ttatctaaca ccaaaggcat accagttctg gtttgcagcc cttccgatga ttcaacccgt    233700
     ttacaaattg ggaacacttc aagatttcaa attcattcgt atatgcaaga atacgtcctc    233760
     cagcttctct aacgacgaaa attcacagct tactaggaat aggcgtttct gcaggtttcg    233820
     ggagctcggt caaatattcc tgtacgtatt ccgacacctg ttggccaagg ccaaagctga    233880
     aggtataccc accggcttcc tgtccatagg catgtataac cttctgccca tgaagcactt    233940
     gcttctcgac ccgaacgcca ccattttggc tctcaataat ggggaaaaca ccaacatggt    234000
     ccgtaatgat gtcgtattcg agggggttgg gtgaagggaa tacatctggc tgattatggt    234060
     gctgacgttg cagaatctaa gattatgcct gtaagtacgc aaccttagac cataatataa    234120
     gaggcaagac caacctcttt tcgctgatct tcataggaag cgaaatcggt atcaccaagg    234180
     gatttaatcc cgcccatata gatcgtgcca tctccacgcg cgaatgccgt ggagtagtat    234240
     ccatccgggc cacggcggat ataacaccgg ttgtaaccat ccttgcggag tctgatattc    234300
     tgctgccgca cgggagtgat gcgcttctcc tcaacatcaa gcagcttcat agctccgaac    234360
     ccagtagcgt tgatcagaac gtcgtgtccc atgcctctca gatcccgcaa ggatttgaca    234420
     taggtacgct ggaatctcac gccctgcttc tccaagtgct gtcggaacca ggataggaac    234480
     gtagggggtg taatgacgag agtctggaag gccatgccaa atttcgcacc cttggggagt    234540
     tctgaaggag acaggaagcg aaagccagga accttccctt ggtaccatac tttcgctgga    234600
     tcaccgatat ccatgatctc ggtcatttca atttggcgga tgccggattc cgggtgtcgc    234660
     tctgcgattc gccagagctc ggaaaaggag ttcagctgca ttccctgctc ccacggggtc    234720
     gaatcgtgaa cgccgagcca gatggcgcct gcccattgac tgacataacg ttggtccatc    234780
     gcatcaccag gcaaaaagtc accaaggatt gtaatctcag tgttcttggg caattgactc    234840
     gcaataccca tgccggtaat tctaatgata aaattcatta gcgtgtcttc cgtcatagcg    234900
     aagtagtaga tcatacccag ctcccaaaat tgttattttc gacattttgg caaggcgtag    234960
     tgctgtcttg gaagaatcaa gtattcgaga gttagaaaaa gtctccttcg gctgaagggt    235020
     ggcttttatt agaggcacag atcgtgcagt agaccttggt caacagggag acccacttga    235080
     ggtggacgct ctccggatta ccaagtccct ggggagttct aactgccttc tccgaagcaa    235140
     gaatcaggtg gtgctaaaca aaacggcgat acctccactt tcagctatgg ccattttgtt    235200
     ctcgcggtag gtgggttgag acgccagtgc gagcggggac aagattgtct ctctcataca    235260
     tctgctgcat accgcattgg gaacataagc gggctgagtg gatctactgt ttgatattgg    235320
     accccgcggc gtatctctcg gcgaatgtcc tattaggtat acggatagag tcatcgctta    235380
     ctgtatttgt taggaatgtg ccttgagtta caatccttcg cgtggacgac tgatctgacc    235440
     ggcagacaaa caaaatacca agcaggcttg atggcttagc gtgcagcgta ggtagctgtt    235500
     catttcctaa tctgaagtca aagcgaagcc ggaaaatgag agatgcctca actggagagg    235560
     cgctgtccaa gctattccag ggtttatgta tgttgtataa aacatctttc ctcgagaata    235620
     cattttcatt ctaccaacag ttgacatcag tcagttaccc ggtacggaat gacccgaagc    235680
     tctatactat cgaaccattg ctaataggca ctcaaagaac aaccagaaat cgttgttcgc    235740
     atcatgccgc gcggtcaagg aaacgaaacc ggttcttcag aaccccatac tgtcccctac    235800
     ggctcctgga aatcttttcc cgagcaaccg ttccccatgt atgcaggaac caagtcgatc    235860
     atctataggt ccactgacgg caaggtggtc gtgggaatgt tgcgtgaaaa gggaaaagat    235920
     acactggtat ggccagttga tgaattcctt ttcgtcactc aaggaacgat ccatatcgaa    235980
     gtgcacggcg gcgagacctt tacactcggc aagggtgatc tgatggtgat gaaaaagggc    236040
     cagacaatca cgtttgagtg tagcgaagac tttgcaaatg ttgccgtctt catggatcta    236100
     gaggacaagg tcacgctggt atgagctgca gacagacatc tctagtgaac atccgaaaac    236160
     ttctttatgt gtcgtatgtt ggctattttg agcgaccttc ggggcagtat gttgtaagag    236220
     gtttacctag ccaattcgca ggcgccactg cttgaccagc atgagatcta gccaggtaat    236280
     ttcaatccca gagtcatgta aattccatag ctcttggagc agttcgatta cccacagtgt    236340
     cggtggaatg cggttcgtgg aatagacaac ctgaagctgc tctatcaccc gctcacgcag    236400
     ctcagtatcg gttgattcta gttcagctgc agcactcagc aatggaagtg tgtgcaagtt    236460
     tacgtatggc gagttaatcg gtgttataaa caacatttcc agagtccgta acgccagcgc    236520
     tcggatagga catttgctcg ccccttcctc gctgtccgtt tccacctcca atgcgaaatg    236580
     aactgtccgg ccacataaac gataaagcat cagaaggccg tggttgcgga aggcctcggc    236640
     cagcaggtat gcaaattggt tctcttcagc cgaagtgtag gagttcagtt cagcctcgaa    236700
     agtcgtctcg cgtacgaagt ctcttggcat accgtcggca attgaacgac aatatcggcc    236760
     gagttgcccg agcaaaaagt agagatcaat ggagtgagat gtgatggtat gaaagcgcga    236820
     gcgtgcggtt gtaacatacg cagccagccg acttcgagat acctgggtgt gatctgctat    236880
     gtccaggcaa aaggaacagg ccatatccca ataaacatag aaacccattg agagatgcac    236940
     caaatcatcg tccaccctgt cctgctgctc taaggtcatt tcaacagaag cctgggcggc    237000
     tagtagatgc tcccgcccat agtccgtggg ctgagtagtg atccaagagg aggacatacc    237060
     cagcatgagg atgacaagga aacagagagg cgagcttaag ctttgagact gcagttcctg    237120
     gcgaagattc cgtaaagcct tgctccgctc ctctaaactg gcagtcatat gcgagggctg    237180
     gaaatgttgt tcatgagcgg cactaacgca ctggatgaca tagacgagtg aatttgaggc    237240
     agacaaatac ttgacaatgg gaaaagacat cggatttcgg tcccggtcga gactcataat    237300
     ttgagacata cgctcaaacc agtactgaag caggcgcaag ttcacatccg catcgaagtt    237360
     tattggctgg gtaagctgcg ataaggggtc cgctgtacct agacaccaga cctccggctg    237420
     ccattgagag gcaggaagca cgggttgaca gatggagcct cggcgacgac atcgcaagca    237480
     aaccggaaag gtctcatcgc acttgacacg cctttggcga cagcctcgac aacctgatcg    237540
     ggtgcgagta tgagttggct tggtctcagt ttcattcggt acggctgtgc ttgtctcatt    237600
     ctggtccgtg tggtaggccc gctggggcgc gaagcgcact cgaaaggatg gcatcaggac    237660
     gattagtgga gcaaagagaa gaagacaaag cacgggagca agagcaaggg gttaggaagg    237720
     tgaagaagtc caaggaaata gcaaggaaat tggccctaat gcgtatcagg cgtttgtcat    237780
     atcttggccc caaaagggta cccccgcaca cgcggggaga ttgttacaat ggaaataata    237840
     aaaagtgggg agtttgaaaa aggaggaaag aaagaaaaag aaaaagaaaa agaaaaagga    237900
     aataaaaata aaaagaaaag aaaactatat ttttgtccgc gtatcgagac ggttgggaga    237960
     taccagaacc cagctcactt gtgcaacgaa accttactgg gacagagctt aatggaaaac    238020
     cttggaatgc ggggttgcgg tagagccatg gatcgatcca tggatggatc agaaggtata    238080
     ccaatcgccc gtcattaccc gtttatcttc aactgttcca aggttgtact ccgggagaaa    238140
     tatcccggcc agaacggcct atggcgtgtg tcgggatgcg ccgcgcttga ggttcggctc    238200
     ccctctcgct aaatcgctca atcgggtaaa aagcactcag tgaaagtcta gctgatatgg    238260
     gtacctgggt acatatgtag gtttagataa gaagaaaaca aaataaaata ttgtagatta    238320
     atttgatttt tatgacactt gctgtttcca aagttgactg cttcacaatt acttaaaccc    238380
     ttaccgattc cagattcaac gttggcattg cttatcgtcg ccacttcact ttaccccttc    238440
     aattgccgaa ggagctcttt ccttgccgtc atggattccc ccctatccac gatcgtggag    238500
     gacctaccca tcagcagacg ccaatttgac tatatcattg ttggcggggg gacggctggc    238560
     tgtgtcattg cagacagagt cgccgagaat ttgcccaatg ccaccattct catgatcgaa    238620
     ggcggcgaaa gcgagctggg caaggaggaa attctcaacc tcaatggcgc cgctgacctt    238680
     tggggttccg acatgtatga ttattcatac cgttctgttc cacagcccta tggtacgaat    238740
     acgccccgcc cccaatctga ctgcagaaaa ataaggtgaa ctggcgagta acacgaggaa    238800
     tttgtaggaa acagcaatat catccactcc cgtgccaaga tgctgggtgg ctgttctagc    238860
     cataatggcg cgatttcgtt tgctccactc gcatatgact gtaagaggtg gcaagatcta    238920
     ggcgctgaga actggacaca cgcagaaatg ctgcgtctag tgcgcaagct ccgcaacaat    238980
     atcataccgg tcgacgaacg ccatcgcagt cagttggtca aggactggtt aaaaacctgc    239040
     tccgaattgt ttggagtacc ccacatcgac gatttcaacc gtgagataga agagcgcggc    239100
     aacctcacga cgggatgtgg ctttctcagt atggcctaca caccggagaa taatcaccgg    239160
     agcagtgcta gtgtcgcgta cattcaccca atccttcgcg gcgaagtcaa gcggccgaac    239220
     ttgaccatcc tacagaacac atgggtctcg cgaattctgt tccaaggaac cactgctaca    239280
     ggtgtcaccg caacaaccaa agctgggcat gagtactcgc ttgtggcaac gtctgaaacg    239340
     gtactgtgtg ccggggctat cgatactcca cgtctgatgc tgctttctgg ccttggtccg    239400
     cgtgaacagt tggccaccca tcaaataccc cttgtccacg atatccccgg tgttggagag    239460
     aacctgcaag accacgccga gacaatgtat atgtgggagt tgcatgaggc tgttccaccc    239520
     gaacaagtcg ccatgggctc cgagggagtc atggtgttac gccgtgagga catcaacgct    239580
     cgcggcgacg acaatgacgt tatggattct ctcttccaca tgttcaccgt tccctttgac    239640
     acctatacta agcctatggg ctacgaatca cccaagaacg ccttttgcgt tattccatat    239700
     acgcctcgac ctgcctcggt tggccgtcta tggctgaagt cagccaatcc gaaggacaaa    239760
     ccgatgctcg accagcgcta tttcagcgat ttggagggat atgacaaggc tagcaacctc    239820
     ttcatgctaa agatggcgcg ccgtatggcc caggcagagc ccttcaaaaa gtatatcaag    239880
     cgtgaaattg ccccaggagc tcacattacc tccgatgagg acctttgtga atacggtcgg    239940
     aaggtccaca ataccgtcta ccacccatgt ggcactgcaa agatggggaa tgtcgagacc    240000
     gatcgcatgg cggttgttga tccatctctt aaggtgaggg gagtcaagca tcttcgcgtt    240060
     gcggatgcca gtgtattccc ttgcatgact tcgatcaatc ctatgatcac tgtcttggcg    240120
     attggtgaac gagctgccga gctcatcatc aaggatgctt gccggacgga acgagctgta    240180
     ctttgactgc tgtccgatac tttgactgcc gcccgattgt cacatacttg ttccatttta    240240
     ttgagtatat atgcagccaa gttttctagt cagatttcac gtcattagca tgtaagtagt    240300
     ccataggtta cttatgatag atacattcat aacccgaaaa agtaataaac tatgtcagcc    240360
     ttaacaattc atccagttat tccttctaca ggagcatctg ttgcagatac aatgtgatct    240420
     tactgaaaat tcccgggaca ctgcaaaaca gaaacaatgt aaggtaaaat gagtctcaga    240480
     atcaagagtt agttatcatg tacattcgtc aatttagtaa atatggttga ggcacataga    240540
     gaacatcaac caaggcttaa cctccatcct cgtaggagca tgatgtgtac ccatgagatg    240600
     gtgatttcaa agtcacgggc ttgccaaaca tcttgcagga tgtcaatcgc catcaattta    240660
     ccaggtaggc ggttgattga atacaaagca gtaaaacggt caaccaccat atcacgttcc    240720
     cggtgatcat ctgccgtaag ctcagatcct gcagtaagaa gagaaattgc ctgcatattc    240780
     gtatgccagt tatgggtggg gatgaggctc aagtctttga ctgtctgtag agcgtattgc    240840
     ctgatgacct tctctgtttc aatgttgtcg acaggtgagt gattacccat gtctaagtct    240900
     tccccaattc gacaacctgt ccgtccgcaa attcggtata gattgatcag gccatggttt    240960
     cggaaagaac tacccagcag aatgagttct gtatttttgg tagttggtcg ccacgccagc    241020
     aaccgtgttt cgaattcttc ctccagcgct ttgtctctga tcccgagatc aatgaatgac    241080
     ctgcaatacc gccctagatt tgctagagtg tacatgatct cagccgagta gcccataatc    241140
     gggtgaaagt cccccgcaat ctttgccact gcttccggaa tcgacgagct gattgtggac    241200
     tgttgatttg ggtccacaag gaatgagcac gccatatccc agtataaata tgtaccaaga    241260
     gctaactgtg cgaatttgct gtcggtgttt gtcgatggat ttagaatcag ctcaattaaa    241320
     gcccttgctc cattcaggtg ctcatacccg aattgggaag acgagggatc aatccagggg    241380
     gtgctaattc caagcatgaa gacagtcata aatgtaattg gatgtggctg ttggcgtcca    241440
     cccaactcct tttgcaaaag caacagcgct ttacctcgct cctcaagaca cgtctcaagg    241500
     caatcctttt tgaaaaaccg ttcatgggca gcactgatgc tcagaatagt tggcatgaga    241560
     gaaggggaaa tgtgcagata ttcaaggatt gggaacgaga aagggttgga ttccgggtcc    241620
     aaaaccatga tctggctagc tttctcacac cagtgcctca gtaggcgcac ttgggaaggc    241680
     gaggtgatgt cggatagaat cagcggagaa atctccaact gccattgtgg caaggagctt    241740
     tctgactcgc acaccgtgcc tcgtttctgg catcggagac aaacggggaa ggtctcatcg    241800
     catttgaccc gtcgtttctt gcagttcttg cagccagaac gacttctttg gggtggagtg    241860
     cctatctcgg aatattgaca ctggtcacag gcgataggct tttggacaga cacttgcgtg    241920
     gtcggggcga atcggacgtt aaatctgcgt ggcatttcgc ggcagtgcga cagttcgagg    241980
     ggaaatggga gtccgaggct gagaatacta agtcactcct tgaaaagtag gcctgtgata    242040
     tgtgatcctc tctattggcg aaagatagct tcgttcccca ttagaaataa aggtgtttag    242100
     ctcggggata ccgatcatcg cgcatgacct tgatagatgt tcaaatgtgt caaatggttt    242160
     gtgttccccg catccgatac gtaaatggaa atgcctaatg gctatctggc ctggaacaga    242220
     ccgtaccgtt gatcttgata caatctccgg gtccagcgtg gccgacagcc atacctcgtc    242280
     tatgctgaat ggggaatgcg gagtgataag aaaccccata gacccgagcc ccacctctcg    242340
     cgtttaggcc gaaataggca acattaggtc agtcttgtta ataaagcatt ggtggcaaac    242400
     catctaatca gaataatcta gaaagtaatt tgttttggga gccagccatg tgatgtgcaa    242460
     agaaaccaaa ctccttgtga cactcggtat ttctagtcag atccaccctc aactttccga    242520
     atgaggagtg gacgcgatga tgaggccgag catggcaaat atcattcata gtggatgtcg    242580
     ttataagatg agagttggag tgatctagat accctcgaac cgtcaggtca ttctcgcaat    242640
     atatccccaa ccacacttct tgtctgacac ctgagacatg ccggacacca tcaatatgga    242700
     cgcacttgtt gtcggcgccg gcgtgggagg aatttactcc acgtaccgcc tgtcgcgtat    242760
     ggggctgtct gtcaaatgtg tggacgttgc cagcgacgtt ggtggcacct ggtattggaa    242820
     tagatatccc ggtgccatga gtgacaccga aagctacctt taccgttatt catgggacaa    242880
     agaagacctg caaacctacc cctggtctca tcactatgtc taccaaccgg agatcttgaa    242940
     gtacctccag catgtcgtcg agaaacatga tctccggaag tacatgaagt tcgagaccga    243000
     gatgacatcg gccacatgga atgaggacac tcaaagatgg attgtgacct gctccggctc    243060
     cgaagagtgg aatatcagcg ctcgctactt ggttaactct cttggattgc tctccaaaat    243120
     tcattacccc gatatccgtg gtctttcgtc tttcgctggt gacctgatcc atacagcacg    243180
     atggccggaa gacttgaacc ttgaaggaaa aagggtcggc atcattggaa atggatctac    243240
     cggaatacaa gttatgacag cacttgctcc aatcgttgaa agcctgacct ccttccaacg    243300
     ccaccctcaa tactcagttc cgagtggcca gcgccccgtc acaaaagaat atcgcgacaa    243360
     ggtcaatgct acctacgaac aaatatggga tggtgtttgg tcatcgactg ttggttttgg    243420
     tgtggttgaa tccaaacgca atactatgga tgctagcccc gaggagcggc agaaagcttt    243480
     ccaggaggtc tgggaacaag gcaatggctt ccgctttatg ttcagcgctt ttggagacat    243540
     taccaccaac aaggctgcca acgaagaggc gtgcaaattc atccgtggca aaattgacga    243600
     ggtggtgaaa tatccccgca aggcagcaat cctgaagcca aaggacctat atgctcgtcg    243660
     accactttgt gacaccggct actatgagat tttcaatcgt gagaatgttg acgtgatcga    243720
     tctcaaggaa tcaccgatcg atcagattgt tccggaaggc attcggacca ctgacgggac    243780
     aacccatcat ctcgacgcgc taattttcgc tactgggttt gatgccattg aaggcaacta    243840
     catgcgggtc aagatctcag gacggaacgg aaagacgatc caagagcatt ggaagaacgg    243900
     tcctaaggct tttggtagta tcgcctgcgc aggtttcccc aatatgttta ttgttgccgg    243960
     tcctcaaggt ccatttgcca atttcccacc tgtcattgaa agtgaaatta acttcatcat    244020
     gtcatgcatt gaatatgccg aagaaaatat tgtcgcggct caggtggacg aaccaaatag    244080
     ggctgccaat ggtacttcca atggggctgc caacgggact tccagtggca cttccaatgc    244140
     cactgcgaat ggtgctttga aaacaaatga atcttacgca aggaaaggga agccaacgat    244200
     catggaggtg tcggataaag cagaaacaga atggatcgac ttgtgcaacc gactgattga    244260
     agggtcattg ttcactacga cggcaagttg gatctttggc cagaatatcc ccgggcggaa    244320
     accaagcacg aacttctatt ttgggggcct taagagctac ttggactggg tgaaatttca    244380
     aacttccaat gggttccctg gttttcttgg ataaatacga ttagtcaatt tcagtgtact    244440
     tacttctggc agcataagtt atcacgaatg aatatgtaac aatgttgacg gtaactgctg    244500
     ctttgggtta cgatcggctc ccagatcgca gggtgactct gtcacctgcg tacggcatag    244560
     cttagggcgg cgatctttac agcagtcttt tcagatagca aaggtacggc tgccctccgc    244620
     ccccttaccc ccacccgttt tcggtcacaa actgtgcggg ccatgatagt tatctagact    244680
     tctagaagaa acacaagggc caggatctag acgggttgag aaagaagcca gtatattgaa    244740
     gcaaaagaga agatttttgt ttcccatttg ttgggaagga aggggaggcg gaggcgaagc    244800
     agcaaaaaag gttcggaatg ggacgggccg gctcttggac cttcatttag cgaggtatgt    244860
     gatccggaat cggaaggcgg cgatctttgg gatgtctatg aaacgagcgc ccattcagtc    244920
     aatattctca tcctacaaac atacatacag tcaatgaata tatctttggc tccatgggcc    244980
     cttccacttt cttcggaaaa atctgctttg aacaagcaga gcgagcacgc aagtcgagaa    245040
     agaagtggcc cacggttcaa taggcagtca cgaccgaggg gagcgccacg cacttcagaa    245100
     ctgtttattt ggcggattct gtggtttctc ctactgcaag tttgctgctt taattcctcg    245160
     gttagccgag gcgccctata attcttctta tatccattac ttgcagggat cgactacaga    245220
     cctcagacct cttgagtcct cgactgacgc tcttttttta ccttacctgt tcacttggac    245280
     tattaacagc agatttacca agggtacgag ctcgaaagca gctactctcg cacgacctcc    245340
     ttgtagcgtt tatcgaagct aagagtaaca cggtgggaca ttttaatact ggaaaagccc    245400
     cgaacaactt gcaaatttgg ctgccaaatt atagtggaga tttttggaca ttgttaaatt    245460
     gactcctatg tgttgacatg catacataca tggatgcgat gcgggcaggg tatgggtttg    245520
     tctctgtgca gactgagcat ttgcctagtt cgtcgcgttt gtcattctcg aggaatcata    245580
     tacagcctcc tttccataga tttatatcac gtttttcttc ctccttcatc accctggtag    245640
     catgtagcct tatgactatg ccatgaaatc agatatcaaa atacccaaaa gttcagcctt    245700
     ttgcgaaacc tacccttcct tttcaagcct tcgccgaagg tgataagcgt aacccgccaa    245760
     cgtcagtatc cccgccgcaa tgaaaaatgc catgtagtga aatctcagga tgcaagcctc    245820
     ctcagagttt caatggccgc acacagtcag agagccaaag agaatagcca ggagtgccag    245880
     gatggttctg ttccagtaaa tttaataacc atcagcacgg gatgtagtta ttgctttctt    245940
     tacgagaagc ttggcaatag gtgccacaag ttattttaca atgaggttat cgggatagga    246000
     gtccaccaac taacacgaga ggtgaagtag gtagctcatc ctacggctgg cttttcgtag    246060
     aggagtcgcg ggatggaata gaggttttca aggatgctcc tttctccata ttgacaagaa    246120
     ggatgtacgg aaacggagag gcacgtcgga aaactgtcga gggacttgga tatatgacga    246180
     tggaggctga aggatttttg ccaaatgcac aactctcaag ttggaatttc tactcagaac    246240
     aaagttgtac gtagataatc gaataatcga attacagcac tggcatggtt gtgtcatcag    246300
     cgaggctcag ttccgagaac ctctacattg aaagcaaacg ggttgtcatc ggaggttgta    246360
     taggtctcta actcgccaca atggatattt ttgtaatgat gtatcttcca aggttcgcta    246420
     gtcgagaagc acctcacttt ggcatattcg acacatgtgg gttttcatac atgtcttctt    246480
     ttggggttca atgtaattgg taatccaaga gcctgaaaga ttccattggt cctgaggagt    246540
     catgaagttc ggatgtctgc tgaatcgggc aactggaagt ggatcaactg ccgtaatagt    246600
     gaggggtcta ttcccgttgt cctttctatc cttcctctat ataatgtctg taagtccaag    246660
     tcagagtccg gaccagccgc atatatttac tccttcttgc cttacctcaa aaagtctctt    246720
     gaaagtccgc atcccctgac ctcctgaaaa agcccctcat agctgactat ataaacagga    246780
     atgacaccgt caattcccaa caccaccgga tcagaatcgc cagccgatgt cccctacggg    246840
     ccgtacacca gttttccttg ggagcctctg cccgagtacg gtggggagaa atccgtcatg    246900
     tatcgttcag ccgatggaaa agtcgtcgcg gcagcagcaa aggaaacagg aactgcaaca    246960
     ttgacctatc cgtgtgacga atccttttat gtcacggatg gatgggtcag actcaacgtt    247020
     catggtgggg atcacttcgt cctgaccaag ggagaattcg tgtacttgaa gaaggggacg    247080
     acggttgatt tcacatttgg tcccgggttt gcgaacgtcg cggtcttcat ggatagtgaa    247140
     cctgtaaccc ttctctaaca aaggggatta aattatagtg ttgaaggcta tatagttttg    247200
     ctataattcg gaaagtgaat attgtatttg catgtggttc ttacgaatcc tgtcgtatct    247260
     acaaatgaaa aatgtgtatg caatagaatg agtgacatgg tgctagataa taatacgcaa    247320
     aagctgtatg aaagagtggg taggtttcca tcttgcaaaa gacgatgttt ggaatttcag    247380
     agcgctaaaa tcacttattc agctttcgaa atctgaaaag acctgcaggt ctactatggc    247440
     agaagagaga ggaatagaaa cgttgaattc acatgaaatg accaagccca ctgcccacct    247500
     atatgggcca gacaaaggaa aacagcctac aaaactcctc cgagctccga gcatctgtat    247560
     cagagcattt gatcttccat aagaagacat gtggtgttga tttctgaaat ttcaagccga    247620
     agtgtcgccg gcgtaaggcg ctgcatgaaa tttaacctcg agtcgatgac cttttggtcc    247680
     tgcaaggtaa aagtcgagca agtccatatc gccgtgagca tggatagacg tggtataatg    247740
     ggcataaaca gcagcaacca aatatttcat cgctagccac cagattttgg ttagtgtggt    247800
     cctcgatttc agatcccaaa gacttacaat aatatgcaaa attggaacct atacacattc    247860
     tgggcccact gctaaatgcc caaaaccatc gcttcatatt tgcgagctcg tcaggtgaag    247920
     catcaagcca acgctgaggc ttccattgga aggggtctgg gaaaacttcg ggggtccgat    247980
     gaagtatgta tgcatatgac tgaacaatgg tgcctgctgg gatatcagag tatccaccaa    248040
     gggagcaagt ttttggaacc actctaggct gtccgccagg tactgccggc cagagacgaa    248100
     gtgtctccat aatgatcgca tggagaactg ggagggcgtc aattgctttc ggctcggcaa    248160
     tgtcatcgac ttcgaccttt cttttcaagt catcttgttg tggaagcttt acaccacgca    248220
     gctcctcgcg aagctttgtc tgccactccg gatttcggca catctcatag aaaagatagg    248280
     tttcggtgtt gccgctagtc tcaaatgcag ccgagctgtg ggcaaacatg tcgcttgcga    248340
     tctgcatcct ttgaggatat gcacttttgg taccattggg gtcgctcatt gactggagag    248400
     cttgctggaa gataacaggc tggtcatcgc tatggatcgg ctcggagctt gcaatgagct    248460
     gttgggcact gtcgcatttt tggagattcc agtcttcggc agccccaaat ttcgtgtcaa    248520
     cagatcgagg gatcaaataa attccaatct tgcgaaggaa atttgcaagt tttggaaagt    248580
     agtactgcca aaagagaaac ggataaggtg cgaaaaatcc gtcgaggtat agcttccgct    248640
     ctttgtgatc ctctagcaaa ttgctaccca aggaacggcc gaattgaaat tgaacgaaag    248700
     tatccattga gtatgaataa ttcattccaa gtacctcgac aggcttgtct tcaccagagg    248760
     cttttcggat tagaggcagg tatctaccaa ataagacatc gcgagtggct gcacgtgctg    248820
     tcggagacaa tgagatgaaa gacttggaga aagtgttgga gatcatcctt ttgcgggcgg    248880
     aatgtagggc attgtcttca aacgtgggaa tgttctctgt gctgttgaga attagctgct    248940
     ttattccaca cttgagacca tccacataaa ttgtatccat ggcatcgtct gggttgattt    249000
     tgtgtgtaaa cttacttata aatagcaaaa ccattaaagt agaagtcagg tttaggaaaa    249060
     ccaccctgat atataggttt caccccatca tcaaaggtgt ttatactgag aaggctcggc    249120
     ccaagaagaa gggagggccc cagtttcatg tgcttgtcat aaaccgtgcg gttctcctga    249180
     ttagtccatc ttaaccagta tatccagatc gaacagaacc ggcatgacca gtgagccgcg    249240
     ggcacttttg aaagaggaga aagaaggact ggatatatga ggaatttgtg aaggatgaca    249300
     ccaagaatac cgacaaaagg tagaaaggaa atatgaagct gcattttgca gacctttccg    249360
     gctgatgtga ggaaatattg atttagagta cataggtgcg ctgtcgagtg ttatatattt    249420
     tctaatgaat agcagcatat catccaactt gaagcttcta tgccttattt cgctatccct    249480
     cccaagttgg aaagggggtc aatagaacct ataatggcat cgtgtcgagg tcaagcttag    249540
     aaagaaaaag caacaatttt agaaatctgg tcttttccag gctaaaagta aaaatcggtg    249600
     acagacgatc atgcagtctt ctccagggct cctccggatt tcctatttag gcctgtgggg    249660
     gcctcagcac tttcccgatt aggccgctaa gcgggaatga agagaagtcc ggaattcgcg    249720
     taggaaaaga atgagacgat ttatggtcta ccgtctatgt tgtagggctg tttggaattg    249780
     tgagcaggac tcaattggaa tgctttagaa aaaggagaag ataaaaaaag tggttgttgc    249840
     acctggtagt ttaaagagcg gaaaattata tacattgttg agatatgcaa taactttcta    249900
     atgatttttc aaattacaaa aagcttctct ccaactgtag agcttgaaat cgggtagtac    249960
     aacgcatcaa tgttttataa cctcgcgttc aaattgatgt gaacagactt cgtaatagtg    250020
     aacgcctcga taccttcctc gcccatctcc cgcccaaacc ctgattgttt gtatccacca    250080
     aatggcacgc gcacatcgtc atcattgcta ctgttgatcc atatcgctag aaaaagaaaa    250140
     acacgttaac actctagaga accgaaaaat aacggaagac tcactgccag actggattct    250200
     cttcgatacc ctcaaagcac gcgagatgtc ctttgtgaag acggatgcac ctaacccaaa    250260
     gaccgtgctg ttcgcgcgtt tgattgcctc tgactcttca tgaaaaggtg caataaccac    250320
     gaacggacca aaaacctcat cctgaacaat ggccatactg tctgttacgt ccgcaaatac    250380
     ggttggggcg acataaaatc ccttgcctct aacattcttg aatgcctttc caccacacac    250440
     taaccgtgct ccttcccgtt ttccagtctc catataagag agaactcggt caaactggtc    250500
     cctggtgacc tgtgggcctt ggaaggtgtc tgaatggaaa gggtcgccaa ccttggagat    250560
     tctttccact tctgctttga actgattgac aaagtcttcg tagatgtcag catgtacaaa    250620
     gatgcgactt gttgctgagc aaacttgtcc ctggttggac ataatgcctc ggtgacccca    250680
     gcgcacagct tgttctagat ctgcatctgg gaagaccagc attggcgatt tcccacctgt    250740
     ctccaacgta actctcttga gcgtactggc agcgttcttc ataatttgtt tgccagttgg    250800
     agtagaccca gtgaatgtaa tcatatcaat gtcggcatgc gctgctatag cagagccaac    250860
     ctccctaccg gtaccattga gcacattcac cactccagcc gggatcccag cttccttgac    250920
     aagatttgcg aagtagagag ctgaaagcgg ggtttgttcg gccgctttga cgatgagtgt    250980
     gttgcccgcc gctagggccg gagccacctt ggtcaccata ttcacgagag ggaagttcca    251040
     agggataatg gcgccacaaa ctccaatggg ctcacgcatc acatatgcca atttatctgc    251100
     attcgggtcg ataacctttc catggatttt atcagaccag ccagcgtaat accgcagtag    251160
     actgatagcc cccacaacat cttcgttccg cgcagcatgg taggtcttgc ctgtgataaa    251220
     aaaagatcat cagtatgcag gttagatgag gagagagagc gcgcagaata gaaaactctc    251280
     gtaccattat cccaggcatc aatggtggcc agtacatctg catgttgctc gatcaaccca    251340
     gcgagcttgt ataacagctc gccacgcaca gatgtgtcca gcgtccgcca ctccccattg    251400
     aatgcccgac gggcagcctc aacggccatg tcgacatcct tcgtgtctgc tgcatgcacc    251460
     gtacagattt cttcttcatt tctattgtat agcgagttag taatttatca gcaaatagaa    251520
     atctagactc acgcagggtt tatagttgga atccccatcc cccttgaaga tgatctccat    251580
     tcattgtcga tgaataggcc caaaggttgc ttgaacttta agccgttggg cgcgataagg    251640
     taaacgtgca agtcagacat agctagattt agtaacaaca gcaatgcagg caggtaattg    251700
     aaaggaagca ggaagcagga tggggaatca agaccctgct gtaatagagg tctcagctag    251760
     accttgggaa tgtccttctc acgtctgtgt ataataaaac aaaataaaat ggtgattcga    251820
     caaggctgaa ttaaatgtaa cataacataa tcttatatta aatggattat gaaaatgaag    251880
     caagaactca aaatatttac atctcgatgt gcctcttctt ctatctcgct tcctgtctcg    251940
     attaggaaac tagaatgtga tccccacatg aaccgagtac gtacgcgtta aagaagaatt    252000
     taacccaact ccactccccg gctgcctgat agagaagata ggcgatcagc aataaggcat    252060
     gtatacacga ggaagccagg taacggaagt ttttccgtag atacttcttt ctcatcattc    252120
     accgcatacc gcagtcgatt gtacttcacg gctttctgat gctttgtgac agttgcataa    252180
     tgacatcctt cccacatccc aatggcacgg tgcctttttg gcgccttgag cctcaggagc    252240
     ttgacaactt ccggtccacg ccagaccttc cagacgaaag cgacatagtt atcataggcg    252300
     gagggtatag tgcagcagca ctagtcacac atattcagaa acaatatccc aatcacccgt    252360
     cgattttggt tctcgaagct cgtcagctat gctctggggc atcggggcga aacggtaatg    252420
     gtccttctgt tcacttccat agacgaatca ctgacagact acttaataca tctaggtggg    252480
     cacatcaagc ccgatccata ccttcatgcc tctgggattg ctgctcagta cggactcgct    252540
     gcaggcgcgg aagtcgcgga tttcgaagtc gcaaacttga atgccgctaa agagtacatt    252600
     gaacgtgaag gcctcgactg cgatttcgtg gccaccggag catgcgatgt acacttcacc    252660
     agcagtcagg atacgaggat aaaaaagcgc ttgcgtgatc tcaaagccgc gggagttgcc    252720
     gcggcccaag cggtgtctga agtgggagag gacgatgccg aaattgtgtg ttaatctccc    252780
     atcccaccgc agtctcagga tcaatgacct gcaggtttct gacttgggtt caatactagg    252840
     tatcaggtgt aaagggggcc aagggatgcg tcagctacaa cgctgcacat ctatggccgt    252900
     acaaattgat ccaccacatg ttcaccatgg cgctgaaaca tggaggcctc aatctccaga    252960
     caaatacttg tgcgacttct gtcttccccg ctaccaactc gcaaagtagc tgggtgatcc    253020
     aaaccaaccg gggccctgtt aaagccagca aggttataat cgcctcaaat gcttacaccc    253080
     cggctttatt acctgagtat cgggagcaaa tcatccctta ccgggctgtg agctgtcgta    253140
     tcacaacacc tagcccagca ccacctattc tcaacaccta cgcccttcga ttcaaggatt    253200
     gggattttga ctatctcatt ccccgatctg acggcagcat tgttgtgggc ggggctcgct    253260
     ccgcctactt tcgcaagaag gacctgtggt acaataacac ggacgattct gaggttatcg    253320
     aagagacacg aaagtacttt gacggataca tgcaacgaca cttccgtggg tgggagaaca    253380
     gtggcgcaaa ggtctcggaa atatggactg gcagtaagta tcatcgacta ttcagcttca    253440
     agtctatctg actgacgcat cacactttta gtcatggggt attcccgtga caaactccca    253500
     aggctggggc ccgtaccagg caagcgagga atgttcatta tggctgggtg gacgggccac    253560
     ggcatgcctc aaatattcct ggcagccaag gggatggcaa aaatggtagt gaaggatgta    253620
     ccttactacg aaactgggtt gccccgtgct tttgaagaga ctgcggatcg cttacagaac    253680
     gcaccgaaca aagtgttgga gtcctggtac caggccactc aatccccgcg gctgtgatgg    253740
     cgtattgatc aacatgcatt tggtatgaat tctaccgagc agctaggatt atagaataca    253800
     aacacttgaa gtattctgcg ttgaagagcc ggagcaatgt aagactagac ctcgaggtag    253860
     cggatttgct ttgaatgcct tccgcttaac gctctggtcc aatcgggcag aatttttaac    253920
     ggaaacgagt atcatagttg ctttgccgtg gttagaggtc caactccagt cgcgtcccgt    253980
     aaccaagtgt ggctctgcgc aaaagtgttc tagcaagcta aaccccacgg tctctaaagc    254040
     tgtttctatg gcagcgacta taaaaaagcc ggtgacgtat actttagact tcgtaagtac    254100
     aggtactaat ggacatatta tgatattcat ggatgtttag cccaatattt cgaatgtccc    254160
     actgactccc cggtactcgc caaggagcca gaaggggaag gtccccgtga acgggtagta    254220
     gaggcacccg cttatagtca atgaatgaaa tactaacgac caacggagta ccgtgagctt    254280
     ccgaggtttc tcatcttctc tcggaaatcg gcgcaatgag ccaatctaaa ttgaagtagg    254340
     gcgattcttc acgttccaca tccgaaatcg acggactctg tgcatgggct tcttgctttt    254400
     tttggcatgt tggcgatctc cccgtgtcat cgcataactt ccaaggttga cactgctctg    254460
     atacccaagt aaacaatacg cctttgggca acctcgattg ctaatcatcc acttgatgga    254520
     atatgtattc tgcctgctga tacaaaaaca gacatgaact tctcgaatct tatgtccagg    254580
     gcttcatact tcctgttcaa catctgacgc accagactaa gttgcgtaat aaattatggc    254640
     tatcacaact gaattcccga tctctttgcg cgatcctaca ctgttggatt gtcggggcct    254700
     gataaacggc gagtggcgtc acgcgaccaa ccagaaaacc tttcctgtct atgagccagc    254760
     tacaggcagt gtgcttcacc aatgtgccga ctttgaacgt gaagagttcc ttcaagcaat    254820
     caatgcggca tacattggtt acaagaactt ttataacgac acaacagcca aggaccgggc    254880
     acagctgctt cggcgatggc atgatcttat aattgagaat gtggaagact gtcagttatg    254940
     agacgatcct cttacctcca attagtattg gaaagctgaa ttttttcatt caacagtggc    255000
     gatcatttta tctctagaga atgggaaaac gttggccgaa gccaaaggag aagtaaccta    255060
     tgcggcaacc ttcgtcgcct ggtttgctga agaggcagtt cgcaactatg gcgatgtgat    255120
     tccttcctca tatgcgcatt caaccgttct cacgtacaaa gaacctgttg gggtgtgtgg    255180
     aatcatcact ccgtggaatt tccctgctgc catgattact cgcaagatcg ctccagcatt    255240
     tgccgccggc tgttccgtgg tgattaagcc tccgagtgaa acacctttca gtgcaattgc    255300
     gctcgcaaag ctggcactca aggccggtgt tccctcttcg ctcatccacg ttatccccac    255360
     caaggaccgc aaagcttcac tagagctagc aagcaatccg cttgtgcgca agatcagctt    255420
     caccgggtca acagctgtcg gtaagatgct gacaagacta gcatctgaaa cgatgaagaa    255480
     agtcagtatg gagcttgggg ggaacgctcc ttttgtagtc ttcgaggatg ccgacctgaa    255540
     ccaggcggtt gatgcggcgc tgatctgcaa attccgcgca tcaggtcaga cttgcgtggt    255600
     aggcatatgc gctcattccc cccaaaacgc actgtgttaa ctcaataatc gtccaagtgt    255660
     gcgaatcggc tttatgtgca taaacaaatc gttaaggctt ttgccgagaa acttgccgcc    255720
     aaggtgcgga ctctcaagct aggccgtggt atcgacgatg gaacgactca aggtccgctg    255780
     gtcaacgctg cagccgtgga aaaggtgaag gcccacgttg cggatgcatt agccaaaggt    255840
     ggccagttgt ggacaggcgg acaggcacct agccatctgt ctggcttttt cttcgagcca    255900
     acaatcatca ctggcgcgac gtctgatatg actgtcgcaa ctgaggagac ctttgggccc    255960
     ctggcggcta tctttccgtt cgagagcgaa gaagatgtga tgatgcaggc caacgctagt    256020
     gaatatgggc tggctgggta cttcttcagt caggacgtca gtcgaatttt ccgcatagcg    256080
     cgtcagctgg aatgtggcat gatcggtgtc aatactggtc tgatcagcgc agcggaaagt    256140
     ccttttggtg gcatcaagga aagcggcgtg ggccgagagg gcagtcgtta cggcctcagc    256200
     gaataccaaa acatcaagtc ggttactatt ggaaatttgg gctgaggttc gcagctgagg    256260
     cttctgtgga ggcggcttta cctaggtaga caattcagaa cctatcgcag agccatttag    256320
     atgcatttcc attgagtcct agtaatctcc aacgccatct atactcggtg gacaatttca    256380
     tgctgaatgg ggcatttaca gtaattccat tttgtttctc ggagatgtca tctcacccta    256440
     tctgccagaa ctgtaaagta gaagtagcta gttgctcctc ttcctcttct tcttttgttg    256500
     gatgcctgag gccatcgcgc atgacgggat catgtaggaa gttctctccc tgctctctcc    256560
     ctgctctctc cccgtgagtg cttccttcgc tcgaaatgca tcgctacctt tctccatcct    256620
     tcttgcgggt cctattgccc tctctctctt tccccaagga cccattccat ttcatttgat    256680
     tcagaactca gaaaggaatc tccaaaacca gccctggagg ctttggggtc tactgctcca    256740
     ctactccgct actccacttc tccactacga tacttccaag gttatctcca acttgcccaa    256800
     tacggacact aaacgaactt catttctcct cacttacact tgcttatcac tcatttgagc    256860
     tatgtttggg ttaataaatt cattaatatg ctataaatga tgtctctagt cactgtttta    256920
     tctcttcctc aaatccgtct ccctcacggt tcttcttctc ttacacaact tttgttaaca    256980
     tatttgacac ctgccaccta gctatgacct caccaaagaa gatcgttgtg attggcggta    257040
     ctggcatgtt tggcggctcg gtcgctcgtt cactgaaaga caatcccgag ttcgaagttg    257100
     tgttgacaac gcgcgatccc aactcgtcca aagccgccaa gtgccgcgag cagggatttt    257160
     tgttggtaaa ggccaactcc tggaatgctt ccgagctcga tttggtgttg gcaggcgctt    257220
     atggtgtgtt tctcaacacg gactccgaca acctgaactt caaaaatgag gtcggcccac    257280
     cggaatccgc catgggcaaa atcgtgatcg atgctgccat ccgccaaaat gtcaaatact    257340
     ttgttttctc agggcttcca cagtctaacc gccttacgaa cggagaagtg tctatcttgt    257400
     ccttcgacaa caagaacgcc attgccaact acggccgtaa ggctgggttc gaggcctttg    257460
     tcgaggtcaa ttctggctgg gctatggata ttttcttcat ggaaacctac gcaaacgcgt    257520
     tcggtggatt tgcgaccatt ccagactcag aaggcttcct cagtttgagg atcttcccta    257580
     tgagcaatga cccggagctg atcccatgga cctccgtgag agacgattac ggcgatgctg    257640
     tacatgctgt cttcttggaa ccaccaaaat acgccaatcg cattatctgg gccatatccg    257700
     aggtagccag cttccaagac gtggttgatg cgtacaaccg attgaccggt acacaagtgg    257760
     cgagatttgt accgcaaacc gagcccctca aggctagcac ccccggcaaa accaaggaag    257820
     tcaacggact gcgtaactat tgccactact tgcaggggaa atactgcaac aatcaggtta    257880
     ctgatgatcg tttgctggaa gagatggggg cgctcaaagc ggttgcaaca aaagcgcgag    257940
     gaagaggaca tgcgtccact cagtctatcg acggcttcct acgtgacaac gcccgcgtca    258000
     aattgcaatc catttcaaag atttgattgt gataggacaa agtaaatacc gtgaattcta    258060
     tcgaatacga tagagtactt tgttgagatg ggcaagattg gcaagatggg cctggtaggg    258120
     aagtggttaa gatgtctgga ggattaggcc agtagcttaa gatgtttgcc caggtataac    258180
     tagttagtta cgttagatct gaatccaagg ttggctcttc cgattttcaa ctttccctct    258240
     ctctgaccat ccagtagact ccgcgcacag tttttcaaaa tttcaaagac gacacatttg    258300
     gtgatcatgc tcaatcaatg ggccaatatt atccatggat ggcgacacag catgagtgat    258360
     ggctaatggc gcagactact ccgcatactc agtactttat agcgcaaaga cggcatgtgt    258420
     gaagtttctt ttcaacgaat tcaatttgcc cggtggagac gccattcgga gcttcgccta    258480
     ggacctgaaa taggaatctc ggtgcacctc tagcgggcct cgtgtgcttc ccatattagg    258540
     caagtaatct acccctcttg cccaggaacg ttatgtccgt cgccgaactc actcgaccca    258600
     tatgtctagt cacgaaagtg ctggacagag ccaagggatc ctggccagac ataaagacag    258660
     caaaccctgc actgccatgg tctaaagtat cttgcaatat atgttcaaaa tgtccagcgc    258720
     aacccaaacc atcactgccc ccaacggagt gagctaccaa cagccaaccg gtctcttcat    258780
     taacaatcaa tgggtcgctt cgtcatctgg ccaaaagctc cagtctatta accctgcgtc    258840
     agtaaatcac cctacaacct cagctgatcc tcaaaattaa cgtatcatgt tcacagaacc    258900
     gaagaggaga ttacctcagt ccatgccgcc acggtggaag atgtcgacaa ggcggtttgt    258960
     gccgcccggg ctgcattcga gggagaagaa tggcaaagtc ttgttgggac tgctcgaggc    259020
     aagctgatgc ataaagtggc cgacttggtt gaaagccagc aacatgttct agccaccatt    259080
     gaggcactgg acaatggcaa accatactct caggcgctgg gtgacattga ggaagtcttc    259140
     tcggtcttcc ggtactacgg aggctgggcc gacaaggctt acggacaaac catcgagact    259200
     agtcgctcga agtttgctta taccgtgcgc gaacctattg gtgtttgtgg tcagatcatt    259260
     ccgtaagatc ccctttcaac gtgtttttgg cagctttgtc cgatttgtca cctggatacc    259320
     cacttgcttt cattcaccct tcataaccta acgtgtttat ccttatctag atggaactat    259380
     ccactcggga tggcagcgtg gaagttaggc cctgcgctag cttgcggtaa tacagtggtt    259440
     atcaaagcag ccgagcagac ccctctttct attctctatt ttgcaaacat cctggttgaa    259500
     gcagggttcc cacccggtgt ggtcaatatc atcaacggct atggtcgcga agctgggtca    259560
     gccttggtcc agcatcctga agtcgataag gtggccttca ctggcagtac acctacaggt    259620
     aaacagatca tgcggatggc cagcgatacg atgaaaaaca tcacgcttga gacaggaggg    259680
     aagagtgctc tcgtcatctt cgatgacgct cagatcccca atgcagtcaa gtgggcacat    259740
     tacggtgtaa tgggcaacat gggccagatc tgcacggcaa catcgaggat ctttgtccac    259800
     gataagatct acgatagttt cattcaaagg ttcaaagaat atgtcgcgaa ggtccaagtc    259860
     atcggctgcc cattcgagga aaaaacgtat caaggcccgc aagtatccaa ggatcaattc    259920
     gaaaaaatcc tccaatatgg caggattgcc caggaggaag gcgccaccat tgttgccggc    259980
     ggcagggctg ccgaagctcg acccaacggt aaaggctact ttgttgaacc tacgatcgtc    260040
     cgtgatgtgc agccgcatat gagaatctac aaagaagaga tcttcggacc atttgcggtc    260100
     ttcgtcagat tctcaaccga ggcggaagca atccggttat cgaacgtgac ggaatacggg    260160
     cttgccgctg ctgtatgcac gagtgatgtt actcgcgctc accgtgtggc tagcaagttg    260220
     aaagccggca tggtctggat taattccagc aacaatagtg atttccgcgt gccttttggt    260280
     ggagtgaaac agagtggtat tggaagggaa ttgggccagg cagggttgga tgcgtactcg    260340
     caactgaagt cggttcattt gaatctgcag ttggtagagc agatctagtg tgatggattg    260400
     atctaatgtg aacttgaagg actggaagaa cagcatgcct atagtagatc aaatacattt    260460
     caacttgaca tacttggaat ttttttggat tggttgaaaa caagcaaagg tagcagcctt    260520
     ggaggcacta attggcaatt gttataactg tttacgaggc ttggacaaca gtccacaggt    260580
     gcttattttc tcatctaagt tactataaat gatataggat aaattgttat aaagtattca    260640
     ataagaaaca aagacagtaa acaataatca accccacggg gtgagacaag acttgacgat    260700
     ttctactcta tagtttagag gtgttgtcac cgttgctcat cggagccaac tctacaccct    260760
     ccacatcaac atagccgtag atctctgact tatccccatc ctcttccaat gccttctccc    260820
     acttgctggt gctctctagg aaagcctcca ccacgtcttc cctggtcagg tccatggggg    260880
     cttggttcct gcccatctgc cggatctgcg ttcccgccac cgtctcagtc agtccatagt    260940
     cctgtctgtc gaccttctgg ataacagctc ccgtctgaat tctcccctcc aagatatctt    261000
     taggtaggtt gggctccgcg cagagggccc gagccaaccc gaccccgtcg accacctcca    261060
     gtgccttcac catagcgttg acagtcagaa gtcctcctgt gacaaagacc ttcgtctttt    261120
     cgagcctcgg cacaatggct tcggcaaact cgaggaaaaa agcctcgcgc tgtttagtcg    261180
     attcacgctt gtgctcgaac gccatgtcct cgtaggtgcc tccggagagc tcgacaaagt    261240
     cgaactggca ttccttctcg agaagcacgc acagctcgcc gcattcgtcg ggggtaaagc    261300
     ccttctcatc aaactctacc gagttgagct tgatgccgag aacaaagcca ctggagaggg    261360
     gaattcgttc tctgattgca gaaacgattt ccacaattat gcgcgcacgg ttggcgatgg    261420
     agccgccgta ctcgtcgacg cgttggttgg tcctgcggga gaggaactgt gacagcaggt    261480
     agccgtgagc tccatgtagc tgtacgccat cgaatccagc gtggtacaga tactcagcgg    261540
     cgtgggcaaa tgactccacg atgtccttga tctcatcgtg actagccgcg tgcggtttgg    261600
     caaacttcat gccccacacc tctttatcga gatggacagc cgaggccgag acgggatggg    261660
     gctggaagcg agtctgaact tgccggccac catgtgagag ctggccgagg atcaagcttc    261720
     cgtcgtgatt gccggcccag gcaagacgct tgtatgcctc aaaccggggt ccttcgaatg    261780
     gggcatctgg cgggatgatg aggttaccgg cgccctcgat gttcacggcg tcgactatga    261840
     gattacccgt caggatagtt ccgatgccgc cttcgccgaa ccacttgtag gcgttgatga    261900
     tctccggagt cggaatacca cgcttgctca gatccttggg gttccaggag ctgagcctct    261960
     cagtcatagc ggccttcagg agtctgttct tggccgttcg cttggagaag gtcagctcga    262020
     gaggccgtcc cagtactgac gtatccgaga caggtctatc ctgcccatat cgttggtcgg    262080
     ccatggtata cttttgggta ggcagcggtc aagaggaggg tgagaagggt gagggagaga    262140
     ctgtctgtgg atgttgttct agtgttgtga gggctcaatt ggatttcgac aaaaagagtc    262200
     ccggacagca caagggcgaa cacctatgac tttgatatcc tgtaggaaga attgcgcgga    262260
     ggagaggcgt cccttgcgat ccgaaacaaa actgcgtcca tgaccattct ctttattgcc    262320
     ctactttcct gggaaagttc cgagtcgcgg actctattgt ctgcaggtgt acagtgatta    262380
     taaatcgggc cttcagcagg cttgcctaaa aagggctgta cgcgaggtgg ccgagatgtc    262440
     aatctgctat tggactaatg gccgctcgac actccaccat tcagcgggga gacatggggt    262500
     agcttagcta caggactcag actttcgtac tgtgttcttt ttactaaggc gatactgcta    262560
     gctgaagact cttgcttgac gatctgcttt agtccaacag gacacgccag gctgtggatg    262620
     ttcatcaata aatcaatttt gttggacgat ctaagctcac attaccgtca tgcagtatca    262680
     ctgtgcactt ggagaatact atgtgttgtg gtagagaccc cacatgtggg tctaggtcct    262740
     caccctctgg tagctagata gttgtagggg aagctcgctt ccctcccttc ccaatacaac    262800
     tctctccttt ctgcttctct gagcctacaa cctgtagtct caccactatg gaccccgatc    262860
     aggatgttga gttgtatata cgtgtaagcc ccgatggctg ggctcctgat agtgttctct    262920
     gattgtatgt tcacttgcta tcatgaatcg agctcatcgg catttatcca ggcactccga    262980
     ccagagcaga aaccgagcgg tcaatactga gaagtcagaa tactctttct atatagctta    263040
     gattaagcta aattggactc tctttattag cggtatagcg ctcgagtgtt attgatattt    263100
     ctggcccttc tcgggggtat cgacgtcccc agaagtaaag ctacagtgcc ctataggacc    263160
     atcgatcgaa atcgaccccc attgaagagg taataaagcc atatcctctc cctcatcttc    263220
     ggattccatc tccacaggtt caggcttatc cacattagga ttgaatcccg gatgacacgc    263280
     cgcagcaatg gccaagctgc agctccccgc cacgggcatc gccgattcaa gccgccggag    263340
     actgagaacg atcaaacacg taaacatgac acctcctatc gaagtcgcga tcacgatggc    263400
     caggggcgaa tacccacagg catacacgtc ctgcaggggg tccctttcca tatgcgtgtt    263460
     gtacgcttca atagcaatta cgaacagact ctgcgaaaca agccagtgaa gaacagccga    263520
     ggtcgccatg agtggcactg catagcggta tgggagggta aggaaataat tgcttcgctg    263580
     ggataacctg gggttatggg agacgcgaag gcccttgcgg cggtggccga agcggctcca    263640
     ttcggcggaa agacacatcg aggtcaaaat actgttgtat gccacgtaga gaaatgaaaa    263700
     aatgagttgg ggcaaattgg ccatgatcga gttggcgacg aatccttgac tatcaccagt    263760
     gctggtgata gtttgcgaat tgatttctcc gggctttgtc tgccaaatgt gtataccgat    263820
     tgcgttattc aacccaaaca taagcataac gagtccagct atgatagata gcatccacct    263880
     gtgtcaaata tcagcctcgg cgcaaattgg aactagagac aattgcaaac aagggcggga    263940
     cgcaccaaag aataaagatg ccccaacgag tcgagacact agagccccat agtctccgtt    264000
     taccagtgta cacggcagga cgacgaaatt ttctgttttt gagtgacggc agttttgcat    264060
     aaaccgggtg tgtgtatatt gcactgccgt cagagggcaa acacatgccc agcgagtagg    264120
     ggtcactacg gcgtaggaaa gaggcaattc catcgccgac agtcaagaga ggggctcgag    264180
     gcattccaag ccatatgtat aacaggattc ctgtcttaac aaggttggca acaacgacag    264240
     cgaccattga tggaggcgaa tactgcaagc tgcatttctg cggcactggt tcggccagac    264300
     agtgctgaat gttgtaacta gcggatgtca tatagcccgg ctggacatcc acagtccaat    264360
     ttttgttttc ggcccattta tggacggcag aagatccgtt ctcactgcag actcgctgtg    264420
     aaccactgtc tgagggacaa acccatgggt agggaagcat agctttattg cccggataat    264480
     atttgggctg atacacaggg ttcgcgtaga cgagtgtgta cgaatcattg tctttggcag    264540
     attccgttgc caagagaagt ttgccatatg atgtttggta agtctgtgcg aaggcagcga    264600
     cacaactggc actgtccaaa tggtgtaatg tcccgttctt tgcggcatgg aggagacttt    264660
     tgagagagtc ggcctggtcc gaggtcttgg gtatgttgtt caactgcaca tctggccagt    264720
     ccatctgatg caaggaccca ggaccagcga atacctcgta tgcggggact gcagttttgt    264780
     agtaaatggc ggagttgtag aacaaatgga aaggaagaga cgagaaacat agacatagcc    264840
     atagaaatga acgtttccga gatatacgga atagattccg aagacttggg actccaatat    264900
     cgagccagct agctgttctg tgagcgcgat cgacgtcctt tctagtcggg gctaccaagc    264960
     attgctgcac aaataaaaca gttagctgag tgggctttat ttgggaaaca tatgacaagt    265020
     ctagtcttca taccattccg aagttactgg cacttagtac accagtactc aacacgttaa    265080
     ctaaccagtg cattgctttg cccaaatggt gcacctggtt acaatctccc ttcacaagag    265140
     tcattccatt tccattgcga gtaccagccg ctgaataaat gagaaatccc gtattgaaga    265200
     ggaatacgag caggctcgac atgaaagcca gaaacgccgt gaacttccaa cctgtgaaaa    265260
     gacccctact ttggcgaccg aatgtttgtt gtttcgaccg gggctcatat tctagggatg    265320
     ttctacacag cgccctctct gagtcttcct cggatagggt gtgaattagg cgatcggagc    265380
     ttcggtaggt tctggggatc ggagtcaact cggtatcatg tccgagcaaa acattgtcga    265440
     acatcttgtt gaggaaggtt aaccggagaa agcataaaat ttgttcttag taaagccatg    265500
     cgactattgt tttaaatata aaggtggttg agccaaagta aaagaaaaag ggacaagaag    265560
     aaagaaatag gaagtcaagc gaggccaggc tcttaagaat cgtggaagtg ctgttcaaca    265620
     acattgcacg atcgtcccgt gcaaagggga aaccagaaaa gatctgcttt ggatccctgt    265680
     tggcgtttta cgcttgcgca gaagggtgga cggcagtctg gggcgaagtc tgggggcgaa    265740
     gagagaagag cccaatcata tctcccatca attgccctga tgcctggccc ctcaacttca    265800
     cccacaccaa atcgggttgg gtaatacctt ccttgtccga atattccaaa gatggacgtt    265860
     tggacttccc aggtctattg gaattttgga aggttaacag aattgactga tacgaaagga    265920
     cagcactcat tccacttgtc gtttataata acccaggtaa tgtttccaac cttggaaggc    265980
     tacttagatt ataaatcatc aagttcattc aacctggact ttggaggcac tttttaacga    266040
     agatcagcga ggcaaacaat taaatgttga agacgacgag gccaacaaaa ggccatttcc    266100
     gcaacactga ggtgtagaga acttgaagca ggtatgtata taaagatttg atgaagcccc    266160
     gcaaaattac atttcgtcca attcgggctc cctatcttcc atcgttggtg tctttggagt    266220
     ctttaaagtc ttgcttttct gctgtatgtt cacctgaaca tcacctcgat cagccttaac    266280
     ctaaaatggc aacgtatcag tggaagtgct cttctgttga tgatgatacc cctgatgatt    266340
     gggctcaata gggagggagg caaataccgc aacttcactc agggtagcta ggctttcatc    266400
     ccagttatga gcttcatttg ctgtctttgg acgttccgag gccaaaggtg atgattcaaa    266460
     atcatcaggg aatgaggtgg caacgtagat ggaagggcct ccgtttgtat aactagattt    266520
     tggggtattg tgatagcaac cccgtgaaat gggactaatc cggacaacgg acaaaggcct    266580
     gataactgca ggtcggatga cagcactgaa gggcatggtc gttgagtttt gcaactgaag    266640
     tatcgtaact tgtctccttt gatgatatga taccaggcat gattctgtcc atgtcgattt    266700
     aaaaaacata tgtgctatac tgatcagctg attgataagt aaatgtcatt taggtcatta    266760
     tgacttcggg gggttcgtta ccccacatcc ggctgtaata ttctgtggtc cacgccacct    266820
     tgagcttctt ttgacctcgt caattagtat agtaattctc caatgggcca tttgtcaatg    266880
     acgtataata tgagagggga gagggcattg cattttatgt atgctatgtt ccgtagtagt    266940
     taacttcttt taggaagctg agggacatgc caaatcatgt acatatatgt acatagccaa    267000
     tatacatgat taactacatg taggtaccta cctaggtagg tatataaggc cctccggggc    267060
     cccgccgggg gccatgacgc atagttacat aatctcctaa acttcccacc tgggcaggtc    267120
     cgacagaccc catatccctt ggctcggtta ccaaggattg cgaccgcgcg aatatgactg    267180
     agggtgattg tctcaaattc tgggcctata cggagtatac ttattctgct gttccatgct    267240
     gattggtgcg ctttgaggtt tattggatga taccacctgg gcagtgagta aaggtcatat    267300
     ttatactgta gccgcggcgt ccctgtaagc acttatcttc aattactcgg tccaacgcat    267360
     gacccaattc cagcagagat tggaccgatc tacatatggc aggctgatcc tcagtggtca    267420
     ttccttagat gttattttat gacgcatttt gcacgtgaat tttgaccacc cttgatcccc    267480
     ctttttcgag aacaatgtaa tagatctgac gtatcgttgt tatgacagat taaagtcttg    267540
     aatccaacgt catttcattc tacaaagcta tgtctgccat ttttggaatg gaagaaatgg    267600
     agggctctag tcaagagtta atcagtagcc tcacatccgc agttaactgc cctctctccc    267660
     taattaccta catagggcag tgggacctcc gaaataattg gctaaatatt gtccgctcta    267720
     ctcagcccat gccctggcga atccagtgct tatgtaacac tcaggggaag ggtggcatga    267780
     ggctgaggta caatgtgtat gttgtaggga gagattaacc atatatctta ccgacctata    267840
     ataagatgta taataaggtg gcgtagtggg tagtccttct cagcctccgt actcggtact    267900
     ttggtatgaa tgacccgaga agatatatgt tgtagttggg gcaattaatt gaggaccaat    267960
     agtatatgca gtcggcaata ccgagtccag gggtatttcg catagagtat gtatgtacgg    268020
     agtaggtagg taggtagcta aaatagttaa atggttaaaa tagtaactgc agaggcgtgg    268080
     aacgtctagc gaacctttcc aaggttcctt tctttttttt caggggatcc tcccactaag    268140
     gaatgtgccg ggccactaaa aatataatta tagaaatctc cgccgagtgg ttttcttctg    268200
     tttttttttc ctactggatc tcaagagctg cgccactttt tttgtttcgc ctggtagctc    268260
     cgatttagcg tcaatacata tttggccaag atagaaacct ggcgaagatc cgactaatac    268320
     atataggcct gtacctgggc aacccagtac tgaaattgcc aagaaaagga gaaaaatcaa    268380
     aggtattatt tattttgtgt tattattgac actatgtaga tactatgtag atactattca    268440
     taacatttaa ttttaatttg attatttttc tatatctttt tttttttttt ttaaaaaaaa    268500
     gaagaatgaa catgtatgta ctctgtatgt actctgtatg tgtagaaata atagaagtgc    268560
     caagtgagac attcgattcc cctaacaacc aaaaattggt ccgagcatcc ccctcattgg    268620
     gtacaagctt gcacaaagtg aaggagctaa taataattcg cccctccccc ttcttgcttt    268680
     cttgctttcc tgctttcccc ctctataaat acgaaacacc tgtgcctttc caaggttcct    268740
     gcttctttct atatttcccc tctctctctc tctctgcctt cgtttaatcc tctttacatc    268800
     cctttacaat ctttattctc tcaatacccc catctttgca ttcaactctc gtttttgccc    268860
     atcatgtggt atgctctgct ctaccttcct caatggtgat gaatactcac aagtctgccc    268920
     agtggaatct tcggttacat caactacctc gtggagaagg accgtcggtt catcattgac    268980
     acactgctta atggtgagtg gttgaaagtt gccctgtgat tttaaccttt tttgctcacc    269040
     gttatttcca ggcctctcca gattggagta ccgtggctac gactcggctg gtatggccgt    269100
     ggatggcaac aagaagaatg aagtctgcgc attcaaggaa gttggcaagg tggccaagtt    269160
     gaaggaactc atcgaccaga gctcatatga catgaccaag acctttgagt ctcatgccgg    269220
     tatctctcac acccgttggg ctacccacgg taccccctcc cgccaaaact gccaccccca    269280
     ccggtaagtc ccccaaactc cgtacaaaga aacatccgga ccattgggag agattgggaa    269340
     gctaatatgg ttttgtgata gttccgatgc caactgggag ttctccgtcg ttcacaatgg    269400
     tatcatcacc aactataagg aattgaaggc tctgctggag agcaagggct tccgcttcga    269460
     gaccgagacc gataccgagt gcatcgccaa gctcgccaag tacctctacg accaacaccc    269520
     cgatatcgaa ttcacagtcc tcgccaaggc cgtcatcaaa gagcttgagg gtgcctttgg    269580
     tttgctcctc aagtcggtcc actaccccca tgaggttatt gcggcccgta agggttctcc    269640
     cctggttatc ggtgtgaaga cctccaagaa gatgaaggtg gatttcgtgg atgttgaata    269700
     ttccgaagat ggtgtccttt ccgcggagca ggcctcccag aatgcggcag ccaagaagtc    269760
     tgccactagc ctcctcgccc ctcccgacaa gtcgctgctg caccgctccc agtctcgcgc    269820
     attcctgtcc gacgatggca tcccccagcc cgtcgagttc ttcctgtctt ctgacccatc    269880
     tgccattatc gagcacacca agaaggtgct ctacctggag gatgacgata tcgcccacat    269940
     ccacgaggga cagctcaaca tccaccgtct gacaaaggat gatggcacct ccaacgtccg    270000
     tgccatccag actattgaac ttgagttgca ggagatcatg aagggcaagt tcgaccactt    270060
     catgcagaag gaaatcttcg agcagcccga gtctgtcgtc aacaccatga gaggtcgtct    270120
     ggatgtggcc aacaagaagg tcaccctcgg tggtctccgt cagtacatct cgactatccg    270180
     tcgctgccgc cgaatcatct tcattgcctg tggtaccagc taccactcat gcatggctgt    270240
     gcgtggtatc ttcgaagagc tcactgagat tcctatcgca gtcgagctcg cctccgactt    270300
     ccttgaccga caggccccag tgttccgtga cgacacctgc gtgtttgtct ctcagtctgg    270360
     agagaccgct gactccctga tggctcttcg ctactgtctg gaacgtggcg ccctgaccgt    270420
     tggctgtgtc aacgttgtcg gatcctccat ctctctcctc acccactgcg gtgtgcacat    270480
     taacgctggt cccgagatcg gtgtggcatc aaccaaggca tacacttctc agtttgtggc    270540
     tatggtcatg ttcgctttgt cgctgagtga ggatcgtgcc tccaagcagg agagacgtga    270600
     ggagatcatg gagggccttg gtcagatctc cgagcagttc aagcagatct tgaagctcaa    270660
     cgatcccatc aaggatctgt gtgccaagtt cttcaaggac cagaagagct tgctgctgtt    270720
     gggccgtgga gctcaattcc ccactgccct tgagggcgcc ctgaagatca aggaaatctc    270780
     atacctccac tgcgaagccg tcatgtccgg cgaactgaag cacggtgtgt tggctcttgt    270840
     tgacgagaac cttcccatta ttatgattct cacccgtgac aacctgttca ccaagtcctt    270900
     gaacgcctac cagcaagtca ttgctcgtgg tggtcgcccc attgtcatct gcaaccacga    270960
     tgaccccgag ttctcatccg ccctgaccga gaagatcaac gtgcccaaga ccgtggattg    271020
     tctccagggt ctgctcaatg tgatcccatt gcagctgatc tcttactggc ttgccgttgc    271080
     cgagggactg aatgtcgatt tccctcgtaa cctggccaag tcggtcactg tcgagtaaat    271140
     gtttctttag ggcgaggtta gatgattctt atgatccagt catcttctta tctttaggtg    271200
     ttttcagctt cgggacaatg gaatctcatg ttattttatt tttttaagaa aaaataccct    271260
     tttacgatcc cactgcctac tatactagta ttgtttacca ttaagagtct gtgtccttgt    271320
     atgttgtata aaccaaattg accgctccat cccattggcg cttaattgcc gtgggtgatg    271380
     acattccgcc ccccaccaaa tgcgggaccg agggatttca cccctcgagc tcttccgatt    271440
     cataaacact tgtgtcaggt tcaattctcc caacccccaa ggaaacaaca tcatctttct    271500
     tttctcggac caatcaagtc ttaacaaaat gactactatc aaaggccccg gcgctgccca    271560
     gacccacgat ggtaaaggca aacaacagcc cttggagaga cgccccagct aataccgatt    271620
     cgacaacagg ctctggactc cgcgtcgcga ttgtgcacgc cagatggaac acagtgatca    271680
     tcgaccaact ggtagcagga gcgaagaaga acctcctagc agccggcgtg ctggaggaga    271740
     acatcacagt ccagacagtt cccggcagct acgagctgcc tctcgcagtg caacggtgag    271800
     tgcggggatg atatcacaca tgccatacca catactatat actacatacc gtgtacacac    271860
     gtactgtata ctgtgtactg tatctatatc catacatatg tagctttaac taacaccacc    271920
     tcgcagcctc tacgccgcct cccagctcca ggccaactcc tccgtccaag gcatcagtgc    271980
     cacagacctc ctgtcctcgc ccaccgccga agtgaccggc tctgccaacg ccgcaagccc    272040
     gaagaaaccc ttcgacgcta tcattgccat tggcgtcctc atcaagggcg ctactatgca    272100
     ctttgaatac atcgctgacg cggtcagcca cggactcatg cgtgtccagc ttgatgcggg    272160
     cgttccggtc atctttgggt tgctcactgt tctcacggaa gaacagggct tggaacgggc    272220
     tggtcttgga aatagtggga tgcacaacca cggtgaggac tggggaagtg ctgctgtgga    272280
     gctgggtctt aagaggaggg attgggctga gggcaagatt ttgtaattct tgcgataact    272340
     tggcacatat ctattggatc ttttgagggc tacgacggaa ccctctaaca tgtttggtgt    272400
     ggctttttgg tacttaaaca acttggtcct tggtagatta tcttttcgtt ggagtaagaa    272460
     aggaaacacc ttcacagaac cataattctt tgggagcata atctattaca tgttcactct    272520
     tccatctgtt cgccttcacc cttatcctcc tcttcttcat cgtccccttc cagagctcgc    272580
     tttgctgctt tctctgcttc ctcaaggatt tccttgggca cttcctcgtg gcggcccttg    272640
     gtaggtccat cgaccgagct gatccacgtc atctcgagct cgaattcctt gtccttgctg    272700
     tcctcatgag caacgtagat aatgcgagca gcttccttca caccatctgc caaagacaga    272760
     tttcccgagc tgaggtctag tttctcgagt tcagccttgg cggcctgtcg tcccttgcca    272820
     gtagcagcac cgtagtagcc ctacaccatt cttgtcagca tatctatcca ctcacaccca    272880
     cacgcagaca agtcacaacg tacccaatac aatccactag gctcaatcat gtatagacca    272940
     ggacctccag ccttggcacc ctcaaccttt ccaccagagc cggacttggg tccattgcca    273000
     acctgtccat caactggaag ctccgcctcg gtatcccacc caccaacaat agcagttaca    273060
     ccgaagggcc gtacgctgga gtagagcgta tacgcctgca cgtacccacc caagcgattg    273120
     gcaattgcag aagtcggaat ggggcctttg tatgtgcttc tccaggagga agcctcatct    273180
     ctagctctgg aaacgaagtg acgaccgtcg gggacgagtc cagcggatac ctgcatagaa    273240
     agaagccaga ttagcaacgg ggtatttcga agccttccac gacagcatgg tttcgatgaa    273300
     aacgcattgc gttgggaagt gatagggcaa gggaaacggg gtctcacaat tccaacatgg    273360
     cgatcgactg tcgcgattct cttgttcgcg cctggcttta ggagtttgct cgtgatgatc    273420
     ttctccactg ccagcactac accatccttg catctgatgc cgacagcggt gcctccgttc    273480
     tcaactgcct tgacagcata ctcgacctag atggtatggt cagcagcgtg aagctggata    273540
     tggctcattc atgagctggg atgtgtttgg gtacctggaa attccggccg tctggcgaga    273600
     acaccgagtt ggagagatcg tagcctgtgc caattgacgt ctaaagaatc atcctgttag    273660
     cttgattggg atacaacata acacattgtg tagatccgaa gctgactgac catggtcttg    273720
     gtgaggatgc gatgcggtga ggttcaagaa caacagacgt caccgtgggc cgatcgaaag    273780
     agttaatctg tatattggac agataaggga agagaatggc cggtttggag ggggagtgtg    273840
     gataggtagg gtgaggttgg aagctctggg gatgataacg taggttccta ggctaagcag    273900
     tgacgctgtc gcgtcacggg gttgcctggc agagcttcca atcacatgac cgcgagatac    273960
     ctaatcggta cttcgatttg tatctcttct ctacccactt gccaggtact cttttcgtat    274020
     cttgtggtat tgggtatatt gtggacacca taaacacact atagcatatt atgggctcat    274080
     taatgggtat atcatagaca taatacgcag tatatcattt taaacatctc ctagtggcca    274140
     ctcgggaccg cagcccaacc gaacaagaac ttgggcatct ttgcccctcg atccaaataa    274200
     aagacacaac ttcataactt tcttctcata tccagtttta cagggaacaa acattcgaat    274260
     cgggtttcga cgttctccat ttattcgata ttgttgatat tgttgatcta tacagaaatc    274320
     gacccctcca tgtcttcctc gatactacat cagtgcccgc agtgcgggca cgtctccgat    274380
     atctcaaatg cacttgcagc tttcatcgag aaccctcact gtaaacaggt agattatgct    274440
     cgttctcatc gtgttgttcc aaggaacctg accaggagcc tatatatagt gcggcatgtc    274500
     tgcatccgaa agcgactcga aagtacaaga cgaactttcc gctctgtttg atacgcaaat    274560
     gagtatgacg cagctgcatc ctactcctag agaaaccacc gtaccatctc aagtgccaga    274620
     aattgcatac agcattaccc aacactacca tcactcggcc cacagagttg cccagcaaac    274680
     aaaccaacct tcaagcattg atctcctgag acatcacggt cttgatccaa gtgcccttac    274740
     ttcgcagcag attgcgctct ttgaaaacgc cgatgcagag cagaaagaac ggttgctcca    274800
     aacatggcag ctctactcgc aacttggaaa ggaagccagt gcccctgctg cggactttgc    274860
     tatgcaggat tctgccatgg atgacagtgg ggatatgaat gcctatgttg atgctgagcc    274920
     gtacatggta tctggctacg agaatgttgc tgatcgagcc tctcatatcc cgaaagagcc    274980
     caccactggt gaaacctacg ttggctcaaa ggacccggtg tatcaaggtc cgcaatggtg    275040
     ggagctgaca aaagctggtc cgatggaatc aaactatggc gcatttgaag agatgagacg    275100
     atattaccct agctgtggtg tataccactg gtagtgtcat attatgtcta tcgggacgaa    275160
     ttcattgtat atatttctat tattcttgtt cttgtctttc ccgtgcctct atatgcctcg    275220
     actagtataa agaatacata ccaactatat tccaaaggct cccccctcag cttaaggaat    275280
     atctaaagag atgtcccaaa tgaaagccga atttagcgct acctagactg actgaaacaa    275340
     attatctttt ggggattctg aatcgaaata ttgtgtcaaa aggggatgga attctttgat    275400
     tctagatacg tatttctctg ggaatgatcc atcaaccccc acaattcaat gctagtttaa    275460
     atcaaaaatc catgccatga ttaacggtga agacaaaaga gtgttagcca ttggcattct    275520
     cgtaaagcaa tccatcatat ccaaccatgc ttccataagc ttcatatcga aaaagtagcc    275580
     gatggtgtcg tgcataccgg taattgaaaa gggagctacc gagcaatctc tatcgataca    275640
     cgcaacacca cggtgctcaa agtaaaggag acactgggaa aagtcagtcg attgattcca    275700
     tgcataggat agatcaaacg gtagcatacc tttactcgtc atcctcttcc tcgagagcag    275760
     cgaaggcacg agcgagagca tcgctggtac gcttgacctc atcgacggca tcggcggcac    275820
     gcttggcctt gtagcaaccc tgaccgatgt ggccacacca cttctgaagg acaaggggca    275880
     agcctccggc catggcctcg gcgagagcat cagcagagcg cttgacgtcg agggaggcat    275940
     cggtggttcg cttgcagccc tggccaatgt ggccacacca cttggggagg gtctcgctgg    276000
     gagcaagagc cgcggcctgg acggtgccag cggcgataac ggcgacgacg acggaggtga    276060
     acttcatctt gatggttgga ggagaaaccg ggggtttgaa attggcaagt tggtttgaag    276120
     attgaaggac agatactgag aaagctcgat gatggagatg tctggagaaa agaaattgag    276180
     acagcgaact gcaacgaggt ttatatattc gtgaagatca gtatcatcgc tcatcgcttg    276240
     ttcaatggac tcgttcattg agaagagcat ggttggacat gagctcgaag aactggttgc    276300
     tctgaataga ggcatgtggt tctgtatagg gttctgaata gtgttctttg tcgacatcag    276360
     cctgaataaa ggtactgctc gagatcggca gttctcaata ggaatcttat tgaccgacgt    276420
     cagtgtgcca ctccaataag gacctcaggt ctcgtataga gagggtctag ggcaagccat    276480
     cctgtcgaat gctttgacgg acaagtcggc taataaacca agttaattga gctggagtat    276540
     attagtcaag atggtagata tatttctttg gtcgatttga ccacgatctc cggggtatga    276600
     catattcgag gacccgaaga ggatatgaat aagaattgac gaaagaaatg tagtttccga    276660
     ggggtaaaat gaataagaat gtaagtttca ttgtctcatt gtttggaagt tgaacggagg    276720
     cacctcaaga gaccctcaga gacctcagag ataagatcgg gccggcgcta accagaactc    276780
     gctcgccgag cccatccgga gccttttttt cccgttttca ttccctttct cccaaccccc    276840
     ctctcccttt tggtgattcg tgattcttcc cctttgttta aatcttccaa aatgttctcc    276900
     agaacggcac agcctgcccg ggtaagtctt tccatttttc ttttttgctt tttcccgtgt    276960
     ttccgcgtct cccgtgactt caatcctttc caatgcagtt gggagttggg ggctttcgct    277020
     aatctgtcct tgctctctat agactctgct ccgcagcgct tccgcagctt cgtctctcgg    277080
     tcgctctatt cccgccagaa gtacgcccat tgatctctcc tgcctcgaat tcaacacccc    277140
     ccgctaacga atttgcgcag cctttgccag tgttcagtcg gacatcttca agcccaccaa    277200
     gtatggtggc aagtacactg tgaccctcat ccctggtatg cttctcatat tttgcgcctt    277260
     ctctgcttgt atggcgcatg ctctggacta acatccgaca aggtgacggt atcggtgctg    277320
     aggtcgccga atcggtcaag accatcttca aggccgataa cgttcccatt gagtgggagc    277380
     aggtcgatgt tagcggtgtt gacgccggta acaagcactc cgaggagctt ttccgcgagt    277440
     ccctggcttc cctgaagcgc aacaagctcg gtctgaaggg tatcctccac actcctattg    277500
     agcgctcggg ccaccaatcc ttcaacgttg ccctgcgtca ggagctggac atctacgcct    277560
     ccatctctct gatcaagaac atccccggct acgagactcg ccacaagaat gtcgacctct    277620
     gcatcatccg tgagaacacc gagggagagt actccggcct cgagcaccag tccgtcaacg    277680
     gtgttgtcga gtccctgaag atcatcaccc gcgccaagtc cgagcgtatc gccaagttcg    277740
     ctttcagctt cgcccttgcc aacaaccgca agaaggttac ctgcattcac aaggccaaca    277800
     tcatgaagtt ggccgatggt ctcttccgca gcacattcca caaggtcgct gaggactacc    277860
     ccaccctgga ggtgaacgac atgattgtgg acaacgcttc catgcaggcc gtctcccgcc    277920
     cccagcagtt cgacgttatg gtcatgccta acctttacgg tggcattctg tccaacgtgg    277980
     gtgctgccct cgttggagga cctggtcttg ttcccggttg caacatgggc cgtgacgttg    278040
     ctgtcttcga gcctggttgc cgtcacgtcg gtcttgacat caagggcaag gaccaggcta    278100
     accccagtgc tatgatcctg tctggctcca tgctcctgcg ccaccttggt ctcgatgacc    278160
     acgccaaccg catttccaag gctgtctacg atgttatcgg tgaagggtga gtggacacta    278220
     ataccgttgt gaaaaatgac catgctaact ccttttagcc gcactatgac ccgcgatatg    278280
     ggtggtcagg ctaccactca cgagttcacc cgggctgttt tggacaagat ggaggcgtct    278340
     ctgtaaattt tggaatcccg cgcgctccaa tatacctacc gctacgattg aggatgcctg    278400
     ctgattcttg gtgttctgca cctgaattgg tcggcgaggt cctcatttga tgtattatct    278460
     tttcaattta gctcgaaacg ttccccgcaa gttatagcaa tagacatttt ttcttttgtg    278520
     atcataacgt ggacattcat tgcattagta gttgggtata aacatcgagg ccatgtgtct    278580
     tcaacgggcc aacttcatat cacggtgccc agatggtaaa gagctcaacc tcccaatcct    278640
     ccaacccgtt gcgaggtctc taatagacat ctcatcaact aacttgatcc gagtcgaaca    278700
     tgtagctgat ccatgagcat cccccaacaa gactatgtga ccaaattccg acccaggcgc    278760
     atggataacg cccaagggaa tgcacataca cagacagaat gtgcaaggta catacttgag    278820
     ggagaaagac ttgaacactc tttccatcca ggcttttctc ctttttttgt ttctcttgat    278880
     tgaatccacc aaagacaaaa agcagttcaa tcagaaagcg attcgtcgtt tgcggccagt    278940
     gtatttcgag ctagccttga cgaccttgcc cttcttcgcc atctgctcct tcttgtgcaa    279000
     aatccaagcc ttatctccct tcctcggggg cccacgagca ttattgatct ccgcagcctt    279060
     cctccgagca tccaagacac tgacatcatc catgccattc acaacaccag taatatcacc    279120
     agtaagacca ccaccaccga ccgtgagaac cagatacaac ttgctgctct tagtccccgg    279180
     atcatcttca aggataccgg caccaaagcc cgctttgata gcagcaccac tgatcatact    279240
     ccgctggaca tcatttttcg ggtagaactg acacaccgca cgaccaccac gacgaaggct    279300
     ggcatacaga ccttcgaaga agcgtcgcag ccgaccttca gcagtgacat cgctagtttc    279360
     cgcattgcac agccactgga ttgcactgat gctgattgcg gcgtcgaatg tgcccggtcg    279420
     gaaggggacg ccctgtccga tgtctgcgag gaatagatcg ccttccactt cgcgttgtaa    279480
     agccacgtcc agcatgctgg gtgagatgtc catgccgatc caggtgtgtg ggccgccttc    279540
     ttcgggggtc acttcggaga gcatttcgcc ggagagaccg gagccgcagc cgagatcgag    279600
     gatgaaggat ggggatttta ggtcgaggag ttccagtgcg cgactggtca tgttggcttg    279660
     gatgttgcgg attcgcgagg actttgtata ctttcgcgat tcattgtcgt tatagaacag    279720
     gtccggaggg ctggagtttt caagatgggg agattagttc ttttttgttt cttcttcaag    279780
     atcactggag tagggtcaga ctggcataca ggatatcttc agggcgcgac atggtgtgtg    279840
     gtattgaatg tgcaagttgc gtaagttgaa gtttggaaat tcattaaatt atttttggtg    279900
     gtgctgcctg aggcatctgt accccaaaac gtccacgttc tccgattgca tcttgaatct    279960
     ctctctctct gaggctgatt gcctcttgca ttacttttca acactaccgt tgttccaaag    280020
     ctctgtcttc accggaaatc atgtggattc taccgctagt cggttatttc ggggtggttg    280080
     tcgggtttgc ctttctcacc ttgtccatag gtatggagcg acatgggatc ctcacgggaa    280140
     aggaaaaagg ctgactttta aaaccccagc ttcgggacta tactatctat ctgagcttgt    280200
     ggaagaacac acggttcttg cccgccgtct gttgacccgt ctgatctacg gcatcgccgg    280260
     gatacaagtt ctgcttatga taattgaccg tttccctgtg tcattgtctc tgctgagcat    280320
     tgcttcgcac atggtctacg ccagcaatct gcgccgattc cccatcgtga aactatccga    280380
     ccctcttttc atcctctcct gccttctagt tggtctcaac cactggctat ggttccgcca    280440
     tttctcgaag cctttgccta cgtcgaacaa ctggcgtcag ccgtatggag tcaattacga    280500
     tgagatgcct tctttctccg aagtggcttc atactttggc ctgtgcgtct ggctcgttcc    280560
     attcgctctg tttgttagct tgagtgcggg ggaaaatgtg ttgccaagca tgggctctga    280620
     gtatgccacc ggggaacgtg ccaaacccac tggcctaggt ccctctgatg gcaagtccaa    280680
     gaacaaggga atggccaagg ccttggtgga tggtgtccga gattggacaa gggagaccgg    280740
     tgaactcatg gggttctgga gaggagaaag tacaagacga ttctgagtga gcgaagccac    280800
     ggtaattgat attacatata gatgaaatga gatttgcatt ccgccgtcac atatcgtgta    280860
     aatggtaaaa aaataaaccg gcaaagcgtg cctccatatc gcgtaaccgg gggccaccaa    280920
     atttccagat aaataagagt aaatagtaat gtatggacat cggacatcgg atatcgagcc    280980
     atagtggaag cgctgaaata tgggggtaag aaatgaagag acgaataaaa ggaaaaagag    281040
     atgaagagat gacgagaaag aaaaaaagaa gggggtataa cgacggtcaa ggtggctgac    281100
     catggcatgg gaactctcaa ctccaagatg gaccatcaaa tttggtgtac cgcatcttga    281160
     ttaccattat cattaaaaca ttccctcgcg actttgctga gattgccaag tgggttaaag    281220
     tcatcattct gcgtgcaagt cgtaattttg ccggacaaga gtggcatgac cactgggtcc    281280
     agaatcagaa aggcgcggaa aaaaagagaa gagaccggtg agaatcgaat cataattcac    281340
     ttgccctggt agaaggaagg atctttatgg acagtatacg ttagtaaagg ccgtgaggat    281400
     cttctcatgc ttgggtctca ccttccataa agagcattga actctcccgt cgcttcgtct    281460
     tcgctgagcg agtgtcttcc gagttaggcc ccaacatgcc attcaaagaa gaatacgaag    281520
     cgccggcacc cggaggttgg ttgtactgct catgtctgga agacgtcggt tggtcatagc    281580
     taggttgcat tggggtaaaa ccagtgtcgt ggtgtgttct ggggccatcg gaaggaccgt    281640
     tcacatcgcc agtggttcgg aacgatgtct gctggtacga aggtgtagga agatccgaga    281700
     acatttgatg acgcggggaa cgaatatcat cggctgagag tgtgttttca actgtcagtt    281760
     ccgtaggcgg cttggcaaag ctggaatcag tatcgccaaa gatactgtcg tagtccgtga    281820
     ggaacatcga gaagactggt gccgggatat tgagagttgg agcgaagaca atgcccacgt    281880
     tcctgaccgt catcttgttt acatcggcat tgttcacaat ctcgatcaag aattgcgata    281940
     gagcccgtag caatgcgaga ttaggcctgg gcaatctatg taccaaagag ttgaaggcag    282000
     cgaccttctt ttggcggtcg tcaagttctt ttcggttggg ttagcagaag aaaagaatgc    282060
     agcaccgaaa gtgtacatac caagaacacg aaggaaatcc aaatggagct cccgggtcaa    282120
     aactgttgtc ggaagctctc gaaggtattg cttgaagaga gaagccacag catgaatgtc    282180
     gtaatactga tctccagaca cgaaatcaac atcaccttca gtgttgaacc gttctttcaa    282240
     tgctttgatc accacgttgg aaccgcttaa gcggaagatt ccttcctcca aagcggcttc    282300
     cttggcatgg agatactcaa tacagcgata aaccactgcc ggcagctcca catcaatgcc    282360
     tggcggtcca cagtcttgta cggcctctgc taagggtata ccaaatacag gtctaacagg    282420
     acctgtcctc tcaacagggt tgcttgctac tgctgtgtcg ttgctggcct gagcggcaag    282480
     gtcgaacgag gacctagtac ggaaacccca gatactgcgc ttcttttctt tcgtcgatgt    282540
     ctttgccttg ttgccccagg cttccacgtc ttgaatgact gtgccgtttg tgggcctaga    282600
     tatcagtctg ggagactgca atgcttgatc ggaagaagac atggccatgt ccttgaattc    282660
     tgtcgacaaa gccgccggaa gacgtgggga tcggggagct tgctcaagag tggaaccaat    282720
     agtgggagga tcagcttgca ctgcgtcgtc aaagctgaac ccctggacgg aaacccctat    282780
     atcctggtcg ggactatcaa ctcctcgacc agatcgcttg cttccgttgt tcaacttttt    282840
     agacttgctc tcggctgcgg agactggttg cttttgctgt gtttggaatt catcttgaga    282900
     tggagcctgg cttttcgaag acacactccc acgtccctca ttctcggaag aagcactctc    282960
     aacatattcc atgagagcat caacccaggt atcgcgctcc tcatcgctct cggcgcaaag    283020
     aacatgccta acaagtgccg atgaatcttt tttcttcggt tccaaaacca aaaacgcatg    283080
     tcgatactgg ttgtcagagt cttcgtcggt cccagaagct gaagtattct cggtcgattt    283140
     cggcgattgc ttgccgatct gggcatgatg aagttttata gtacccatgt gtggaccacc    283200
     gggagattcg tagtatctga gttcaggtcc atcaagaaca aaatatctcg ctttccagcc    283260
     accaaagttc ttgcctcgtt tggtcaagta accttccttt cggggctttc catctggacc    283320
     acgtggcata tcgggccttg cctgggcgat acctttcagc agacttgtct cgtcgtctcg    283380
     aggctcgatg gcatcacttg tcaggaattg gcagatagct aaagcagcat tctcatccat    283440
     tggcgtgtcc aaaagtttgt cgaagtacgc attcagtgcg gcacgtctca agtcaacctt    283500
     agcaggggag tgtccgctga aaatacttct atctggtaat ttcccaggga acggagaaga    283560
     ttgtcggact ttttgatcca gctgtggcaa agcaccaatg accttttcaa cccgccatag    283620
     ctctgacatc tctgatcgca ggatcacact gagagtaaag acaggctcct cgtccagggg    283680
     cttggacgcc atgtagctat tccgggaagg acgaagccgc gacgaagaca ctctgacttg    283740
     aactagagga agggcattcg ggggcaaaag caggccctgg tattcatctg acatcaatcc    283800
     tcggtatatt tggttgtctg gaaaatttgg agatctcggg ctgtcaatca tgaccgtggg    283860
     atcaattgat ggaataggac cattgggacg tcctgaaggg atgggagcaa atcccgtggg    283920
     atggttggcc attcttgggg aaagcggaat tggggcctga tgtccggatg ccatggaagt    283980
     ggccatgtct cgtggcatgc gaggcattgg ggaattaata ggtcgatctt ctggtctcgg    284040
     gctcaaaggc agtccagggc tcatgggcat ggcagcgatg gagcgcccat taaaggacga    284100
     agcgggaggg ggccgagcgc ccaaaagcga ccccagtgaa ttagaatcac ccacattcgg    284160
     cggggatctc gtagaaagct ccctagggac catttccggg ctacacgttg ctgtatcccg    284220
     ggaggtgtga gaggatgatg tctgggacag tcccacagaa ccggtcgatc caaacatatc    284280
     cttctgcagc gcagcttcgc ggtcctggtc gtcctgctct ctcgtctttc tccgcccgcg    284340
     gtcggcgctg ggaatcccat ttctattctc ggagtcgccg taatcagaac ctgaatcggt    284400
     atcggaagct gaggatgccc ttttattgtc tgcttggcgt aaatttagag gagcaggcgg    284460
     cggtttgcga cttgggtgtg gaaacctgct ctttccgtct cctactggag atgggatatc    284520
     tgtggcagag actggacttg tggtgttttc gaagccccgc cgagaagctt cagatggtgg    284580
     ggcgatcgat ggcgggtcag gcttgcgcga cggtttctct ttgtcactgc tcggcgcggc    284640
     cacggaggcc atgggctcgg cgaccggcaa tggtggagcg tcttgtatat ctttaagctt    284700
     cttccgatat ttatccttct cttggaaagc acgctctaga tccttgttga ggccgaggat    284760
     tagagtcctt tgtttgtcaa ccaatttcca aagttgtgca ttctgagagg ccgcttgatg    284820
     tttctctttc aagaggtgca caatcacagc ctcggcagat ccagcggcat tgatgagatt    284880
     gttaatgtcg gctggactga gcgcattgac atcaaaggtc gatctctgag aattggagga    284940
     tagggatgaa atagcggagt caatcgatga ggtccgaggc atggtgcgat tgggtgcacg    285000
     atctcccggc atcgagtgta tagagctgac ggaggaagag gcagatcgat cgggttctgg    285060
     cgcacgggat tgtttcggtg tatttctttc gccaggttgg gcactggcat tcgccgattc    285120
     cgttcctacc atttctggtg attgcgacag actctgacca gtgctgaagg gtggcgcaga    285180
     gtaaggtgca ttggccacgc gagagattgg cgaccgatcc tgggaagaag ggttggattt    285240
     cggtgataga ggactctggg atgatgttga tccgtcgacg cggtacgact gaggcaggga    285300
     acttgtatgc aacggggaag gtgctatatg tcgagaacca ggagcaggtc cggggcgttg    285360
     atcagatcga gctaaataat cccgcgggat gaggccgtta ttgactgggt agctggactg    285420
     attcttatat gaagttggcg agctttcatc attctctcgc ggaacttgcg acatggctgt    285480
     agggatcgag actcatcaga ggggtcacgt tcgggggcga cacgaggcga agacccaggg    285540
     ggcgaaagcg cggaaccccg gaagcttaag cttaagcgcc agggaggaag aaaggggtat    285600
     tcttgaccga tcaaccaact cgaaagaaaa caacggtgaa cacactccct ggtggcacag    285660
     agaatgggag tggagagggt gagagagctt aagaaagcga agtggggggg agggaaaaag    285720
     ggggtttcga gctatgttgt aataagaata ataaccaaca ataaccaaca agataaatat    285780
     aaaagcaacg ggtatggata aactcagtac ttttgagaaa gaaaagagaa gaggaagtga    285840
     ggaagatgat ttgagatgtg ttggtatgca gaactgatcc ctttcaatct cccggagtta    285900
     cctaagagag taagagtatc gtgagtatcg tgagtatcat agtatcatat gtattctgtt    285960
     tctttccagt cttttccagt cttttccttt gcttttctac atattaaaag tgcatcgcgt    286020
     ataaagaaat ggatatatgg actatttgta gtacaaagcc gccccggcat tcggcacaac    286080
     tgtggtggaa ccagagcgat atgaaagtga ttgagaacta ctagaagttg ctgtgtataa    286140
     tgttttggat gtccagggcg acccctggaa atcgtctcat acttggacag ttggactgct    286200
     ttgatttctg tttcctattt ggtttgagac ggattctatc gtgaaaaaat gacctagact    286260
     cctgtaaatg cgaccgcaat gagtataata cagaccaaat gaaagagaag agaaaaggac    286320
     gccagtcaaa tgaggtacag aatagtacaa ttaggcaatg ttgccagcca tgcccatgaa    286380
     aatagcctgg gcggccagct gaagggacca aaacccgact ttcttgaacc gccttttccg    286440
     ggcttggtca tccacgacat ctcgagcaaa agcatcgtag gtctgaagaa gttatcagca    286500
     atgatcggta tagtaggaca caaaagaaaa ggtacttact gcagccgaca ggtcatccat    286560
     caggccactg tcaaagacgg tccagcttcc atcgaaatct ccgacgcgct tgactaagcg    286620
     gcaattgatg ggaataaagg tgcgcttgga gttaatgtag gcaacgatag gacggatcag    286680
     tgcgttgttg atgtaagaaa ggtcccgggt gaagatgggc actacagccc gaacgttgtt    286740
     gaggtgcacg cgcaaatcca tggcgaggaa acgtcgatcc tcagtctctg attctggact    286800
     ggacgacgaa gatagaggct ccgggtaacg attggtggtg acagtggttt ccaaccgatc    286860
     ataaaaatcg accatcacct tggccaagct ctcatcattt tctgcgggta acatgatgtc    286920
     ggccacaata tctacagtcc cttcatgaat ccaagagaaa gggccctcaa caccgcggtt    286980
     gagatggtcg atattgagtc cgtcgactcg aatcctatta tgtttcttcc acgggcttgg    287040
     tttgccgtct tcatccactt cgctatcctg ccgaataccc gtaaatccat gggtttggcg    287100
     agcgtggatt gtgaacaaag agttgtcata agacccagac atcatgttag cagagaggaa    287160
     atcgtagaag agccattgct tccgcagctg agggaggtcg catgagaaga tgctaacgga    287220
     gaagggacgg aagttgtccg gttggtaaac ggtgacgagc aggtcatgca tcttgaaaga    287280
     gtcgatttca aagtcaccgg gagtatgttc atgtcgatag gatttaggat ccaagtcctc    287340
     ctccggccag taaacatggc gacggtcgac gacaccccgt atgcctttca cctcaacatc    287400
     atgcagtggg ccctttccat tcagccattt ggtaaatgat aatgtcacgt tgaccgtctc    287460
     gatcgacaga tcaaattgtg tgtagttagt atcttcctct tcatcagata ctacctggga    287520
     atcttcgagc ccagtgtcac ctcgagctgc agccgcggct gccgcagact tcgacgagcc    287580
     cttactgaca tgaccggcgc cttggcctgg tcgttttgac acaaagacat tcttgaaggt    287640
     gatgacgcca tttttccatt ttggcacgat tgcagattca aaaacaacct tgactccaga    287700
     agacttggtt agatagttgc ctacccaccc tgccaatgtt tctgttcaag cacattagta    287760
     tccaggcctt actgcaacaa gaagtggacg taccctgagc aaagactgtg ttgattgcga    287820
     ggatcagaag cgagaagaaa gtggtagttc ccacgacgac ccagacgatg tggcccagca    287880
     aaacccacga gaatagggca gcaatctcat ccaaattgta aggacgaaca cttcttatag    287940
     agaaccactt aaatcgtact ttgaggcgtg accagaaccc agttgctgcg gccaagagct    288000
     cctctttggt tggccgatgt aggtgaggca tatgtggtaa gcgatccatc aagtggcggc    288060
     tgttcgtagt tgattgttga gtgtcttggg atagtttggt ttgtgaatgt gtggtggatg    288120
     tatctttgcc ggattggcca agggtctggg gacggtcatt ttcattgcgt tcatgagtgt    288180
     ctttagaagc ttgttccccc cgttgatggc cgtctgaggt atgtaaagtt cgcttccaga    288240
     catactgggc ggcaattttg ggagaggaga tgatgcatga tgcagttgtg tccgcagcag    288300
     tggaagtagg cgagacgccg agaacaaaga agccaccaga agcgaatctt ttagtgaacc    288360
     gggccggttt cgctgggagt gtcgaaatac gccgcgagtg atttggaagg gacgaatcga    288420
     ggaataatct tgaggtataa gcatccgggg ccgatacgcg attcattcgt atgcgaccaa    288480
     caattggatt tgctgtatcc cagatatggg cgtacagccg gcgtcccaga ttggcagaca    288540
     tctttgtctt tacatactgg acatgaatga gaaacttgac agcaaggtag gacaggcaca    288600
     ctgtattatg aacagcagtt gacctgttga caagaagctt ccaaacttgc gagagttgcg    288660
     aggaaccgga atgaaatcat cggagtttgt catgtttgca tcaaaaaatt cccttccgcc    288720
     cacacttcat ttttccgtga ggggggaact gattaaattt tgcgataaca gattttatga    288780
     aggaaaaaaa aaacttcatt ctttaatcaa cacaatgtcg gcccctacag ctattcgcca    288840
     gtcagagcag cccctagggg ttcagcctga gaccatctct catggttagt attcgatctg    288900
     atctgcaaaa ttcctcttca tagctgacaa tcaatagatc aagatgatga agttttgatc    288960
     gatgttcaag ccacgaacga ggacgctccg attaaccccg tcgctgagac tgccggggac    289020
     agcgaaatgc gcatcgacga ggaaggtcgc cctgtcttca ccccggccaa agacgtggct    289080
     accgcgtatc ggatcgaaac acgaaaagtg cctgtcccac cgcaccgtat gaccccgctt    289140
     aaagcgagct gggccaagat ctgccctcct atcgtcgagc acctcaagtt gcaagtgcga    289200
     atgaacatca aaagccgatc agtcgaattg cgaacctcca agtttaccaa cgatgtggga    289260
     gctctgcaaa aaggtgctga tttcgtcaag gccttcactc ttggcttcga tctcgacgat    289320
     gcgattgccc ttctccgact tgatgatctg tacatccaaa ccttcgagat caaggatgtg    289380
     aagactctga acggagaaca tcttggtcgt gctattggac gtattgcggg caaggatgga    289440
     aagaccaagt ttgccatcga aaacgccagt cggacacgag tggtacttgc agaccagaag    289500
     attcacattc tgggtggatt caagaacatt cacattgccc gagaggcgat tgtcagcttg    289560
     attttgggta gccctccggt aagtcctggt cgtataaacc tgaaaaggaa tccttctaac    289620
     aaaaaaatag ggcaaggttt atggcaacct tcgaaccgtc gcctcgcgaa tgaaggaacg    289680
     cttctgattc cacgactcat ttatctcatc cggcatggtg tgggcgttca ggtgcatcag    289740
     gttttacgct gtcttctttt ttcttttcct tgaccttaga ggcatgacga cgtataacgt    289800
     aaagatatca attcatggaa atttcattca tctcgattat gtgtttgtga ttaactgatc    289860
     acaaaagagc cccggccctg ataagaaggc ctcgatctac catgttccaa tagtctaatc    289920
     ctgcttcagg gcatggaaca cctcctcaat tccttcccgg gtaacaataa ccaattgcaa    289980
     gccatcgcca acctcgatat gtctctctac ggcacttgta aaggcatcct ttacaagctt    290040
     cgtggccgtt tccttgtcca gaggctcagc ctttttggga acaagggcat gtccttctcc    290100
     gcttccgggg atgtattggt tcttggagtt gacttggttg tccaggaaag gcatgatcaa    290160
     gctggatgcc gcaccggcag cccggcactg ttcccgctcg taagagccca ccgggtcgta    290220
     gctgtacaaa gcccccacgc cttcctcatc cagaccagcc agaatagcat gtacgtagta    290280
     cgggaagaat cgcttctcgt agaggatcgt cgacaatcgc tgtgcacatg ctcccactga    290340
     catggatttc ccatgttggt acttgtacat cctcaccatg gtgtccagct tttccttgag    290400
     agcatttcca tcggcggcaa aaccgacaac agaaagaatg atattagctc cctcgccggt    290460
     ctcatcatca ccgccgatct tgaagacttt ggggaccatg cgagagttga tattgtagcc    290520
     tgatgtggaa cgggtgtcgc cggcgaggat agcgaaatca gcacccgtga taccgagggt    290580
     ggaaccgcca ttatcggtgt aactagcgta acaattagcc aatgttactg cttggtttgg    290640
     tcaagtcgtt ccttacgggt aaaacgagtg ttgtttgaca ttagcggatg ttggctcaga    290700
     gaaggagtat ccgatagtcc cagagtggtt acccatgagc gacgtcatct tcggagagat    290760
     agagctttat ttcaagaaaa tatcaccacg gcagtctgat aggaaaattt aaagtgttgg    290820
     atgtaaaaga ttcttgagat tggggagttc tggaagatgg agagcaaaga agctgggtgt    290880
     ctgacgcgat gcggtagctg ccttttgatt aggtaagaag tccaagctcc ccgagagccc    290940
     tggagggctc gatatatact ctcgctgcct cgtttattcc tggacgttaa gttgtcatac    291000
     tctgattcga aagaaagatt gctcatacct tggagcttat tctgctgtct tgatctcctt    291060
     cagtctcgac acttctactt ggacacaaac tgcggcgtga tgcttggtct tggtgactat    291120
     gagagcagca gtgagggaga ggcagagcgc aagggtcatt cacccagctc tcaggtattt    291180
     tgagccccga aagagcagca tcaggagctg ctaaccccga agcaacagcg caacaaggat    291240
     attccaccta tagcctcgca agctggccag aacgaaggta acatgcctct taatactccg    291300
     gatcttaacc ctccggggga ccagtaagct ccaagtattg gcgctgacaa tttacccagg    291360
     tcgtaaacca tctctccatc aaccaaaaga gacacgctct catgttgcga gcgattcagt    291420
     cccagaagga cccgtccttg gccccgctgc tatcgacatg gcgcccctct cggaggacaa    291480
     gcattcgaca agtggacgct catctccctt ctcggcttcg cgaagtctcg ttcaagacct    291540
     cactctccct cccgttccca atctagacat cccaccatca cctcccgggt ctcctaaccc    291600
     agccgcaaac gcgaaattcg agcatttcct ctcgctcaaa aagcaaggcg tccacttcaa    291660
     ctcaaaactg gcctgctcgt cgtcgctcaa gaatccaagc ttgctgaaga agatgatgaa    291720
     acatgctggg attaatgagc aatcacaata cgacacatcg ctgccagccg atctatggaa    291780
     tccctccgat ctgcccaaat ggggtttcaa ggaagagctc ctgaggactc agcaagattt    291840
     ccgtaaacaa tcggaggaga aaaaggcatc gggccagcga agctcggttg attttgtcac    291900
     tggatctgct tgaggattca ttcagcggga accagaccac gaagaccgac cttacagtgt    291960
     gccagctctc ggatggtatg gccgaacgac ctcgggcata tcttctttcg agaaatgcgg    292020
     acattccata ttataacccg aaagggcggc tggagcacat tacctgaatg cttcgaatat    292080
     tcagtgacgc agtaattgcc taccctacat gggaacttcc gttttggcat cctaggattc    292140
     aagaagaact tctctatctt cgctcaaaat ccaagactat gtgcccatct cggagcaaaa    292200
     tactggtggt acatccaatg actctaaaaa gagtcctgga aagaggatca acagtacgct    292260
     ttgattgaca tattgacata gcgcacactt ggactcgtgt atactatcat acttgtggat    292320
     catacattgc aacaatgacg cttgtttcag cctcctcctc ctcctccacc accaccaccg    292380
     gctctgtgtt tgcgccgctt cgccttctca tacaaactta aacaagtaac caaagccatt    292440
     cgatcaaagt cctctccgta ttccactcta atttgcagtt tcccacctct ttctagcccc    292500
     gccgcacctg agaatacggc cagaagctgc tcggtgtgct catccacgag cttatagttc    292560
     tgaccggtcc atttagacgg tgctgaatct tcaacgccaa tggtacgtgt tcgcttccac    292620
     aggaatgacc gcctcccact ctgagtttga tcagattcgc attgaactgt catttcgaag    292680
     cggtatttcg gtttgcgaat gagttccttg gtcatgtcct cccactggac ggcgttcaca    292740
     tcgtcggtgt tcccaatgcc tattttgtaa tcgccggacg acttagcaaa tttggagacg    292800
     gccacaattg gacctttgct gctggtacca gcatggagaa taaggtcggg cttgtttggg    292860
     gtgaactcag atacttcgcc gtaaaataga ggctggttat ctgctgagtt gatgtcatag    292920
     tgtcggcgga agaactgatt ggtgatgtta tacacgcgcg aagggacatt gtcgtcaatg    292980
     ggaggggcag atgccgttga cccagcacga cttgagcccg gggaagacat tagattttcc    293040
     agagataagt atagatattg aaaggttgtt aaacggagtg aggtactgcc gggggccgca    293100
     gatctattta ttatgcgaga ggtccataag ttttgaggcg aagcatgcta ccaaagaaag    293160
     tccctcagga agcgaatacg agcaccaaat caggttagac gacagtgcgt atgttgtaca    293220
     tgtattaaga cctcgagagt aaacttagat acacaattat agtgtaacta attctagagg    293280
     gtcgtattta gttagttagt ggatagttaa ctatataaca tagttggtcg acatcctccg    293340
     ggctggatga ccgcgaatct tagtcagcca agctctccgt cagctcgact gcctaagata    293400
     gctccccatc tatcgtcatc actttactgt gctatccatc cgttgtcttc cctccttgtc    293460
     tgcaatatac ctcccttttt tgagccctct tgaagctgcc attcatcttc attcattatg    293520
     aaccacttcc ctgaagcttg gggccgcgta tgtggcacaa ctttcccagt ccttgctctg    293580
     ttgctaacta tccgtccagc ccaggaacga tgtctacggt gcctacgatc actcatattt    293640
     gcagacctca ggtcctaagg cccatacctc atcccctgca gtgacgggaa cgtcagtggt    293700
     gggcgtcaag tttaatggcg gagtcgctat agctaccgac aacctgggta tgccattcca    293760
     ttatcccgtt cggtttcctt agcattgcca tctgacatga tatgatttgt atgaatatag    293820
     cctcctacgg atccctggct cgtttctccg acgtgaagcg tctgcgtaat ttcggcgata    293880
     aggcaatggt tggctttggc ggtgacgttt ccgacatgca atatctcgac cgtctcctag    293940
     actccatgga tatcaaggag aactactcgc atcatggcaa catgctcaac gccaagaacc    294000
     tgcacacgta ccttgcaaag gttttctaca aacgacgctc cgagttcaac ccgctgtgga    294060
     accacgtcct tgtcgcaggc tttgatgggc aaggggagcc cttccttagc tcagcagatt    294120
     tgctcggaac aacattctct gctcctcacc tcgctactgg cttcggtgct catcttgcgg    294180
     ttccgatcct gcgccgcaag ttccccgagg gtacccctct tgagcaagtc agcaaggaag    294240
     atgccgtcga ggccttgaag gagtgcttga aggtcctgtt ctaccgcgat gcacgaagtg    294300
     ccgacaagta ctcgatagct gtgattacga aggatggtat tgacctgaag gaggatgagc    294360
     agattcaggg tcagagctgg gcctttgccg agagaatcag gggatatggc gcccagactg    294420
     cttagatcct aatttatgtt tttcttttac atgtaatgca cacgggacta cggatgcaaa    294480
     gataatcttt tgggtccaaa taacgatgat caattgcaaa gactgaaacg tacaggtagt    294540
     tatatacaac ttgaaccagt gccaacccgt tcgctggtct caaggcaagt tcaacggaaa    294600
     aataaattta gagcttcgag ctgggcttgt caaagaccac ccggttgaca caggacccga    294660
     cgccctcgag cgacacctcg acttgatcgc cgtccttcaa ccacaaagca ggcttgcggc    294720
     ccatgcccac accctggggt ctgtcaaacg gtcagcctat caaatccaaa cggctatttt    294780
     ctttctcatc gggatgtact tacgttccag tgaagatgag atcaccaggc aagagcgtag    294840
     ttccctgaga caggaaagct atcgtcttag ccactccgaa gatcatatcc ttagtcgagg    294900
     aagactggac cgtctgccca ttcaacttgg tcgagatagc caggttattc ggatccgcaa    294960
     tgacactgga agaaacaatg ccaggaccaa acggcgccca tccatcaaag cccttaccca    295020
     gtccccactg gcctccaccc cgcttgatct gccaatcgcg gtgggaaaca tcgttgccga    295080
     cagcatagcc cagcacatag tccagagcct tgctctcggt gacattagtg gcctctttgc    295140
     cgataacggc gaccagttca cactcgtaat ccagaccctc gccctcttgg gcaagttggg    295200
     ccacggggat atcgtctcca ggtccggaaa tcgaggtgac gggcttgtag aacaacactg    295260
     gatacttggg aataggcatg ttcgactctt tggcgtgttg ttcataattg agacccagac    295320
     atcggactgt gccaatatcc ttacgcgcca ggggtgcgag aagcattctc acatctgcaa    295380
     cctggtcggt aatccggtgc tggccaaaga tgtcaccctg gatgactctg gccttggtgg    295440
     ctttggcgat atcgctcact cccgatggaa gaagggcatc gccgtaatat atttggccat    295500
     ccttggccag gaagcggatg aggcgctata tagggaatca gcatatgttg ttgcaatagt    295560
     actttccatc acatggttga ccatatatat acacgcatat atatgcgtat gtatgtatat    295620
     atattgtttt tgtctattta tttgtattca aatatagatt gatcttcaac tcacagtaaa    295680
     agtagacatt gtggaatctg aaatatgggg aagttggagg aagttcgagg ggaagctggg    295740
     tctgatatga tatctccact cggccgggaa aagacctctt tttcctcaga gcgggaaaca    295800
     cacccagctc cgtccaatga tttgcaggct ttttctctct tcatattgaa gacaatggct    295860
     agactctccg gtctccagag ggatgttctc tctctatacc gaaaatgcct acgagagatc    295920
     cgaaataagc ctgaagtggg ttctatcgcc tctcacctca tcaactgata cttacttact    295980
     tcattgtagg actccaggat caatttcaag agatatgccc ggtaagacta tatcaattgc    296040
     ctatctgtct ctctgcctat tcccctgtcc tctcctttca tttccttttt tcctttcccg    296100
     acggcgttcc ccctagatat cggtacaatc cggctgagac gggacatcta cagggcagag    296160
     ttccaaaagc atctttcggt gaacaagaaa gactttagca ccattgaata tctcttgcgc    296220
     aaaggccatc gacagctcga gttgtatgct accccgggaa tccgcaatat ccgatgagcg    296280
     gacggggcca gaccccggaa tcttacttct tcagggcgaa ttacacagct ggatttgtat    296340
     gtatcacgcc ctttcagccg cctgtctcca ccagtttact tattgatata gaatcggaga    296400
     tctccagggt cgccggtttc acccgggacg gattcctgcg agcatgttga acaaggcaaa    296460
     agggatggga tgtattgagg cctggttttg aaggcatctt gtataatagt aactaaccag    296520
     ctaactaact ataactgtca tagactgttg tgtcattatg gctttgtcat ggagtgttct    296580
     gcccatatta ctgtacaact attgactcat tgcgaagccc ttggaagttt cgaggttcaa    296640
     gattaccaat tatggattat tcaaactcgt gtaaattgca tttgtcagag ccaatattat    296700
     tagattggag ttattcgtgt atagaatgta tagaatgggg tggttgtgcc ttgaagttgc    296760
     tggcggctcg tcgaacgccc cacaagtttc tggatgcttc cgcatggact ataagcaaca    296820
     ccatatacaa gcaagaaaga tataaaatgg cagatattcc aggacaatta gaacagaaca    296880
     atcaatcaga acacaatctt caaagcctct cagatactct ctatccttcc tacaacctca    296940
     aataacttcc aaatccaaaa caatggcctt cttctcccaa tccggtcttt cgccactctt    297000
     cctcctcaac gactacgagg ccccaaacca atacaagcct cgcaaatgtc ccaagtccta    297060
     ccagtgttcc aagctccaag cacgcagttc ctttgcacca gcatttgacg tgcgcgagtt    297120
     caccaatgcc taccacctag acggcgaact gccaggcgtg gaccagagca acatcgagat    297180
     cgaattcacc gatccccaca cactcgtgat caagggccac acagaccgcg agtacaacag    297240
     caacaacggc aacaacgacg ccacctcaag ccgcagctca tctcctgcag gctggcacca    297300
     agccacagtc gaagacgaag atgcagaatc aactagctca gccgacaccg ctgcttccaa    297360
     gactgcttct gcttccgctt cgcacaccga gaaaaccgag actgacaagc ctcacttctg    297420
     ggctaaggag aggtctgtcg gcgacttcca gcgcactttt agcttcaccg cgcgcgtgga    297480
     tcaggactct gttcgggcga gtctgaagaa cggtgttttg tctgttgttg tgccgaagga    297540
     gccgactcct acaccgaaga agattcctat cctgtgattt gaaatatgag atcattttat    297600
     ggctgttatt ggcttgaaat ccatgactcg gtataatgat tgcattgggg atctcgggtg    297660
     gcgtttcttt ccttggggtt tacttctacg atctgtcttt gctatgataa ttaatcgaaa    297720
     ttgacattta ttatatttac tttgtatttc atggagacag gtagtatgca tctgcattat    297780
     ttggtaggct gtagaggact gagccacatt gaccctgcgc ttaattcccc ccttgcttga    297840
     ctcgataaca ttacttcgca tccaggaaag gccctgggcc actgaaccag ccacagcgtg    297900
     aagaagatgc ataaggcaag atagccgaat actgagatcg tatcccaagg gggatatgca    297960
     tgcattttgg actagactaa atgggccaag agcctaaaat ttgccaaaca gtagcatatg    298020
     gtatatggca tacagaattc atggtttcct gttcaacgcc agatattaac cacgccaatt    298080
     ccacttccaa ttccaaaagg gtatagctag taagactcca tatccaaaat gtgtcctaaa    298140
     ctcctgaaag aaaacgcatt aactccataa tgaacttttg tagccgccat agacgaacaa    298200
     gccaagatca aaataaaaat aacatccaaa cgggaatagt caataaaatc attaccagaa    298260
     atgtcaataa ccaaaagaaa ggaaaaaggt cattataggc acaaatccgt ctggcgacgg    298320
     accttcgtca accgacgacg gggatgatca ttgtttcgac tccgagaccg gcctcgcatc    298380
     ggctcagagg gtgttaattc agcatcaagg tcaaggtcat cctgcaaata tcctggggcc    298440
     gcgacagtgg gtagcggagg aacatcaaca cctggtttct tgctccagat gcgacttccc    298500
     cgtcggcttc tggatcggga gagttgcgca ttgtactctt catggatttg atactcggag    298560
     gtcgatctgc gaagccgctc cttggcttcg gtagttgact gttggcgact gagttgtgaa    298620
     tccccagtcg cggcagaccc tgtagaagat gcaagatcaa acgagcccaa ggacaatcga    298680
     tctccataga aaggccccct ggtaaaccct tttggagtct ggtgtggagc ggagaccaca    298740
     gtggtagacg tgacttcgaa cagggattca cgcggcgaag aatattccgt gtatcggggc    298800
     gcacacaaag tggaccgacg cgatcgcgac ggagcgaggg ggtttggatc gctcgaatcg    298860
     taccagcgag cagcggctgg atacaacctt gagtagttct ccggctttgt ctgcaggctc    298920
     agaggacgct gcacttgatc gcctgatcga cctgaagccg agtctttcgg ggtacaaacg    298980
     ttttttgagc tgtctgcacc gcaagagcta gacgtctgtg aaccagaaga actgtgagtc    299040
     cggctccgtt gtatcgagtg gactgaggtg gcagagctgt agccactgtc ggacttgttg    299100
     agggattggg acgtgctccg ggtaagacca gcgtccataa cacctttctc caactggatt    299160
     ctcgtatcgt cgaagagggc aattccttca tcttccggat ctccagaaga caatgatttt    299220
     gttcgaggct ggactgtgat ggttggagac ttttcgaaag agaatggact gcccggaaca    299280
     tcgtccgttt tcttcacgtc cggtaaggat ggaatctcca gtgtcgaccc cctgctgggc    299340
     cctacaactt ctatgttctc aagaccaagc ccagagcctg gagcgcaggg cccatccaga    299400
     ggaacgcgtt cactcggaca tggggaggcc gagccgttta caacccgcaa agaccccaac    299460
     ttcagtgccc cgagctgagt ataccgggca tccatcggac tcggcggccg cactggggat    299520
     ggtagacgca gcgatctagg ggtcgaaggc aatggccatt gcaaaactgt tgactctgtc    299580
     ggatcctcga tcgggcattc aggctctcca atgggcgatg ggacgcgccg aattgcgctt    299640
     gctgttcgtc ttgtggcaac cccaggtcga gtcaggagcg atcgccgacg cgttaatgaa    299700
     aaccgttggt tgccaaccaa gaagtgggtg ttggaagatg tcgcatcccc gatgtgggtt    299760
     tcatagacag cgctgttgtg tctctgtagg ggagttcgag tcgaactggc ccgtcttggt    299820
     ggctgttcgt aaagaggcga ggattgggaa gatgagcaag tttcggactg gtacgatgtc    299880
     cttctcgaag agcttgcgct caacaggctt gggcgggtta gatggcgctg cgtgggactc    299940
     tgttcatata ccaaggttcg atcctcagtc gggctctctt cggacgactc tgtttcaaaa    300000
     agggtaggtg ggatctcagc tttcttggga taactgcccc gtttttccac aggggcgctg    300060
     gagatactgt tgccaaccca agggttttgc caccctataa gccctgaatt gagcgtcggg    300120
     aggtctgttt cggggcgttg ggaacttgga ccggcattaa actttttcgt caagggcttt    300180
     gaaaggcggt tggagcggta ggtctcatct ttggctttgg tcgagtgagt gttgcccatg    300240
     acttcaaaag cagatgcaat gcaggtagat tcagatttgc tctggccaga tccaaccggg    300300
     catgtgcagg gaagatggcg agaatgatat acaagtagaa taagggcttg gtgacagcct    300360
     ggcgagcact gttcccccgc acgacggggt gacctaggtc tgggatttcc aagcttgacc    300420
     cgatagagct tttctgatta gatcgcaccc cggacttctg acgtcaagcc acgccctgat    300480
     tgcccacaga ggacgcaatc cgagccccaa gctcgtgcaa ccgctgggat tggaattgag    300540
     tgtacgattg gcggctccgg gttctccaac aatcccggag atgatggtcc gtgtttcaga    300600
     ttgggtgcaa tacaggaatt ggttggactg gagagatgga agacagatga tgcgcaggat    300660
     tgaggtaacg tcagaggcaa ataaccaatc ttggaagccg gggagtccct ttcttgcttc    300720
     acaaagcagg atttgatgat ttcaagattt cacgatctct gtttttccgg ggaggttggt    300780
     agaccagggg gagatcaaaa tcggcaaata cacaatcaga tattaagatt atagacaaat    300840
     tgcaaatata aaaagaaaaa aaaagcacga aaaaaagaaa aaaagaaaat aacagtagga    300900
     agtggtgggg gaggggaata gtgtcgctgg ggaaggggga acatacgata cataagaagt    300960
     ggagagagaa tcagacaaac gaagtgtata tgcaactaaa cgctagaaac aaaagaagac    301020
     gcaagcattt cgccacaaaa gttttctata cgcacatctt gcatcagatg aagctgcatg    301080
     cagttgcagg agaaaagagg aaaatatctc cacgcgggac ggagggaaaa aggtaccgcc    301140
     tccttctacc gcaaccgggg catagaggta ttcagtactt aaatttaata tacaacaacc    301200
     atacatcaac aaagtaccag atacctcttg gcacacctag taatcttcca caactccatt    301260
     gtttttcttc ttccccttct atatccggtc caccgcaatc agcttttctt tctcgttttc    301320
     tctttttcaa tattggattt atcttccagt atttctgatt tgacgtataa caacaggtca    301380
     ggtcaggctt actcttaaac ccgtatcctg gcacaccgcg ttcacagctg agcatctgca    301440
     tccggacact gggtacggag gaatagcctc ctccagccgc atggctgcat tttgctctgc    301500
     atttcccttc ctgacacagt cggagtttga gggtgcatgt caagatctcg ctgatcgatg    301560
     cacttcagcc caacatattg actggtccgc cattcgactg ctcacaaagg tatccctttt    301620
     ttttatgcat gaaccattaa accttatctg gttccttatg tatgtattga atgaagaact    301680
     gatgggaaca tatggtttgg atgaaactag ccagatggaa ccagcctcag aataacaaaa    301740
     cgtgttgatg tccccagccc gctagaagcc ccagcgctgg accttgaaga atcacaggaa    301800
     gatgaggatc cggtctgcag agctctggcc cccaagggac gtgtccactt gtcctgactc    301860
     ttcaccgcag gaagctctcg ttcgcgccaa accccagccc agtttacaga tcgattatga    301920
     tatcttgttg tcccccacat atcaggtccc cgtcttgtac ttcggcctga ggtggcacaa    301980
     ccacggccca ctcggactag acgaagtcta ccagtatgtg gtgccggaac agtacaggca    302040
     acaattgaag agtgtgggtg taatgggtgg gattagcatg ggtgtaggtg cattctcgga    302100
     acctcgtgac aagagctcat gtcttgtttt ttttttcttg tagtaccatc ctgactctgg    302160
     cgccccggcc ttttttgtcc acccatgcaa cactgcggat gccatggcga acattgcaga    302220
     cgcacagaac gtcactcctg ggtcatatct cctcatctgg ctcggccttg taggtcattg    302280
     cgtgaacctg cacgtcccac gcgagctcta tgcttagcct acataggaac tggagaggaa    302340
     gcaggttcaa ctacggccaa tggcggagag accaagaacc aagtcagaga acgtaagaaa    302400
     acaaatggat agtcatatgt agtaaaccaa taatagcctg gtggccatat aaagacacga    302460
     tattatatct gttagaaata tagaggcgct tagccagaaa gtgagagaca gttagcgctc    302520
     taccgtttag tgtatgtaca ttgcctacat atcctatagc ttcgggaggg ccttatgctg    302580
     atagaataac gatagaaatc aaaacttctg tcgggccact atacggcggc agataatgat    302640
     tgatcgagta gactagctgt ctaaaaagta cgcagaccgg ggtataacta gggcaatgtt    302700
     ccaaagaaag gacctatata tatcctaccc gattaaaact agagtaaaag aaggtgcacg    302760
     gggtggaaga cagcctacaa agctagatat aaagccccca cgactaagta agagggcgag    302820
     acgggaaaaa taggacgaaa taggaggatc ggaggaacta ctactgccga ttgactcgat    302880
     agcgaagtcc tatagcctag ttagctcctt ggtttgatgg cggggcttta tagggagcga    302940
     ccttatacag aacggctaga gtggcggaag tgaggtacgc ctggttcatg atactgggtg    303000
     tgatcataaa accacctccc cgcgcctggg aagagccctt gagggtcagc ctgaggtaaa    303060
     agttgacaac aacatcctat agtacaggtg tgggattcta tatatccatg gccgtataaa    303120
     gacacagacg ttgtatcagt cagagatata tacgacgccg cgtagcagta tatacggtag    303180
     gaaagaggtt taaaagaaat cttacagtcg agaggattag cagcctgaga tagcatgata    303240
     gcacatccat atcacaagac acttgtagat gacgaagtgg acttcattcc accgatacat    303300
     aaatcataga gtaccttacg atgtctactc cgattggacg aagcatctga acccatttca    303360
     gaagctgccc ttacaaagcc gaataacacg aagcttcaca tgggcctgtc tcatccaaaa    303420
     gcagggcgcc taatatagaa tcaatgtcag atatgtcata ttatggtaaa tactcactcg    303480
     aagtaccagc caatactttt tcatatgctt aaaacgctgg ggaataaaaa aaatcaaatg    303540
     taaatcgaaa acttcatgtc tcttcggctc tttcagtccc attcataagt ttactcctca    303600
     tctgaggaag cttccatagg cacgtcgcta tcttcgtcca tcggagcctc ttcgttatcg    303660
     ctttcctctt cacgcggtcg cttcaagcca tgagtctctc cattggcacc ggccgtgggt    303720
     cgtggaggga gtgcacccgg aggaccactg aagatagact tttggaggtc tgtgatgact    303780
     ggggcttgtg cagcctcaac tggcgcaacg tatgtgccac gaagtttgga aatgacattt    303840
     gatgatccct tggcgtacac gattttctaa acatccaccg attgagcagg gtttgcgaca    303900
     agagaaggga gatgaaaaca taccatctgc ttcccgaaga actcgaatcc ttgtaaagcg    303960
     cgcagtgctt gcgtactagc ttggacatcc ttgaacacaa tatgggcctg gcctcgcatt    304020
     ttgctcgtct tcatggccac gacgtcgaga acggtgccgt atgtggagaa tagggaataa    304080
     agtgccgtcc ggagatcatt tttctgaatt cttttgtcgg gcaaatttgt gcagtagagt    304140
     ctaaaaattg ttagcaacaa tgcgcgacag tctcctgtgc ttgtaagggc aagctcacgt    304200
     ctggttagga gcgccgggag taacggcctt gctgtcagga cctccacggg caggtagaga    304260
     ttttgaagcc atttctcaga cgattagaaa tgtcgggtac gctgtcgtct ggttaagaga    304320
     gtaaatggga caacgatggg aaagtgaagc tcaatcgcgt gctgtgtcca cggctcaaaa    304380
     cctcgacata gttaaaagta gcttggggtc atgtgatgaa tgtccttact aagcaccgcc    304440
     gtcatccccc agctcccctc ctggtcccgc aactacaact aagtacacaa gcacgacggt    304500
     agagagaccc tcctgtcgtt attatctcaa atatggctgc tcaccaggtt caccatctct    304560
     tccacgcacc aattgcagac cactcgttct catccgacaa gaagacactt gctgtcgctc    304620
     gggagaacaa tgtggagctg tatcaacaat caggcaacaa gttcgcgctg agcgatgagc    304680
     ttaagggcca cgagaagact gtcaccagcg ttgacattgc cccaaacagt ggccgaattg    304740
     tcacttgctc gcagggtacg ttttataaat ctccttttac tataccatgc acaatacctg    304800
     acagatgtcc actctataga ccgcaatgcc tacgtttggg agcagacccc caccggatgg    304860
     aaacccaccc tggtccttct ccgaatcaac cgtgccgcca catttgtgcg ctggtcccca    304920
     tcggagcaga agttcgccgt cggctccggc gctcgagtga ttgcagtctg ctacttcgag    304980
     gaggagaacg actggtggat ctcgaagcac ctcaagaagc ctatccgcag cactattaca    305040
     accctggcgt ggcacccgaa ctccgtcctg ctggcagccg gatcgaccga ttctcatgcc    305100
     cgagtcttct cgagcttcat caagggtatt gatacccgcc cggagcccag tgcgtgggga    305160
     gagcgccttc ctttcaacac catctgtggc gaatacctga atgataccgc tggttggatc    305220
     cagggtgttg ccttctctcc tagtggtagt gcgctcgcct tcactggaca cgacagcagt    305280
     gtgactgtcg tataccccag cgctccggag cagcccccgc gggcgatgtt gaacattgct    305340
     acccgtttgc tgcctctcaa cagccttatc tggaacggcg agaccgagat cattgcagct    305400
     ggacatgtgc gtcatatctt tctttcagta atatcggctc gtgctaacca tatctaggac    305460
     tgtgagccct tccgtttctg cggtgatgag aacggatggc aacttgccgg ctctctggag    305520
     aataaggctg gagaagtccg gggtgcccgt gaggagtctg ctctgaacat gttccggcag    305580
     atggatctca agggccaggc ccaggcggac accaagctca agtctaccca ccagaacact    305640
     gtgcacacca tccgggccca cgaagaagcc aacggggttg tgagctcgtt cagcagtaag    305700
     atctacctcc tgaaaaccta cgacctacga gaaactaaca tattgttaca gcgagcggtg    305760
     tcgacggtcg tgttgttatc tggaatgtct gatttgtata aagagtacaa ataaagcgaa    305820
     gaatatttat cacccgtaac agtgtaggat attgaagtca ataaagtaag acacaaataa    305880
     ataagcatag aatgtccatc ccgcaatact attgaacatt gcagtcaata tggaagttat    305940
     cccgaaatcc catcttgccg gcgatacccg tggctctagc agagacaaga gccgatccat    306000
     gcccgtatac cttcctagac atgctcccct cgtgccttcc aagactgccc aggtgatcga    306060
     catgaggaag gcgatgacat aatggaatta ccccggattc cagtcacccg tggacgtctc    306120
     cacatcacat gctcttgttc tcttaaagat taccttcctt cctacacaac tcagcatgtt    306180
     aagccatggc tagcatttta ttcctctctt tactactata catcagtacc ctgagccctg    306240
     ccacagccct gagcaagacc atacatgtat ccaacgagct attcaactcc ctggaagagt    306300
     tatcccggat agtggacatt tcatactgcg tcggcacaac aggagtacac caaccattcc    306360
     agtgcctcag ccgctgcatc gagttcccag atctagaact agtaaccgtg agttaccaac    306420
     ctccaaccaa gcactatctc caagacacaa accactaacc caacccaacc accccgcaga    306480
     cctggaacac cggcctcctc ctatcagact catgcggcta catagccctc tcccacagtc    306540
     cctcctccaa acaaatcatc ctcgctttcc gcggcacgta ctcaataaca aataccataa    306600
     tcgacctctc cgcctatccc caagcctaca tcccctaccc agacccggaa gaaaatacca    306660
     ccactacccc gaatccaaca agcccacact gcgaaaactg caccgtccac gcgggcttca    306720
     tgcgttcatg gctcgaaacc cgacccacaa tcctcccaca gatctccatc ctacgccaaa    306780
     aataccctga ctacgccata accctcgtag gccactccct cggcggcgca gtcgccgccc    306840
     tagccggcct cgagatgcgt ctgaaaggct gggatataac ggtcacgacg ttcggggagc    306900
     cgatgattgg gaacggggcg ttggcggcat tcatcgatga gcaattcggg ctcggggatg    306960
     ggatatcgat tcccccgctt gatccccttg atgggggtat gcgttttcgt cgtgtgacgc    307020
     atgtcgggga tccggttcct atgctcccgc ttgctgagtg gggatatcgg cctcatgctg    307080
     gggaggtttt tattaagagg gagggattgc cgccgcgtag ggaggatgtg gttcattgtc    307140
     ttggtgcggt cgatccgggg tgtattgcgg gggagggggt ggagggggtt ttggttgagc    307200
     tgtatcggga tttgaatgtt gttgggttgg ctggttctgg tggggagggg cgtcggtcga    307260
     gtgatggtga tggtgacagt gatggtgtgt ctgaggagca ggctgttttg ggaggggaga    307320
     gttcagatat tgctggttgc gaggatagat tatcgcctct ccgatgggat tggtctcata    307380
     taccggcgag gtatcggctt tgggagctgt tttatgctca ccgggattat ttttggcgca    307440
     ttggtctttg tgttcctggg ggagacccaa ctggatagag gatacctatc tggattagat    307500
     actggcgctg gttgctttgc tttgtttact attgatatac cctggatacc ccgttctata    307560
     catcatcaga cactttttct ttatgagaaa ccacgctctt tcaatctgat atctttcatt    307620
     ccatctctag attgttcgct gaaagcaatt gcaggtcgat ccaagaatcc agtcagaaca    307680
     gcagtgtaat tgtgtcaata taatgaaggc atacacccag gctaagaaat agacaagaac    307740
     cgagcagcgg atatacaaac acgccaaaaa gaacgagttc aaaaaccacg aaagaacaat    307800
     aaaaatgctg cgcaagaaag gacaaaagac atcgaaacaa aaagatccct cagtacaagt    307860
     ataaaaagga gaccgtcaac atcctcatca tcaccgacca tgatccaaac tcggcacaat    307920
     aacaggcccg aatttaacca cattcccaag agccccatca ccctgaacca taaagtccgc    307980
     cgcaagactc aatttactga ccccaccagg cgttacatgg ccataggaag gattaaccgt    308040
     ctcagggtca tacgcgacaa tagcgacgta gttccgacgc gccatgagct tgcggtattc    308100
     acgggcctgg ccgttgacgt ctgtctggaa gatttccatc atgtcttcct tggtatcgct    308160
     cacctggccc gaggatctgt ggccgttggc ggggacgtag agcggtttgc tgtggctgtg    308220
     taggagtttg atgatatatg atgggggcgg ggtgttgacg acggaggagg cgatgagttg    308280
     gtacattgtc ttgtggtctg aggggtttga ggggtcgtgg acgagacctg cgccgcagac    308340
     gttgacggcg ccggagagga aggtcatgcg gattgatttt tggtgtgcga tgccttgcag    308400
     tgtgcggatg agatatgtgc gttcgagatc ctggcgttgg gttagtatgg catggtttgg    308460
     atagggattg ggggaggaga cgaagacgaa ccttcgattc gtgcgtccat tgatcgcgta    308520
     gctcgtccat ggagttgaat tcgccaaatg gactcagtat accgcccatc aggccggatt    308580
     tgccgacggc tcgcttcact gagtcgaagc ctgagccgac gaactctttg gcgccgacca    308640
     ctccggctac cgagctagtt accttgccca gcacattgta cgcgccggtc acggctcgct    308700
     tccctgttgc gaccgtctgg acgatgtgtt ctgccgtctc taggcgggga tagatgagtg    308760
     ggacggagac catccagaga cagtgttgca cactgggtgg tagcattgcg atcttcggga    308820
     agagaccctg gtacgtggga ccggccataa cctggtgtgg gtttctttct gagcggcaat    308880
     ccggaccgac taccacgacg ccgggaccta ggtatttaac gaagtgccag cctgtgccgg    308940
     ttatagtgaa gagatccata tcgttgctga cgttacggag gatgtcgagg gttgtgtgat    309000
     gctggaagag gaggtacatc tcgatgccga tgcggccgat gttcttgaac atgttcgaga    309060
     attgcatgtg ctcaggatac gagccgaacc catcgaagct gcggaatacg ttagtgctgc    309120
     tcgctggttg ttgctgtgtg ggcgactcac atgtcatgat catcaatctg gcagacataa    309180
     gggatctgcg caaatgactc ccttatgtgg ggttgatcga agtggctggt atagtaatgg    309240
     aagtacgcgt gggaaacatc ctgctggtta gccgctgtcc aaggggcgtt ctttctagcc    309300
     tcttttccgc tgatagtcaa ccattgcttg agagaaggaa tctctttcca catgcgatcc    309360
     gcatagatct gaccacccag acataactgg gcgtggaagc ctccgatttc attgtgcttt    309420
     tgcatgatat ccttccacat gtaaccaacg ccacccaaac gagcccgctc accagcattg    309480
     acattgagcg agaagtcatt tccagaggta gcaataaacc gccaattggt ttcgtgtcga    309540
     ccggcgacga gaaactcgta gcgagtgcag cctaggtggg aggtgatggc gtaggtccat    309600
     tttgctggac ccgcatcgtc catctgaaga tcaacctcat acttgtagaa ggtccagcgt    309660
     tgatgggcgg caatgttgac tgccttcaat tgtctcgggt tgggagacag gtctagactc    309720
     tggtgcatgt gaatcgtggg tggctgtgcg gcatctgtca caagcaggat agatcctaac    309780
     cagattccac gctcgatatc catgttggtg taacgcagat aagggccaaa gtagacaccg    309840
     ttagttggag tgttcttgta cagatccacg ccgctactcg ggggaggccc agtgaatcca    309900
     gtcaccatcg gagactgtag actttcgaaa ccaggtgtca aaggcacacc gggtgacgct    309960
     aaaggcttcc caaaagctga cagacccggg gaaactagcg gatgggcgct atacacactt    310020
     cccactggag ataagggcgt gtcgttgaga ttaagcggtg taggtccctt cgggaactcc    310080
     cactgagttg actgtgtggg caaatggatg tagtaatact gtccggaact tgggtccatg    310140
     tgcgcaatcc atccctccgg aagaggtggt ggagacgccg gacctgcggc agagggcccc    310200
     gggggagtca cctggacagt ctgatgatgg aaaccggaca ggtcgttagc aacagacgcc    310260
     tgtggggatt gtcctatttg ctgttgctgt ctctgatcat tcgcaaaagc gggatggtcc    310320
     tgcggcgaga ctgctggtac aggggaagat gttttcgtaa caggattggg ttggtttgct    310380
     aaagccgggt gcatcaaggc ggctccagct ccagcagccg ctcccgttgc tgctgccgcc    310440
     gccgcagcac cgctttgctt ttcattaggg tatccattcg gagcagaagg accagataca    310500
     cttgagtagg cgggaggagg agatgagctg aggcgcatgc ggtccatgtc ttgttccagg    310560
     gcgttagggg gaattcgtcc tggttgttgc tgctgctgct gctgtagccc agctgcaggg    310620
     tgcgattggg atggagatcc attgtattgg ctatggtgag cctggggcgg cggactacta    310680
     tattgacccg gatgaacttg tggcggcggg gtgccatagg acccgggaat ctgcggcggc    310740
     ggactaccgt attgaccagg atgcgcagca gccggctgat tgtcatcaga gacgacctca    310800
     ccaccctgat aaaccgtagg agggccgtgg ggctgcgaac cgggctgctc agtaggagtc    310860
     cacgggcgcg gctgctgctg cggtgggaaa gtcggctgct gtccggagta ctgttctgcc    310920
     cgtctctgcg cagccacgtt atgcgactgg ataccctgca aggtcccggt acctgcgatt    310980
     cccgcagcgg catagcgggc ctctatgtcc gagcctggct gttggcctgg tccaacgaca    311040
     ggtgtctccg ggggcggggg cgagccacgc tgggcgcggg ttgtcgaggt ggaactgatg    311100
     cgattgagcg ggccctgtgg gggctgtaga ctggacgggg gccgggccgc agacgtggaa    311160
     ctttggcgtt gaggcggcgg gtagtattgt tgacggtaat cgtattgatt tgtgtttgct    311220
     ggtggctctg gtgggccagg tggttgactg gccgggggcc gagggtatgg tctggcagct    311280
     aaggcctcgc gatctggcgc atcatagcta ggagattcgg gcagtggctt aggggctgca    311340
     cctcttcgtt cggccaatgt tgcgactcgg ggctcacggc cgtcccgcgg ccggagcgct    311400
     gttgggtatt catttggact cacggagccg gagccaggac cagctggcgg agaaccatat    311460
     ctaacgttgt cgtgatagcg gtcgtttgaa cttgaggtgc gcatctgggg acgttgacgg    311520
     tcatccggat agggtagcgg ggcgtttggt ggggggctgg atcccgcggc ggatgctgga    311580
     gatgacgagt cccgtttgtt gatgcgtaaa gggccgacgg taggtgattc ttgcctggca    311640
     gggcggtcat tgaggaaaag ctcctcggga tggagggcac ggctgctgcc actcatggtt    311700
     gagaaattgc tgggctcgaa gctgcagaaa gacagaattc agccacagca gaatgcgagg    311760
     tactcccaat tacggagata agcgcgaaga tcgttgggaa gtacaccgta gatgcggggc    311820
     aatgggaaaa ggggcttttc atctattcat agaaattatc cgagaagaag aggaaaaagg    311880
     aaaaacaaaa aggaaagatg aagaagatcg gattttctgt aggcgccaag ttgggcgaga    311940
     cgccgacccc gcaggtgacg agaatcatca caagttgcct aggtgctgcc ttggcgtaga    312000
     ctacttctgt atcatatcac tttcagacta ttctatccag gttgcgacac aatatgcgaa    312060
     ccctaatgtg cgcagatgat atggcctggg aatgtgccga gaacatatct cacaactggc    312120
     tgcttcaatt cctgaaactt gacatcaaga aaccgatcgc gatgttcatc ctccagcgcc    312180
     atagaggaga tggtgccgag tttacgatac tcgaaaaagg ttcatataat atctccttac    312240
     gaatgaagta cgaaaaaaac catgctgttg tcatacggct cgctcagccc ggtgccgtat    312300
     ttttccccga ggaaaaagtc gtgaacgaag ttgctacgat gcgattgctc acagaccaga    312360
     catcgatacc tgttccattc attctaggct cgggcacgaa gaaggaaagc ccccttgaac    312420
     tgagcccatt tatcatgatg gagtacatcg agcacaaaac aaatatgtac gacgctctca    312480
     atacccctgg atgtccgaaa aaggatcgtg gaattctaga tccgaacatc gacgttaata    312540
     cgcttgagct tttatatgat cagctagtgg gtgtcctact tcagctgtca aagatttctt    312600
     ttcctcgtat agggtctctc acccaggtcg atgacttcac ctgggaagta tcgcgccgac    312660
     ccttatcaat gaacatgaat gaactggtac ggctaggaag cctaccgcgg tcgaaaattc    312720
     cccacactac attcagtaca gcttcttgtt attttgaagc ccttgcagac ctaaatattg    312780
     agcatctggt gcaccagagg aacgatgctg tggagtcagc agatgactgt cgacgaaggt    312840
     ttatagcgcg gcagctgttt cgtaagctcg ccagagagaa gcgacttact gattcaacat    312900
     tcgaacaagg tcctttcaaa atctggtgtg atgatttacg accggggaat atactactcc    312960
     atgaaaatat gcaaattgct ggagtggtag attgggagtt cacatatgca gcaccagttg    313020
     agttttccca cgcgccgcct tggtggttgc ttatcgaaaa gcccgagctt tggccaaatg    313080
     gcatggacaa ctgggaagat gtgtttagtc atcgcttgaa gacatttctt agggtgatga    313140
     gaagtcgcga ggacacggag attcaaaagg gtcacataaa cgagaaccaa cgcctgtcta    313200
     gtcatatgca atggagctgg gatagcggaa atttctggat cgtgtacgcg gcgttgaata    313260
     gctttgcatt tgacgcaatc tactggaaga aaattgatcc gctgtttttc aaggctgctg    313320
     gaagtcccga gacagcttgg aaggaaaggc tcgacctgct agccgagaag gaaatcgagg    313380
     agatggaaca actggttgtt cggaagctgg aagagaagga aaccagagtt ctgaaatggg    313440
     acccggatga gtatactgtt gaagcgaaag cgaaagcggc tgaagtgggt tgagcccact    313500
     agaccgagag gaaccgaagt gcaacgagat caaggctggt gctggttggc caaataaatc    313560
     aattaccacc tggacaccta attgtctaca taatgtttac attcgaaacg ggtcggcccg    313620
     agcagttcca aattccatgg atcaaattcc actccacttt ctatacgtat atatcatcaa    313680
     tcatgctaac atacattgaa catccaaaat acaagtatgc cctatgcgcc aatgctctga    313740
     aaaaaaaaac caaaaagcca aactccacta tccaatcaaa acccgaaatt aaccatctga    313800
     agtccctcct gagccatcag atcagaccaa tccacatcca atgtatgacc catatgcatg    313860
     aggcgctcca actgccgctc atagacaatc tggaggatag cacgagtcgt tgcagcattg    313920
     cggcccaagc cgtcttcctc gtattccata ctagtcatca attccatcgc cgtcagcttt    313980
     atcccactag ctgatgccgt agcacccgct aggaacaatg ggaagactag gaaatgtcga    314040
     tctgctcgtc gagtgtgcgt agtctgctgg gccaggcgta ggatctctgt tgcgtggtgg    314100
     tcgatttctg cgtctggggg gtactcggac tcgacacgtt gtccgggcca catgctgcta    314160
     taggagaaga gttgacaaac atggtatagt gtagcggact acaaggagtt agcctttttt    314220
     tctttctttc ttactttgca tagatggaaa gagcgaaaag tggaaagaac tgacctgttg    314280
     catgatttcc cgagaccgcc gcgggaggtt atcctgatgt tggtgtacaa atgcaacatc    314340
     cggggattcc cacaatctcc cgaaagctcg acgtaggtcg cttaattcat gcgatctctt    314400
     gtcgaactct tcaaagggca gattccgtct atcatgacga aggcgaatag ccaagaaccc    314460
     cagttgcgcc gctagtcgga atgtgtcgtg gtatagacgc atgagcaccg gtaagctctc    314520
     atgctcatcg gagtaaatca cactgtagcc ctctggggcc gaagggtaga gaagacattc    314580
     cgacccaggg agcatctggt ggtcgataac ggcccgtaca aactctcctg tccctgctcc    314640
     gctgaacagg gcgtacaagt cgatgtggca cacccaccag agaataaatg ggtggggctc    314700
     ttggccatac ttggcccggc gaaggaaggc gatgtgaagg aggcgggaga tatggtgaga    314760
     ccagaggttc gagccgtgtg gctcggcggc tgcaatctcg tagatcagaa gtaggaagtg    314820
     ggtaaggaac agcccgtcgg aaacaagatc atcgttgttc cgtaggctga cttggaggga    314880
     ggggaaagct tgctgataat attgtagcgc atcgacattg tgtcctgtgc cgctgtgcga    314940
     gagactaagg gctgatacag ccatcatagc gtgggaaagc tattaatcct gttagcacag    315000
     acatcgccac cgtccaaaat atagagtggg atacctacag gagggaaacg agtggcttcc    315060
     tgctctagaa agtccatact gagagtcata aagtgactat cagatccaca agaatcatca    315120
     agtctatggt cgtgagggaa caactgccgc catatgacct gacgaaagtg ggaaaagata    315180
     gtacaatcct gaccttgccg gtcaagacgc gggtccaaga acgccatctc ctctaccttc    315240
     acatccggcg aaggaaggga agtgaaattt ggagagagag acaaattgca gaaaggatct    315300
     gagatctccg acgttggaga gatccccaag gtcttcccgt tagacggcga gcggcgagta    315360
     acatcttcaa acgtcttcaa tatcaccaca ttaggatcat cgcccttggc cgcgctcgcg    315420
     ggactactgg ccgcagagct cctgcgctcg ctggtggaat tggatctagc tttctcaatt    315480
     gcatcgtctg catactctgg cagtgaggag aaactgtctg gtgtcatcac gacaaggtac    315540
     gtgccgggac ttaccccttc ggctttcttt tccctgtctt cgtccgaagt gagtagggaa    315600
     aagggcggaa gggaatcctt ggaaaagaaa taatccgtcc tctcgtcatt ggaactcggc    315660
     gaagtgacta ctctagttag tatgaactag aagaaacctc tagaaaagaa aaagaaaaag    315720
     gtgcttacga tcccaaacga catggccgtt tgtcttcaca tcggccatgc ggcccatgat    315780
     acgcggggta tcatcgcgaa aagcgagccg agggcgataa tcgcaagtat ggcctagacg    315840
     agtacattgc tgtcacgtat aagtaactgt ggaaatgtgg agataaaccc agtgtgaaga    315900
     atgcatacat tacattgcgg gtgtccttca tcacatttga ctggagaatg tgtcagccac    315960
     ggaattaacc ttggaaccct ggagtgtagg agagtcacct accttttcga ctctgagaaa    316020
     aaaaagaaaa gaaaaagaag caattaatca actgtttttc ttctgattta agaaaaacat    316080
     aaaaagagac tcactcggca tgtcctggaa ggaataagtt tgggttcggg gtataatcaa    316140
     aatatagaga cgatcactta ccagcaaccg gtgcgagatc gcggaggcaa gcgtatgcgc    316200
     ggtggagcgc tcagggcctt ttcggacttg gcgaagacat caaagagatc ttccggatct    316260
     tccttggggg caatgatggg taaccgcaga ggtttcgcag agactttgcg tctgttttgc    316320
     accagactgg ccgtcatatg gcttgtctta tggtcagtga tgtacagaca ggctgaattg    316380
     gaacacttac tagggtactc ggtacagtat attaatggtc aattgttaaa ggatgaaagg    316440
     aataggggaa aattaaagat agaaaagaag ttataataag attagaggat agagaggata    316500
     gagggggaac ccttggaagg gaaaacagta aatcagaaaa atgcataagg ggagttcatg    316560
     tattttgaac gggtggcggg aataagggaa aagaaaatta taaaattata atcttttatt    316620
     ctttttttct tttcttatag tattgtatta ttgtattatt cgcatgattt attccaagga    316680
     gaaatcaggg aaaggaagac agagctaagg ggaaaaatag aaaatgggca gaaaaaaaaa    316740
     agccaaaaaa aaaaaccagg aaaaagacag aagaacagaa aagcaaatgg catgcagatg    316800
     ccaaccatgt ggacaatctt agaagttgct attattactc tgctaactgt tgagtttaca    316860
     gggttggccc ggactaaagg gaactagagt taatgagaga gtgagaggta gaagaggaaa    316920
     acatagaaga agagacaacc tcggaaggga ctgatcagaa atcatcccat ccctttttat    316980
     cggagccgga gaatgggctc aattaggtga atgtacccag gttagctgcg acttggccat    317040
     gtgtggggga ggaaatgcta agtctcgatc ggcccggacc ccggtctgga tcgatggagg    317100
     aaaaatcgaa gagatcacac tgttgcactg ttttgggaca agcttagccc agtttggcca    317160
     agcttggacc agtttggaca ctttcagaca cctttagacg cttttagacg cttttagact    317220
     cttttggaca ctttgggact ctccgcattc caagcggact tggccgagag ttaggcgagt    317280
     ggcgcagcct tgggggcatt tggaggaatt taccttaatg gctatgatac tgttctacat    317340
     agacttccta ttggtacgat tgtctatttg acccgtttga cccgtatcga atcctccctt    317400
     aaaaatgagg aaataagcat cattcatgat cggcctataa ataaaatata aaataataaa    317460
     aatggcccaa accacgtggg atccttagtt cgggaacgcc agggcctcgt cgagtaaacg    317520
     ctgcaccggt tcggatcgct cactggctct ccacgcacga acacgcataa gaagtgtgtc    317580
     aggcacacct tgggcatgag gactcagtct caggtacgct agaatggcct ctgcacgacc    317640
     cttgcggatg gcttcgacag atccgtccac ttcccccgtg agaatcttct ctgccaaacc    317700
     agtcaagggt gcggccagtt gttcaccgga tgcctccggt aagacgatcc actgatccac    317760
     tcgtgtaaag aaagcccgga gctcatcgta gcccgtgctg acgacctgtc gtccaccatg    317820
     ttggagcact tgagccagcg gaccagtcat ttgttccaca tactttccca gcgctgtggt    317880
     taatgttagc aaggcgtgac gctaggggtt tcccacaatt ccacaatttt ggagggtaat    317940
     tgagggggat ttagagggat ttagggaatt taggggacta accttcaccc gaatcggcgg    318000
     tggggttgaa acattgcagc agacattgta cacacgccgc aagggtgtca tcttgggtcg    318060
     agccgcgccc attcctcgag tctatctcca tctggtcttg gtcttggtct tgcatttctt    318120
     caaccacccc cggaattatc ttcaatgcgt ccggcatgaa gttgaggtcc ttgcgtgcct    318180
     gcgcgatctc gcccattgct cgcagtccat gcggccggta gaggaggtta gctcgcttgg    318240
     cttcgcgaac cgtaatagtc tgacatgcgt tagcatcaat tgtatatttt tggaaccttt    318300
     tcccccatga tcaattataa tcgttggggg ccaagtggcg acatgtcagc ccataccttc    318360
     atcaggctcc tcagctcctc cttgtcttgc cacaacttct gagcttggcc actaaatttc    318420
     actagcgcct taagcaccac ttctttacct tcccacgttt tccccgccag agcacgctcc    318480
     aatactggcc aaaccaattg ggccgtcggg aggtcaatct ctgcatcaag cgataaaacc    318540
     gcttgcgcaa ttgcccgtgc ggccgtatgc ttgatagccc agcgggggga gtccagattg    318600
     tccgaaacga ggccgacaat ctcgcgaatg taaagcgaca cggcgcgcga tccaccaacg    318660
     ttatcctgcc atgtcttctc aaactgctcc ttcacatgtt catcgccatc gtgtttacac    318720
     acaaagacga acggcaaggc actcgccgca aatgccatga accgatcgtt ggatagtttg    318780
     gacgccgagt acaggatctc gccggagata actcgtggcg tggcatcttc ggctgtcaga    318840
     tagaggtttt tggcaaagtc aaaggtcttg agcacccgat catccgaagc gagccgcagc    318900
     agataaccca tggatgagca gtaggaggcg ctgaccgtgt cattccggtc caccacgtac    318960
     ttggtgagga tctggataaa tcgatctgcg tatgggcgga agagcaaggt tttcatgcta    319020
     agcagcacca gaacgcggct gcaacccacc ttcgatggca ggcccacggc cgaccgaagc    319080
     acatcttcga gtctctgtgc cagttcgtcc agattgcttt catccaagtt gtcaatcaga    319140
     taccgctcaa tcacctccat cataggggat gtgcggatgc tagagagacg catcttgtca    319200
     atctcttggc cggtgagacc atacttgtcg gcgttgaggt ggacgtagtt gacagcttgt    319260
     ggctccagag agctcagagc acttaggaac ttctccagca tattggggac atgtggacgc    319320
     agtaagccgc cagggctctt cttgatcatt gagatcagag caccaatggc gtatccttgc    319380
     acttcttcca cgctggaatc cagtcccttg tcgctcagaa ggaaggggat agcactttgg    319440
     agtaaagtac ccgcgcgctt ctccgtgcca cttgtctcga gtgtgcggat gaccgaattg    319500
     gtaatggttt gacagagctt cagcgcggcg gtgcggacag actccttgat atcgtccagc    319560
     aatttgaaac ccttgctgta aatttcatcg agatactggg cgtacttctc cggacggcga    319620
     ccttggatca gatctgccac ggcagcacaa cttgcttgcc gaacacgcca ttcccgacca    319680
     gctaaaatgc tcttgagaag atcctgcatg atatcatcaa agtgggtatc gatgacaaca    319740
     gtagggtcct taactagtgc ttgccagatg gtgttcatag atctttgcac gttcgggttt    319800
     ggatcgaacc ggtaacggaa aagcttgggg taaatcttag ggttcttcgc caggtagcca    319860
     tcgacactgg aatcagagaa gatgctgctg attccaaagc ggccaaatgc cgcacgattt    319920
     gtccaaatag cattgttcga agccagtgac ataaatcggt aaaccagggt ggggtcaccc    319980
     gcctcggcgg ccaggttcat gatatccttg taggtgttga cagacgaccc ttcaccagtg    320040
     gggagggccc caggttcaaa tagctgggtg tcggcctcaa tcttgccacc cccgaggttg    320100
     ggaccagtcg aggtgaatga ttcaaccagg tcttggacca gatcgtcttt cagggattgg    320160
     tcaccaatct catatacaag gctgagtcca tgcgctccag tctcctgcac cacctcatcc    320220
     cggtttccga ggaggctgct gaaagtagct tggcacttac gcagtcgctc ctgcatcttc    320280
     tgcatgtgac cgcagttctt gactagcgac aagagccata ttgcagacgc cttccgcaga    320340
     gatggcttgg gcgcaatgca atccgcaatg accttgtcac agatcagttc aaataccgag    320400
     cgcgggacat ctgaatgagg gaactctcca tcgatgtcga aatcttgaat aagagcgcga    320460
     gaatcccaac caacagcgac attgctcaag gcctcgccta cagtgaactg aacttcgggg    320520
     ctacggattt catgtagact gtagagcgaa cccaggaaat cgctgaacaa gatactatcc    320580
     gagcccgatc gagaaaaggt cagggtcaac aaccccagag atctgatagg gatttgattc    320640
     tcggttttgg cgtcgcgcga tagcttttcc agtatctttt tccaaccttc ttctgtgatg    320700
     atatcaagag acagcacgcc agatagactt agctgtccaa tggcctcttg tgcagtcctt    320760
     tggagcagag tatcccggga aacatctaga atatcaaaga gagtctcaat aaactgcttg    320820
     gtttgtgctt ctggggctcg gctcgctagc ccgcggtacg caagtcgact caacagatac    320880
     gagagcgcta aaatcgcccc acgaactcgc ataacctctt gaccaacagc agtattccat    320940
     gattggatgg tagcagtcag ctgagtaata aaactcttca gttggtcctc tgagaaggca    321000
     ggatgtgaga ccagaattcc aaatgcccgt gcagtaatcc cctggttatc ttggttgttg    321060
     ctgcaaatgg gctccatcaa ggatgccgca cgcgggatca agtgttgaac aacgtcattt    321120
     ggtgctaggg agcagatttc cacgaaatga acaccacatt gccgtaggcc ttcacgctcg    321180
     ccggttacaa gaccttcgag tgtgccagat aaaaatgcta aaacagattc ctttgcagcc    321240
     tctcgaatat actgtctcac ggctgcacgg gcttccacgc tggtggagag aagcacttct    321300
     agcttatagt cccaatcttg ttctagatct gcagcaactc ccgatgccga gaaagcctcc    321360
     caaagtaatg tattccggag gaatgagatg gcaggcataa atgaaccttt gtaggaaccg    321420
     gacaggagtt gggatgcgga caaagcctga acattcaagt gttgctcttg tcctcccgag    321480
     ccaagcagga aacgagtagc ctcgtcgaac tttgggaagt cgaaccagga ttcgtcttga    321540
     actggggctg ccgatgaagc tgaccatttc ccatccttgg caggattgag gagtcggtac    321600
     caataaggat gaagaccttt ccttccttcc tcaacgattt cttgctgtct ttctgggcct    321660
     cttgcgatcg ctatcaaatc gatccagcgg gcgaccacat cgccaaatgg caggaatcgg    321720
     ttcgcaaacc gcactgcagc atactgaaca cctcgcacag cgcggtagcc agtgtcagga    321780
     tcaatatcgc caggctgcat gctcatctga cgaaccagga atggccgcag ctggtcttgg    321840
     aaggtcttgt cgtggctatc caatgaagaa ttaagaatac ttcccaatgc ctgatcgatg    321900
     ctgacgaata tttcaggact cgagtcatcc gcactcaagg aagcaaagag ccatcggacc    321960
     aggtcgaatt caaagttctc tacagcatcg gcctgcgaca taaagtcgac cttgggaacc    322020
     atgataccga tactctcgta ggcaagccct cgcaagctga ggtctgtcgt gggtagtttc    322080
     tgcccactag cggccggact gggccatcct tgagactgaa tgaaatctct tagacccgca    322140
     ataattatgg gcgcgatttg cttgagatca gatggcgcgc ccatacgaac cacccaagta    322200
     gtaaacgtaa aaatttgcgt ccttagcttc gacgcttgca acccttgaga ggatctagca    322260
     gagtctgata ggagcccatc ttcaatgagc ctcaatactc gctgggggtt tgcagtagct    322320
     ttgatcgact tccccagaaa gacgaggagc ttcacttgta gtggagggcg cgcgggcgga    322380
     gcaccacccg aaccgaaata caaatcatac aactcctgca caacattagg attctcaata    322440
     tccgcagtaa atcgcttcag agtctcatct ccgagatcag caaggcggga gttggcatca    322500
     gcagaagcga tcagtgaagg caggaatcgt tgtggatcct taaaagcacc gcttccgatg    322560
     aatcgaaggg cagtaacttt tgtctcggtt aggttcaagc caccgtcggt agaagggttc    322620
     catgtctcgt ttgctggggc acccttgttt aagaagctat actcgtccgg agatagaccg    322680
     gggcatgttg aagtttcctt ggggccaggg gtaagaagta acaatttcgc cagccaaaag    322740
     gacaagaatt cggaatcttc atctgataga cccagccggg ctttcaactg ctgatcttct    322800
     tcgctcccct ttgctggcag cttgagaagt ggcaataggc gcagaaccag attaaataca    322860
     atagcaccct gagtgggtga cgttccgatt ttcgagatac cttggagcaa tggcagtagg    322920
     atttcgactc tggcttcgga gccgaggcga tcaatacctt gctgggcata gataagatca    322980
     aaatgcctga tcaattgaga gttttgctcc ttgaattgtt tcaacaatga cgccacgggc    323040
     agctgaatag agggggtttt gactcgggtg ttgatatgct ggcagaccga gatgattttg    323100
     ttgcgtacct ccacgctctc tgacccgagc ttcagcaaca agggaggcaa atatgttcca    323160
     agtagtgact gcagtttctc atctgtgtct gccattgcaa ttctgaattc caccttgcct    323220
     atcagactca actcgcgagc ctcaggactc tgtgagtccg ccatgatgaa agtgttttgc    323280
     aaaagggtgg ttctaccgga gcatcaaagt gaccctgaaa aatacaaaat acaagacccg    323340
     attttatgaa tgaaccagtg atataggcaa ctgcactcac gtcatcgcct tcaagtgaac    323400
     aacagtatgg gggacacctg cccaggcggt ccattgatta gtcagcgttt gattagtcac    323460
     tttccttggc attaacggat ccatccatct atttctggca ggtgcgatcc caaacgaagt    323520
     caacatactt ccgtaaacga ccttcttagt ctacaaaatg ggaagagaaa caaattaagc    323580
     aacttaacat tccaaggtcg ggtctacatt acaacgagaa acgagacata caatcttcta    323640
     gattgaagtc atgattgaag caaatatccg tatcttagtc ttcccttctt tgctcagcag    323700
     cttcgcctct caagaaccga cccacctccc tttctgcctc ggccgaggga ttagtgccat    323760
     ctttctgctt ggtatttcca aagagacatt gccaaaggtc gtccttcttc accatctctc    323820
     caccttcaga gccgcgttgc attagtgtcg tgagagtggc atcttgcagt tccatcgagt    323880
     tggcagattc aatagccgct tctgtgacac cgtcgtcgtc cgcaggagat gtcgagagtg    323940
     ccgctttggc ttgcttttct ttctccgtga tatgagtcaa acgccgggtt actgagatct    324000
     catatatgga ttcttccacc gtgccggaga caaggtacat ccatactgtt gttggtcgat    324060
     gttgtccaat acgatggact cgagcaatga cttggagctc gattgccgtg ttgatgagcg    324120
     gctcacatag aaagacatga gtagcaacag ttaagtttag cccggatgcc tgtgctttgc    324180
     catgcagcaa aaagcactca atctagatta tttataaatc gtcagcgttc ttcttccaat    324240
     gaggaatggt tccgcgccac ttacagccgg gtctgatttg aacttctcaa taccatccgg    324300
     agagtcaata gtcgtgctgg atatttcaag aaccccgaat acagcctgta atgaagacaa    324360
     aaagcttccg tattgggaga aaatgataga ctttgcgccg gggtcatgtt ctcgcagcca    324420
     taggatgtgt cggaccaaag tgtcaatctt tgacccgtaa gattcctcca aatcaatgtt    324480
     cttgatctcg ttgagatggc cggagctgat gtcgctgtaa atcgcattct gagaatgacc    324540
     ttcgtagctc gatttgacag gtgtcttttc ctcctgtacc actagctcct gtggcttgta    324600
     tgtaatccga tggaaatcat tacgcttcag cttcctcttg cacattggac aattttgatg    324660
     tgcagtccac cataatcgca agcagtcttt gcaatacttg tgaccacaca cagtcaacac    324720
     gcctataccg aaagtcagtc tacgtcaaaa atatatatcc cagagaaagc aatactcacc    324780
     aacttcgaag gtcgattggc agacaatgca ctctcggggg ttgttgtccg agctagaatc    324840
     gtctcttaga tgaatgagat atcttgcttt agacctgaga gaggcaatct ttgcttcaat    324900
     cgactcctct tgctccaacc ttaggttaaa agcggattca tctagcggct tgcctgcact    324960
     ttcctcgtcg tatggagcca ccgtatccga aatctgctgc aggtgacgat aatactccag    325020
     ccgattgttc attatgtcgc ggaaactctc aacttctctg cttagtctgg tcgatacttt    325080
     cagttgctca gcaatcattt gacctgcgtt ctttaggacc atctcgacga tctcatgttc    325140
     agcacgagca cgcgaatttc ccgagctggc ttgccactcc aatgatgcca cgagtttgcg    325200
     aagctcactg acaattccgc ggagcgatcc gagactggga tcaggttgaa gctgactgcg    325260
     aatatccatg atcttgagaa atagttgcgg agagggtccc tcgcctcttt cggcctggat    325320
     gattccggct ttggcttcgt gggaaatgag agtgttcttg taaccagtga gggcgtcata    325380
     acggtcgctg tagattgacc tcaaagcctc catgtagaca tacatctcat cttgatgctt    325440
     tgttgaccgc tcatactcat cgccctccag ctttgcttct tcttcctggt caatgagtga    325500
     ctgagagacg agtctaacca tgacatctcg ccattccttg tattgctggg cattcttgtt    325560
     aagagcgtcg cagaaatctt caaatttgct gagcagattg tatgcctcga ctcctttgct    325620
     gtagagatgg ggcttcattt tcgggatgtg cacgaattct ttgtctcgtg ccttgatctt    325680
     gactttcctc atgtagcgct cgactctccg ggcaacgtca gtcaacatct ctttgcgaat    325740
     gacttttgcg gcctcatagg cctcctcttc acgtttctca agcgctttaa actcatctga    325800
     ctctggctgg gtcagatttg gatcgctctt gatttggtaa tatgcgttcg cagtgaaaaa    325860
     tactgcaata tgctggacct cgagtgcagc tcgaagcttc agtcgacact caccgaggcg    325920
     gctgttattg cctgcctctt cgtcctcttc gtcctcatca tcctcgacat cctgattaat    325980
     atgtcctaga gtagccccgt ctttgtcact ggtagcgcct ttggtcttca gtaggcgcag    326040
     ctgctctctg ctatcttcaa ccagccgcgt ggcatgatcc aatgctttct gccaaagagc    326100
     gagggcttct tggcggcgtt ttgcattttc tagaagctgg cctcgtcgaa gttgagatag    326160
     aaggagagtt cgttcttccg tgcgtagagc tgactcgttg gcatcagtca tggcttccag    326220
     gacttggccc acggtctgca aaggaccaga gccctgacct agcgttcggc gatagcggac    326280
     gttgggacga aggcacgttt cacggagtct tgtcaaccaa gtacgcattt tttcgacaat    326340
     tacaggatct tcgggatccc agtcgcctcg aaggggagct cccgaagcgt tcaaaccgca    326400
     ttcttcgcac atttgctcaa aaagctgacc atacttctgt tcttctatag ccgtgaaagg    326460
     agtagtgata acaatgcgct tttgaggcgg tagacggagc tcctccaata actgaccttt    326520
     cctgtgccga agagcgattg tgtttatgat tttcgccaag actggtccaa agcacaaaca    326580
     caatcttctc cacaagggtg ctgaaaagca gaacggctca taatggagga aaaggagaag    326640
     accaaacagg tcgtctatgt ttctgcgcag cggagtaccg gtcacagccc aagcgatttc    326700
     acgagggatc aaacgagcta ctttcgctgc gttgctgaca ccactctcaa tcatctgggc    326760
     ctcatccaga catactcgcc accatgagag ccgaacgagt ggtgtcttcc tctgcgcaaa    326820
     tcgcttttcg tgccgtagag ctcgctgtgg gccaccaccc gtatagtgaa tttctttcgc    326880
     gatgacattg taggtggtca gaacaacatc gaactcggca agctcatcga caatcatgtc    326940
     gtcagttgct tcccccgaac gtttgatgcc attgtaatga tgaacactca gagtgggagc    327000
     atgctctttc aactcttgtt tccattgttc aagaatcgcg gggggtgtga taatcagagt    327060
     gccgccagta ggtctcaacc cgtcggcatc agccttccag atctgggatt cttctcgctt    327120
     attcaaactt atcaatgcag tcacttcgac tgtcttgccc aaccccattt cctcagcaag    327180
     tattccacct ttcaggttag ctgcggcatc gtaccacaga gaaatatcgg ttgtcagaac    327240
     catgaaaaga tgactgaagt agtaggtccg cccatccgca tctttcgtgg aattgaagga    327300
     cgccggaatg tcacttttgg gaagttctgt cataggcata atttcgccat ttggcccgac    327360
     ttctcttcct tctctttgta agagccagcg aacagctctt tgttggaacg ggaatagctt    327420
     gcattttaaa tcagggcatt tgatatttgg actgtctgtg acctcgggaa cgtgcacgtt    327480
     cttatagaaa tcccggggag accattcttt gcgggttccc agcatatttt cacgatattt    327540
     gcgcgggtct gctgatggct gaacacattt ttcctgcagc acatatttcg taaacgcttc    327600
     caggtctgct atgcccaagc ggtttgagtc cggaacctcg atagagtcct tccaaagaac    327660
     aatcgtctcg agagaaaagc ctgctccatc tggcaaggta cacaaatgcg cttggtagca    327720
     ggcagtaggc actttcttgg agaagttgtc tacgtgagca agtttgctgg cggcctgaag    327780
     ttgcccaagg agctcgaaca gccgtagatc ctcgcatgga tatatcagca atcccttttc    327840
     atcgagacta gatagttcca gttccatacg atcagggccg tcctcggccg ggtctggttg    327900
     cggcgcattg tccagatctt catcgagaaa atgaacgctt cggacatcaa tgagtatagg    327960
     aaccctggag gtggagaggt ccgggtcgta aggtctttgg tatttgttcg tgtccgtatt    328020
     cgagggtctc tgaggagggt aacggatcag tgattttgct ttagaacggg caccagtggc    328080
     aacttactat gcgcattgtc aatcttgcca atggaatgta gcccaaacgc actcctgccg    328140
     ttgatacccc attttcttgt gtcagactcc ttgcgccccg tttggtagtc ttgcgtcgct    328200
     tggtgggacg ctcatcgcat tgctggaaga tcgagtacag agactccaga gtcgcgtcta    328260
     gaataagaat ggatgtcagt gcttcaattt cgttaacaca gtcagcaaat aaaagtagct    328320
     tacctggcaa tgtgatctct tctacaacca cactcatctt gaagaccaca gcctatcctg    328380
     tcgccacaat gcagagttat caagaagaga gaatgcgcct ccgaaagatg gggctgtcat    328440
     cttatcgcac taatcacggg aagataagac aggcgctgat ccatggatct accttatcgt    328500
     cccgaggtcg agagttcggg taaacgtaac tccggctcaa cttgtatact accaagacga    328560
     cagacagtag ctcatgtctc gacatactgc gtccagttac ctatagtcca taatctatcg    328620
     actaacactt atgctattta tcaatttgat aaaagctatg ctgtttaatg tcccttcctc    328680
     tgataattgt atgatgcttt accatgtaac catatctatc caaggtttca agtggatata    328740
     tactttagag ccatcgtaac tcacccagcg gcaatatcaa gtttgcgcat tcataacaag    328800
     gggatataca tacatgcgtc tgctttacgc tcaatgctgc aacagacatt acaaaagaac    328860
     catagtaata tctccaagag acaacctctc aaatcacagc aagaaccacc taaaaagccc    328920
     caaccttatc atcctgacaa aacggacatg tagtaaagta ctccgccaac ccaacctgga    328980
     tctgccattt cgcaaaacaa gacagacaag agaaagactg gacgagacga actcgcgtag    329040
     atgcagactg aggcaaccac ctgtgcgaaa gcagcacaat atcagtagca agcccgggtg    329100
     tctcttcaac cagtttctcg aatgccttgt tctctcgcag ctccttcctg tgcttctgac    329160
     aaaccgcgac gacgacatct ctcaaacctc gatccgattt tggtgttgtt gtgtatgctt    329220
     caaaggcagc agtcaagaat tcgtccgagt tccagtggtc ttgggcgagg gtgacgaagg    329280
     ttagttttgc ttggattttg agatattcga cctcgaattt gtcggcaatt gcgtatacct    329340
     tgacattgaa caacagtggg cacatttgag ggggttggtt gatgtcgtaa tgtagtccgt    329400
     agaatgagcg tatcatggct tccacgatgc gtggatgctc gtctttcata tcgaacacat    329460
     gagccgtttc gctttcctgc gatcatcaag tcagctgagc ctgtggataa tggagagttt    329520
     gggttttgga gggagttaca atgggaacat cagagaagaa cctgcaaaaa gtctcagatc    329580
     ggctgcagac tatgattctg tgcacctcca aggcttggtc tgtcgtgcga attgtgaggt    329640
     cggagaagac tcctgtgtgg tataggctgt ctctcgtcag ctctcctgtc catgcagtgt    329700
     gtagaccaag aacttactcc cctagtcggt ggagaaaccg atcagtaccc tcgacgctgt    329760
     aaggagtaag ttccattgca aagacgcgtc gtgaaaggct tgacgcacaa gaagcgataa    329820
     gggggcacta aaatatgtga agaagcaaag taaggataca aaacttgttg gggtaacaac    329880
     ggcgagcaga tcagatgttt ttatcctcag tgccaaatga gactgacata ccgaaacaaa    329940
     ggtaaatgac tttatctacg accttgtctc atctccaact tggtcttttt tgcgaatacc    330000
     caattcttcg actttttacg acacacaata actcattact gacgtctctt tgtcatgatg    330060
     ccgttgtatt ctgtgtccat ttcccaaatg ggatgtcgtg taccttgcaa cctcgacgtc    330120
     cgggaccttc atatgattac cattctccct agtttataag agctccaggc ccctttccaa    330180
     ttatagccct cacgctgcct cttccagtat ctccataatc ctgtggagaa gaagccgaaa    330240
     ccttgcctcc agggtcggtg tcagatacaa cggtgccatt gactgcatga acagatcggt    330300
     ggtacggttg cccattcatc tgactttcga acacattggt ggtatcgccc caagagcttg    330360
     agcttccacc agtgacggat ttatactgcg cagtgccaga ctgccttgtg tgtaggtgtg    330420
     acggccctga cgacaaggtg taagtggaaa taccaagccc tcctgttgtt tcaaagtcga    330480
     gacctctcat catccaagag tcaatcgtca ttccattcga ggtgatgccg taagttgcat    330540
     tgacaaccaa ggggtattga aatgtaatgc tatatgagat gggtgcatct ccgagctccg    330600
     tgatactgtt atttccagtt gtgagttgtc tgttaacctg gctgtatcct tgttggttga    330660
     gtagaccgtg gttggagaat gatagtgtct gagaccacga gtacagagac gatcttacac    330720
     tgaaaattcg cttgacagcc acggagtatg acaaggaatc attccccccg gtctcgttgc    330780
     ggacaagatt ccgagttaca gcaaacactg gcaagggagc atccaccatg ggcccatcct    330840
     tgtcacgagc ggcagtgact ttcgagtctg agctgttgtc attgagataa atgaaaatgt    330900
     tacctgtgac aacccaatat gagcccacag tgttcgcaaa tgtggtcttc ccatctgccg    330960
     agacattgag accggttacc cggatttcaa aggaatgttg cttcccgtct tgaaccatag    331020
     ggagaaatgg ggaaatgtca atctccggct gtcgaagatc aaaggcatca gtcccaacaa    331080
     ccggacgcca gaatcccgga gccacgcctc ccgtaaagat aataggaaat ggccagacaa    331140
     gcccggcaag gatcccatcg atatagagct gaacttcacg aaaaggagtg tacccatata    331200
     gcccaccgac agtgctttcg aagtctcggg tatcctgcga gaagacattg gaccaccaga    331260
     actcttcttc tgattgtcca catgccgata tagacacaat agcacgcgat gccgcagcag    331320
     ggatctcgta catgacagtt gtgttgtcgg taggaagctg gaaggcactc ggagagtttg    331380
     atgctgacct tttggcagaa attggaagaa cgatatccgc ggtcttcaca ttctgtcctt    331440
     cggagaagtg cgccttcaac gtggcattga acgagccggt gtagacctcg ttaatgatat    331500
     ttcccaagtc aaatatcagc ttctggggac ttctccaaag cgagttatac tgcgacatct    331560
     ctttgatata ggtccagaca atcccgttgg ttgtcggctc cgccgttgaa gtccgaaaca    331620
     cttcattatc tcgaaggtac atgagtgcca ggcggtcaaa ttgcttcccc cgagaggtga    331680
     ctgtgagatt gattcgtaca gtatcaaatc cgcagtccgg gggctcataa tttccagtaa    331740
     gttgcaagat tagaccacaa gtaggagtac tttcgagacc tcttaccaac aaatggcgct    331800
     ccgtaactgg cgccaaagac atgatccatg agcaagatct caacatcgca gttgccattt    331860
     ccactgaaat cgagagatat gggcgaatag agctggaaaa actcttgcaa accagttgag    331920
     ttaggtgctt gcgatgaaaa gctagcaata gactgcaatc cgttctgaag cgatgaagcg    331980
     actgacaggt gccccaaaag caacaacccg catatgccga acagaaccat aatcgctaac    332040
     agtcggaaag ttggattggt tcttcccgcg ttgctgctgt tatcgatcac ctttgattta    332100
     aaatggtaat gatcaataga cgaaacagtg ttcgcagttg tgtaggcctc ttgggacttt    332160
     agtggttctt gactgagtgt cagcactgga gaaggattcc aagctctgcg atgcgatttt    332220
     aaagcactgc ggaatgcgat cacgagccag ataagaagaa taggtagcag ccatgcagct    332280
     agccgggtag aataatagtc catgggaaat tgcagatccg ttagtacttg agacaacctt    332340
     ggaggagcta gcatgtcagc tctgaaccag ttaggatatg ggattttatc caggacgggt    332400
     ggctaaagcc tatctaacgt tagaagtgtc tcttgcacaa gacataatcc gctagtagac    332460
     ctagaaggtt gcagatgccc ctgatgataa ggcgcataaa gaggggaagg tgcggactcc    332520
     cgacgcaagc cccgaagtaa caccctcagg ctatataccc atggacatat gtactgtatg    332580
     cccaatatgc ctttgaatta taaaatggtt tccattgata tccaccaaga aatgcttggt    332640
     attgtctaaa catgtagcaa catggcacgg ctagacgagt agagagcata gtgtacaaaa    332700
     gaaaaagtag taagacatca aaacgtcttg tgtaaagcag gccaaaaaca atcactccat    332760
     atccaatgca gacttttata ccgagatcac ataaacaagc gccaggcacc aagaataagg    332820
     gccgcggtac cggtacagac acccctggag agaaaagaaa gtcagcatag gctcgcgcgt    332880
     tgacaagata tcgtcgggga tcatacataa gccactgcaa cgtcgagaac ttgacagctt    332940
     caactcgctc ccttaatccg gcaacctcct gctcaattcg cgtttcggtc tccttgatac    333000
     gcatttcttg gctattggcc tcctcacgaa tgcgaccctt ctccagattc agatctaacc    333060
     ggaccgaggc ttgtgttcgt ccaatctcat cccggagtcg tgagttgagt ttggcgaggt    333120
     ctgccgcgat cttctcgtgt gatgagcggg tcaactgtgc ctcggtcgag tctgcgttga    333180
     gcaattcgga gcgcaatttg gcgaaatcca ccttctgtgt ataagtcgat ctctccgagt    333240
     ctagtaaagc gtttcccgtt agatatccgg caagcagtac aaagaacatg tgcgaggccg    333300
     cattcacata ccttctcgga ggaccattgt ccttgtcaga ttctggattg actcttgaat    333360
     gatatcgttc agtacccgca tcatagctac ggactgctcc tcgctgaagc cctccgcctg    333420
     aaggcgcttc acgaatttca gggtatcgaa gtgatgatcg cggggccggg cgggagtcgc    333480
     atgaaaggcg cgacgagcgg gattgtatgt agccacatat acgccattgt gtcggatcgg    333540
     attgccgcgg ttcgttgtgg acgttgccgg cgtggttata gaggttcctc gggaaacaag    333600
     atattcggag ataacatccc gcgacgatgg ggagatgagc tgggaagact gggaaggtgt    333660
     gctcgagtga aactgtcgct ttaaaggact ccagccttgc ggaagtggtc gtctttgact    333720
     tgtcgcaagc gcgggatggt gggtgatggt gacggatgga cgcgaagagg agctgttcca    333780
     tgtcaggcgg ggaaggatat tgcgcgggac atccgcgaca tgtttttgag gtgccatgtc    333840
     aaggacagcg ggcaagcaga taatttattc aagtgcactt caagccgatc aagagtgacg    333900
     cagaagaggg aggcttggaa gattccgggg tctgaaagga tcgggatgac taaagagcat    333960
     cggaaagatc gacgctttca gtttcccgac cccgggtgtc caccttaccc gcattgacta    334020
     gtatagtatt gtagggttaa gtatattctc gtttcatgcc attagaggac tattttgatc    334080
     gatctttgac tatgactgtt tgtagaaaat atccaaatca gactccgcat gtaaacgcta    334140
     tcacaaaacc atgccctttt cggctatttg acattcaatc caatctcgta tctataaatc    334200
     aaacagcttc ttcagctggt ccatggtatc ttgggggcca tcaacggagt gtccaatggt    334260
     gcgggggtct tcgtagatct cgtaatcgtt gcctccgaca aaagtcttgt cgccgaagaa    334320
     gtggatggtc ttgtagtcga tacccgagat gcccttttcg gcttcgatgt gctgtaggca    334380
     gtaggtcttg tcccaaccgg tggggaagac atcaaaagaa atctgaccgc caatagagta    334440
     gctgtgttgc cagattgatt agtatcatat caaaagaaaa cctcgtggga caaagactta    334500
     cgtgagaccg tagtcgggga attccttctt caaggactcc accaggttct ttctgatatt    334560
     gtggatcttg tcataactat agcgcgggtc agtcagcaaa cccatttata tggacatagt    334620
     tatgcaaaat caacacgtac gcttcgaact catcgcgctc gtcaacgcta gcagcacgtc    334680
     caacggggct aatgttgacc attccattgc ggaactcaac gaaagtaccg cgcttgcggg    334740
     gcaacttagt gttggcaata tacttgagaa cgaaatccac aagcgcttgg tacttatcct    334800
     ccccaagcca ctgaatgaag ttgttgctag caagtgactc gccgaggcgg aaagcggtca    334860
     gaccgttctc agagaagcaa aaatcgaaca tagtggtaac gtcaatggtg gaagatccaa    334920
     gctgctcttg ctgcttcaca aggttcgagc cgccaacctg aatcgtgtta ggaacagggt    334980
     gggtgtattt attgggagga gacgaacgaa tccaatagca cacttgtggc gcaaccgaga    335040
     cagcaactcg agcatctctg gcgacgcatg ctataataca tatattagta taactgaaga    335100
     gcagtgagtc tcattgcaac ctacccgtct cgcgggggtg agagtctcgt caacatcgaa    335160
     cagaacaacc gtgttcttga tgggacggtc ctccaatgag gggtaaacac tggcagcttc    335220
     agtcattttg aaggatttag tcaattgagt ctcaataagg gatttgtcaa ggacaaaaat    335280
     tgcgggcaac ccgggggtaa atatacagag aggggcccat tttggccgca agcggtgagt    335340
     gaaggcggga gcttagcatt gggtccagaa gcggagaagg ccacttggtc tcactcattt    335400
     ttagagaaag gtttattgga tttaatgtct cactcgaatt attgatctaa ttagtctgta    335460
     tacactgtcc ttggagtacg ctatgttgcg cagcattcaa atgttgacag cgagatctag    335520
     actctaccta cccagctggt ggctggctgt tatcgataag aaacggaggg gtcaattatc    335580
     atgtcagaaa agagtgaaaa catgtgaact cgacaattac cgtaactact tgttatgtac    335640
     ttgaaaatat gtattttcta ccgtactaag tggtccatag ccatgtagac atgtacagtc    335700
     gaaatgtcca actcaaccca gatcccaccg gaggttgtaa aagccagctt tcactacccc    335760
     aacgcccaaa ccgcccagca aaccagaagt agacatactc agcgtcccat agtggactgg    335820
     aaaaccctgg ccgcaagttc acccaggagg cgcgtccgat ccggcactgg aaggtccaag    335880
     aaaacctcat agacactttt gcccttagca tcacggatcg cgccgagacg attacccgca    335940
     acagcgccag ccagcgcacc aggcaaattg cccacaatga agcccatagc accaccactg    336000
     acaccgccaa ccagtgccca gaatcgcccg gttgggcgag tccgccgtcc gccttctccc    336060
     tcgttctcct cggcgagacc ctcttcgcgc agcatctctt caaatacgga cccaaactga    336120
     tcgttgtcgc ggtcatcacg gttcccaccg aacccaaagc tggaccaggg gaaaccgcct    336180
     gttggtggga cttctgcttc tgcttcctct tcggctgcct ggtatgcgcg agtagcgtca    336240
     tattcccggc ggcgcgcggg gtctgatagg gtgtaatagg cgtcgttgat ttcctggaac    336300
     tttcgtgtgc gcgagggtcg ctctggtgaa tcgacgggga ctcgatcagg gtgggacttt    336360
     agtgattccc tagacttgat tagaggggca ttcgaagagg agtggtggtg cgctcacctt    336420
     ttataagcgt tgcggatctg ttgctgggtg gcatcttggg cgatgcctag agtcttgtct    336480
     gatatgtgtt agttcgatgg gtataagtta ggccttgaga tgaggtctta cagtaattgg    336540
     ggcctggtca agagttagta tagattccag taagggagag taaaatcaac atactcgaca    336600
     tggtcaaacc aggcccttga gctcaacaat aaaagatgta ctgtgatagc ctaatgattg    336660
     aaccaaaaga aggatttggg ggaagtcttc catggaaggc cttcacatgc agtgacgtcg    336720
     ttgtcgcctt gtcgccttgt cgcctgaggc gccaatcccc atgaggttcc acggttcaac    336780
     tgttcgtgat attcaattta aacaactaca ttgtagacag ggacaacagt ctatattcca    336840
     atataatttg aagatgatca tgatctttag cgcttaggag tggattgctt gactctttgg    336900
     gctaatttgt ctcccgtcaa tgcagtttaa gtcttaagtt cagccggcca caccccagcc    336960
     acatttattc cgcccagggg gtgactgatc aatcaaatct gaagatcccc tttgattcgc    337020
     ctgaaattac catccagtac ggagtgtcgt ccgcaaactc ccctcagaat ctcaattgtg    337080
     ccagctgtca aaaggcattt cctgcataca aagtccctaa agcgggtgcg cacatcggcc    337140
     tagacctcag attgcgcagc agctagtggc tgacctgcat tgtctctttt ccctttttca    337200
     attgccacac aagaaagcca aaaaagaaag gtctcaaaga gagataatca ggggcattgt    337260
     tacgcagcaa catttcaaac ccaccttctt ctgcgtacct acccaccaca atccctctcc    337320
     taaacacaca agcgtctttc agaccaaaca cctcatccgc cagcctggcc caagtgtcca    337380
     aagttgcacc ggtaaccagc tccccaagca ccaaaccagc acaatgggtt ggttcgacgg    337440
     caaatccacg accgtttcat cagcggggta cgtgcgacga cgggcatcac ccacgcccag    337500
     ctcgcacagc acgcacagca gacgcagcaa atccggctac tcctccacgc accatacgcg    337560
     acactcggcg ccgtctttct tcgggctagg cggtagccga acaggaggcc gatcaagccc    337620
     atctgtattc tcgtcgtact catcttcgtc gcgacgagcc cgtccccgcg agggattcgt    337680
     gcagcgcatg atccgcgaca tcaagcgtct gttccgtgat atctatcgct gggcgcgtcg    337740
     caaccccatg aaggtcttta tgatggttat cgtgccgctt ctgactagcg gtgttctgcc    337800
     gaggctgctt gctatgattg ggattcgctt gccgcatgct gttaccagtg cccttggtgg    337860
     tgcgtcgaag acccgtggtg gtttcgaggg tggtggtggg ggtatctcgg agaacattgg    337920
     tagcctgatg aacattgcca agatgtttgc ataggcgata tgcgacatgt ctctagggct    337980
     ggataggatg ttctgtttga gccttggacc tcttttttcc cacgatttgc aatgccttgc    338040
     tgaaattcaa cacacgacga tcacgaatat acacctactg tcctttgctc cttttttttg    338100
     cttttatact cccgctcttt ttttctttcc cggactttgc catttttcga cgttgtcatg    338160
     aactgggagg cccgtctgaa ttcgatagaa ttgatttctt tggaaaagct gctgtttggt    338220
     attgacattg aaacatctga gaattcaaaa caagtctaga gatacattgg agcctcctat    338280
     ttatactaaa ctagtcaagt gttgatgccc aagctggtgg atatggtgtc ggacagctgt    338340
     acaccgcact agttgtgtct gcagctgggg aagcgcactg accgacagac ccgcctacaa    338400
     actcgccaaa catagtctag taggtatgga gtacaggtat tcctgctggc agaccgatct    338460
     ttgggtgtac cctgtactcc gtcatgccat gtgagatgaa tctgcaagga gtacatatca    338520
     tacaccaaca ggatggccag tgggtaactg tagaccgtgc acagcatatc ggtggccagt    338580
     aaccgacctg catcattttg ccttgaagtt ttaggttcga gaaaagaaac tatgtataca    338640
     ttttgtttct acttgggtat tgccgacatc caagcaggga ttctatagta aaagcaacct    338700
     tgggaacttt tgtgatcagt ccggcaggga aaacaacgac aaacgcccgc ggtgcagcaa    338760
     tccagctgcc caagtctatg atcgctggga gcgcttgcca cgcttccgag agcgggcgtt    338820
     cgaggtggca gtggtctcag cctcctcaac caagggctcc tcagcctcat cagaatccac    338880
     ttcctcggtg gaagtaccca gcactcgacc aacagtcttg ttgaagcacc agacgggaag    338940
     cttgcacacc attgtctcac ggagagtagg gcgcccaatt tgatcaatgt caagcaggaa    339000
     ttcctggcgc tcgccagcct cgttcagctc ttccaaaaac acattgccaa tagaatcgac    339060
     aatcagcgtc tttccattct cagcgacgac gcgcttcctc tcgccggtgc tagcaggttg    339120
     ctcggtggga gtggaggtac ccgaggcacg agcgctcaca cgggctcctc ccttcttatc    339180
     cttcttgttc tccttatcca tcatacgctt ctggcgacgg ttgacagcca cggcaccagc    339240
     gtcaccggat tccggggcgg tagggggagg cgctgcgatc gagtcgatgt ccgaaatacc    339300
     acgaacaccc atttcatcgc cccaggcggc tctgcgggcc tggcgaatat agcgatccac    339360
     aaactcgcgc tggcgcttcc agccgaggat cagcgcggcg tagtgagcac caccaccgaa    339420
     aacgaggaac agaccgagca gcacggagcc cagaccagga cggaatcgcg agtagtagta    339480
     gccggtaccc ttccacaagg ggaagccatt cttaaggaag tggtcgtaac gctcgcgatt    339540
     cgggccgcgg aggacgttgg cgacgaggtt cagccgggca gaccgggcgt cggcgtctct    339600
     gactgcggca tcaatctcgc gctgagtagg acccttgttg acattgaccc ccttgttgga    339660
     cttggccttg ttcttgtcct tggggtagtt ggcgatgaag gcacgcttga ccttgtccgg    339720
     gtggatggtt ctggacttct tgcggtaggc tttggtgatt tgttcttgat tggcattggg    339780
     acggatctcg aggaggtctg gcgccgggta tagaagttag atacgtatca tcaaggttga    339840
     tggaaataag aatgagaatg gaaaggaaag aaagccgatg gcaatgctag gagaatatca    339900
     cataccgtag aaggtcacat tggcgccttc atttgtggcg acatcatttt gtaggccaaa    339960
     gatctcatag tctgttcaat ggagcagtga ccgtcagtac aacataaggg tttctggggt    340020
     aaacaatacc caccttcttt ggaccaagca gcgacgaggc cgaagaagac gaagagagat    340080
     agaatggcaa atggcttcat gattgatagc ggtcaatgcc gcaaaagcca gaaacgaaag    340140
     taattgaacg aatgagctgt gtgttagtgg aggagacagc tgtagggaaa aaaagcggtc    340200
     gggcatttac gaagaaccaa cgtggcccca ataagagttg ttctttttac tgtttttgtc    340260
     tttttttgat tttttatttt ttttctgagt ctgcatgaat tattgcatct gagcgtattc    340320
     cgtatagtat atatagagga attctagatt ctagattcta gagggttttg tgtttcttct    340380
     atttctgttc tccaggactt cgttgcccag tcctggagtc aggaactgac ctcaacccgc    340440
     gttactattt atgggtttgt ttctacaata taactaggta acaacctaac aacctaacaa    340500
     ggtactattt ctcatcttat tacttgataa cttggtgaaa caagaccgtg cttcgactaa    340560
     aagtccaaag gggaaaaggc caagaaaaaa aagactcgtg tttgtttccg gcgtctctct    340620
     cctctctact ctctcgactc tctctatcac tttattacct gtctcatttt ccaactctcc    340680
     ctttctcaac tttatattct tccctcccac cctctttttt tcttcatcca aaatggtctc    340740
     tatcccaatt gatgcgatca cttcgcgttt cggcgatcgc ttcaacaaca tccgcagtac    340800
     ttcgttgagc acacgcttcg ccaacctgcg ccctatttcc gagttcctcg acgtcaagcg    340860
     cctatccaag cccgccaact tcggtgaagc ccagagccgt gtcaattaca acttgtccta    340920
     cttctccagc aactatgccg tcgtctttgt gatgctcagc atctacagct tgctgaccaa    340980
     cctggtgctg ctgttcgaca tggtctttgt gagctgtggt ctctacggaa tcaacatgct    341040
     gcagggtcgg gatctggacc tgggcttctc tcgcttcacc acttcgcagc tctacaccgg    341100
     actactcatc gtcgcagtcc ctgtcggcat ctgggcttcc ccccttacaa ctgccctgtg    341160
     gttgattggc gctactggcg tgactgtttt cggacacgct gcgtttttgg ataagccgat    341220
     cgagaatgct ttttccgagg aggcggtcta ggtggtcggc cgcgagctcc ttttgatatg    341280
     ccctcatggg gaagaccacc gggggcacga agggggagaa ataatagggg acgcgcggcg    341340
     tgggaggaga ctcgactgga ggaggtggat agtgaggagg atgcatacgg gcgggagctg    341400
     gtgcggagcg gtcgatacag gcagttggag tatggagggc gagggccgcg gaggcgagtg    341460
     gattatgagg atctgacgga tgaatctgaa tcggttgatg gaggagaatt cgatctgtat    341520
     gaccatgagg acagcacggt ggcctatgcg gttcaattgg ccatgcggga caaggaagat    341580
     caattggtgg atacagcgct cgaacgaatt cgccgcgctc aagttctggg aaagaagaat    341640
     gttcggctat cgaaacgcga gctggatgcc ttagagcgca agcgccagca gacggacggt    341700
     ttaagccggc gcccatccgc cagtgtcaaa gtgtcgtcgc gcccatcgtc ccgccggagc    341760
     ggagcagttg ctgcaccaga gcagctgccc ggtgcgtacc cggcctttgc gcctgatgca    341820
     cacagctggg ctcgtgggac gggcacaaac agtcggccgt ccagctcatc ttctgctcgg    341880
     ccccggactc ctacgacaca atctcttcgt ccccagcagt ctaattcccc tctccggcct    341940
     acgtacccgc cgtatacacc cgaacgcttt gcacccaatg gccgaccaca gtcaatgcaa    342000
     caaccgcctg tgttccaacg gccactgcca gacgatcctc aatgggcccc atcctactat    342060
     aattccctgc agatgagccc atacggggaa cccgcgctat acccatcaca ggttcccacc    342120
     gatctccggg ccggacagca gaatcgaatg agttacccgt caggccctcc atacccaggt    342180
     tatcaatctc agtctccggg caaacgcccg caagacacac cgcagacccg ggaggaccta    342240
     gctccagctc catccaagtt ggggtcggag gaatccagtg aagaatcgag cgaagatgaa    342300
     gtgcagatcg tcaaggtggc caaggtggcg gagcgcaagg ccccacccgt tgcagtgcag    342360
     aggcggccga ttactggaac cactcgtaag cggaccagtc gatgaaggtg aattgtcagg    342420
     gtcgccctga tatccaaaaa tactttgtgg ggttttgttt tctgttttac tcttttctgt    342480
     ctttctgaat actgcgatgg cgttttgagg tagaccggcg gactacagac atacatatac    342540
     atattacttc cacttttcat tagatatacg tagatctttg tagagagtat cttgtagttt    342600
     aatagctgaa ataagtggac cgatgcactc ggcaacgaaa aagtctgaac atctgacaat    342660
     ctcagcctca aaggcgttag atctgcctag tattcagcca cccggtgtat ccgtcacccg    342720
     ttagctcgcg tgacaacctt gggacaggca tattaatgtt aataggatat taatagttac    342780
     tctgtagagt agagggaatt acggagtaca cctgtagcct acctaggtaa tctatctaca    342840
     acagtatcat ccattggagt aactattgag gctgatcact aggactaggc tgtgggggcg    342900
     acacaatttt tctgccttgg cagtcctggg ggatgacgtc gctttataat ctctttaggg    342960
     gctcttctaa acaaataatt attggaatgg atttcttctc tgcttctctg cttctctgct    343020
     tcttcttttc aggtccccta caacataagt aattgggtat aaacaagtat atcttgcgca    343080
     tcatcgttgt cccggttcca acttgatata tccctttgtc atctaagcgc cactgtcgcc    343140
     ccctttaagc ctctcattta aacctggaat gctgtattcc tgtcagtgtg tacatagata    343200
     cagggatata ggtgagttgc agtggggaaa gtgcttggaa tccacttctt tccatcctat    343260
     cctatatgga atcacatctt ggagaagctg cgactgacag gaccctatag gcttgcattg    343320
     tgctttcaat cctccactct cgttgatttg agcttttagc ggacatacaa acataccttc    343380
     attgcatcaa gatcggtctc gaagtacaac cagtacagct caaaagtcgc aaagatgtgg    343440
     attatatcat tttggatgtt tccgttgata tcagcctgca tgtgggttgg taaggcatcc    343500
     ccgcatggaa ctggatatta tgttctgggc tgcagctaac gtggtcttag caatgttgat    343560
     tgccatgctg gtcacctggg tcaacgaggg gagaccgcac taccctagta tggacaacgg    343620
     acaaaccatt gcgtatgtct tcttctccgc cgttagccca tccatccata cgctaacagg    343680
     actgttacag gtatatttca gatgtcggag cacaacactt gaagccgctg ttcgtcggag    343740
     gcagcgtagt taccgtcgtt tttctcgatt tagctttcct ttccgagcga tggcttcgac    343800
     attccaacca gttggcctcg aacaagggta gattggacaa gacgtgcgct atcctttcca    343860
     tcttcttcgc gatcgccggt gctgccggtc tgatcctact cgctgtcttt gatacactcc    343920
     gccacccgaa aatgcatgat ggtttcatcg ccctgttcat gtgagtcatg tccactcctg    343980
     gaaatatgca gccaacaccc aactgaccaa tcgattcctc ttcagtgctg gatacgtgat    344040
     tagtgccatt ttggtttgca tcgagtacct tcgcatcgga atcttctacc gtcgcgaaca    344100
     ccgcgtcttg ctcgtcagtt tctttatcaa gcttgctttc gtcattatcg agctcgcact    344160
     cgctatcggc ttcggtgtct gcattggaag caaccaatcg tctaagcaaa accccggcgc    344220
     tgttctcgag tggacgattt cctttgtctt cactggctat gttctctcct tcgtcgtcga    344280
     tctattgcct tccgtgcgca cccgcaacca cgtgccccag ggtgagaagt acctaatgac    344340
     ccagcaaggc cgtgaagaga atgtctccat cgaagagccg ctgacccatg actcgatggg    344400
     cccgagcacc ggcttttacc gtggccagcg tgtctaatcc ctttttgatg tgattcttta    344460
     tattcctgta tttacttata cgacgtgcac gatgtccctc gatactctgc ttttgttaat    344520
     agtttcttga tacctgtcat ggatacttca tatatatggt gttttgggaa gttgggcata    344580
     cactgttaga tcaatacgtt ggccttggga tacatattta catatatact tctatagcaa    344640
     ttcaatcaac attttagata tttcctagtt ccttttctca atctgtttac tagacatcaa    344700
     aaacatccaa tcccccacca tttattatct cgcatccaaa tgctcaatgc tcatataaca    344760
     agaaacgcta gacccatccc aatgccaagg tcattatccg tatctacata tcccatatca    344820
     aatacagaaa tccataaccc ccaaaccaat cccaaaaccc caaagaaatc aaaccaaaaa    344880
     cttcccccga atcctctcct gcatctcaaa cccaacccca accctctcca aataccccct    344940
     aacaccccca tacctcatct caagataccc cgtcgtctca cccacaaaac caggcggaca    345000
     acgcgtataa tcctccccaa gcccaatagc cctaatctcc tccatccgct cctcaaactc    345060
     cgacacaagc tccagctccg agcgactata atcatcaaca atcgcctcag tcggcacacc    345120
     cccaacaagc aacaacataa gcaaaacaac caatcccgtc cggtccttcc cctgcgtgca    345180
     gtgcacaagc gtgggatacg attcctcgca cgccaggatc tcaaacacag cgcggatctc    345240
     agccatgctg gaatcgagcg tgtcttgcgc tagacccgtc aggccgcgcg gttgcattac    345300
     cgagccgcag actagacgca cggcgtcgct gcggtatcct gttgttgcta ggccgattgt    345360
     ttttctattg ttattgttat tagaacggta ctaggagtgt gtgaaggggg tgcggggtgc    345420
     gttacagata tgtaaaccag tccagtttgg ataataaggc gcgttcgaag cctttgcctg    345480
     ttaggcttat tagagctcgg gtcgagccgg ggatgtggag gagatgttcg tctggatttg    345540
     atgggattgg atctgtcggt gatttttctg ttgagtttga tttttctgat tctgattctg    345600
     attctgattt ggcgatttcg cctcgacgtt ttcgcgtgcc catttggtgt tctgttctgt    345660
     ttttggtatt agtttctgct ttctgtttct ggttttgcgg gacatactgc gaacgcagat    345720
     caatgacggt gtgaatgtgt agttcttctg ctagacggcg tttatctcgt tctgatgcgt    345780
     cgtcgagctg ttatcgaatc agttttcgtt tcttccgtct gacaacgcat caatgcagcc    345840
     atttgagcgg ggttggaatt actcttgcgc tgcgaaagaa gactccttct ttcagtattc    345900
     tatgttaaat ggttagtttt gtatttagag acttcaacat cgagacgcgt agctcactct    345960
     ttgcgacaga attgattaac cgaccggccg acatcgcgga aattgatgat gttgtcgaag    346020
     ggccggtcgg gtgagtctag gtccacgctg ttatggcgcg acatggtgaa ttaggaatta    346080
     ggaattagag aatatggaat ataagaaatc cgtcgagatg aggaggagga gcgtgtttaa    346140
     acgtgtttaa acatgtggag aagtacaaat ggcggtggac gcggacgttg ggcagacatc    346200
     gcgttttggc cgatagtcgc ctggacaatg aactttttgt tttttttttt tgttttttat    346260
     ttcattgtca ttggttgtat gtatgagatt caatgtttat tggtttgtgt tgtcttgaaa    346320
     gaattgacta tatatagcag agacgggtgt tttagttggt ttctatgttg tatggtctaa    346380
     tctaaggacc tttttgtatg aattgctaga aactcgacag gggactactt gagtgtctgc    346440
     tttgaacttc ctagtacttc aacaatgaag tattcaagtc tgatgtcaac taaaaccaag    346500
     gaagcccata gatatatgta gcgatgatga aacaggtacc ggagccaaac aaagaacttc    346560
     ctcagatcta gaccgggaac atctccaacg cggatcaatt cactaagtca accttccaag    346620
     gttggaacat caacacttta cctaaacata ctgtccccgg ttgttctccc actgtggctg    346680
     caggtatgac caatcgtgat tgaagttgaa tccagtacga taagccccat atgcaaccag    346740
     atccacctga ctcaatcggg ccccctgctc cgtcagtgcc cacagactaa tcgccaacgt    346800
     attctctcca cggttattaa tcacgcccgg cgggaaaggg aacctagtct ggggcccgat    346860
     atgcggcagg taatgaccaa actggtaccc attcatgaag atctgaacca ctgcgggggc    346920
     gtcagcagat gcaccgagct gcagaccaat cggaacgtcc aggtcggagt ctagatcgag    346980
     cttgaaggtg gtcgtgtaga accggcctgc tgcaccagac acgccgtcca gcggactttc    347040
     tgatgtcgct gtcttggacc ctttgtatcc tggcagatgc cagccaagac gctcgccgta    347100
     gagacctcct tcgttcatgg gtccccggac ggggtcgatg ttggcttcgc cgcctgcgtt    347160
     gccttggatg cgccaggagg tgaaatcgcc gccaagaagc gtagcgccta gtattccgcg    347220
     cggattctgc gacccgttcg gtttcacgtt tgcttggtcg tggcctgtgt aatccatgac    347280
     gacggttagg acgttgtctt tcctgcgtaa ggtagagctg gtgaattcga gctccgctga    347340
     ggtcgcggct aggtcggggt cgccaatggc tccaccgacg tagactccgt ttaaccaggc    347400
     ggcccagccg gcggcgacgc cgttctggac ggtgatgttg gcgcctgttg ctgtcacacc    347460
     gtcgaagcgt ccgcggtaga tcttcgttcc ggcatggtag ccgtagtcgc cagagtagag    347520
     tacggggagt gttagtggcg ctacggaatt gactgaggtt gttttgttgc agacggtcca    347580
     gcgagaatcg tcatagtctg gattaatctc tggaagtgta tcttgtgctt tccatgattt    347640
     cagggttggc agtgatagct tggcatgttc ggctcctggg gctgatccga ttaagctgcc    347700
     gtaggctgtc ttcttagttg gggtctcctt cccattccat ttgatctggg taacttttga    347760
     gtttcccgtg tagaccctgg aaatgtatat tagctaacaa ctaatttgag ggtaagcaat    347820
     cccacttact caagagatgt tgcgtttgcg ttgtcaccaa caagactgac tgtgtgcccg    347880
     ctgacacttg ctgtgcgaac gagatatggc ccaagagcaa ggatctgctc actgggagct    347940
     actcgcggat tggaagtagt cggcactgca aagaagttcc acgctgtctc tttgtcgaga    348000
     agatagacta gcacgccgtg cgagaatttc agcacagtgg tgccatctcc ctgacagtat    348060
     gtgtatttgg tgccatggtc cgatttggcg gagctcactt tcgaattgcc gtatgttttg    348120
     aaagtcagat gggttggtgc atctttgaag gcaaattctc ctttctgtcc gatattcaag    348180
     tagaaaacaa tgacatctac atcgagggtg gcgtaggtca aaacctcggc ggatgaatag    348240
     agcaagctcg agccatcccc ggtttggtag tccgtgacta taattttgct ctgacggccg    348300
     gcaagctcaa tattggggat ggtgagggcc cctattacgt ggactccaag ttagcgcaat    348360
     tcttcctcct agacacgggc acataccagc tgaggtgttg acattaagcg aagtagtagt    348420
     cacagcacga gatgagctcg tggagtgcgc gagaacatag aagccagcat gagtttctgg    348480
     gttccgcaag gcccacgtgt agatactagc atcgctggtg tacccagtcc cattcccttc    348540
     catctgcgtt tggagaagac cagacgacac gcgagtaaac agtccaatca acttggtctg    348600
     cttgagcttg tcccgaatct cacgagtctc tcgcatgggc gcagagtagt catacgaagt    348660
     gtaaacaaca ggagcagcac tttggcccca agaagttgcc cccatcacca tatagatatt    348720
     gtgcaatgtg accctggagc cgatgttatt cttatagtag acgtcggcga attcaggcga    348780
     aagctcggta gagcattgat cgtagaaact ccctccccag gcggagaacc aaccgccctc    348840
     gaattcgggc aggtactcag gctgagaact cgagtaattc tggaaccact ggtaataagt    348900
     gcggacgaga ttgaacccag agttcgggtt ggtgcacgac agaccaccgg gatatgaatc    348960
     cagaccatag atgttgacgg caccacccac atcctggtag tcagtcgacc agctcatcga    349020
     gcgcattcct ttttcgttat gtgtgctcgg gacgatgatg ccggcatcgc tgaaggcggc    349080
     tttgatttgt tccatgtact tgacaacagt gttatcggca ctgtgaattg tctcctgcaa    349140
     ctcattctcg tgctggttga gaatgaccgg accaccattt gtgatttggt tggcggcgat    349200
     gatctttccg atctcctgga tccacggata ccatcggtca tagtaggagc ttgcgctggt    349260
     gcgcgtgctg cccatttggc cattagatgc ccataatgcg aacccaccgg cggaggtctc    349320
     ggcattgcag taaggtccag cgcgcgcgat cacatacaga ccggcctgct tggcataatc    349380
     gaaaacacgt tggacgtcat gggcgccatt ctcgaagtcg aaagtatcct cggaagcgga    349440
     gtggaaactc cagaagaaat agactaatcg gaatgagtac tagtgaagcc tggagggttt    349500
     gtcaagtcac tcactagaaa ttgcattaaa gccatttgcc cgtaacttct ggaacacgtc    349560
     gagccatagc tccggcacgg ggagtcgctg gtagtggaat tcacccgaaa acacgtatac    349620
     cctctctcct ttgacagaga ggctgtattt atcccatgtc acatcagtag tcttgccgtt    349680
     atctgtcgca gagacaaagt ggctggaaat gagcccgagg aggaccggga gaagtgcgaa    349740
     aagacgcatt gttggacgct gtgcaggtat ccatcttgga atatgacttt gttataatgg    349800
     gtgtatgctt cggtcctcgc tatagagata ccccgtactc tgctgggatt ggtggatgtt    349860
     ttggagattc aaagtccgat taggcagttt tccagggttt ccagggccgt gaagatgcgg    349920
     ggaatggcca gctttcgacc ggggcattac atttacattt acattttata tggatagaaa    349980
     tgtgccaatg gtagaatgaa aggaagtgaa taattgaaaa agccttgatg tgcagtttgg    350040
     cctaatgata atagaaatct tcacgacccg tgtcacagga agtaggcgaa acaaatatct    350100
     tgatatttga aagtcatcag ccctcccttt ttgtttctgt taaaagaaaa taacttccga    350160
     taacaccgac gacgtgataa aagatccatt ggagtctccc cgtcgaaatt gcgggcattt    350220
     cgatccgctc catgagcaat aagcaacttg accacttccc attccgatgt cagcactgcc    350280
     aggtggagag gtgtattgtc atccgcattc tttgcagcaa tatctgctcc atgtttcaat    350340
     agcaacctga ttgtttcaac cattgctttc gttgctccgt atgccatggc atgcagcggt    350400
     gtttgaccat aagagtccac cacatttacc ttcgccccat gggccagaat aagcttcacg    350460
     aaacgcacgt tgtcgggttt gtaaaggagg ttctgtcctt cgctgtcttc aatgctccca    350520
     cactctccat gactcaacag aagcttcacc gatttgtgaa tgaatgaaac gcacgtttca    350580
     ttatcgactt tctcaggttc gggctcagat attgggcatc gaaactggtc gacttcattt    350640
     aactcgtctt cgtctgagtc gcatccataa gggcttgatc cttctgggat gaccaattga    350700
     agtgaagttg ggccaaaggc agtccggtat cttatattag catcaagatc caacaactgg    350760
     cttatcaatt cagtcctatc ttcaaaggtc tctttgattc gatgccaacc attgagtttg    350820
     tcaagagtaa gcccgcaagc aacgagcagt tctatcatgg cctttttgtt gttttggtgt    350880
     agagtagtct caccgatgta agcccgcaca ctggagtccg cgccgtggtt aacaagaagc    350940
     ctcgctgttt cttcattgga aaacgaacat tggttcgagg attctatgaa accatgaagc    351000
     acgtccttac tgctcacatt cgctccgcgt tcgacaagca atttcaaaat gccgttggag    351060
     aacgagctac atttgaatag cgcacgtaat accggcgtat ccggaaagta atgaagcccg    351120
     atgaaattgc agtcggcacc aaaatccagt agtagcttca cagtggcata atggtccacc    351180
     actgccttct tcctggatcc ggagcaaatt tcttgcttct gacaaaagca gtgtctctct    351240
     aggtgaatat aatctacttc tcccaccgcg tcagatagaa ctccgatata ctcacctggt    351300
     ggcaaggtgc gggagtcaaa ttcaaattca agcagcattt tcataatagg aaaatagccg    351360
     tttcgagcag cataacgtag tgcgcgggaa aaagatccca ccttaacact tggagtctct    351420
     acctttattt gattcaggtg tgcgagaagg tcccccacta tctcctcata gccattctta    351480
     acggccaagt ccaagcttga gctactccag tactgtgtcg gtttgcaaca accacctggt    351540
     ggccgagttg gttgattttg gagggtatcc ttaacgcatt cgatgtctgc atttattgaa    351600
     agcaggagcc gggttccatg cacatcgcca gctttaacac attgtgtcag cccttgttgg    351660
     agttcccaat cctctcgttg atgacgacag tgccataaga gaggttgaca aaggttgtgg    351720
     tagcattcca ggagacagat tatttcgcgt acggatatgg ctgcggcaat ttcacatacc    351780
     aactccgttg gcaatgaaac gagagatatt tctgccatgt cgaaaagtca cttcaactgg    351840
     tagcttggag agagaaagca atgtggaaag cgataaaagg gaagagaaaa agaaaaagaa    351900
     gtgagagaaa gagacttaat gaatccatgg atgtcatgtg agttatgtaa tgtgcccagg    351960
     tgagtctatt tcctctattt ccatctgtct cctttcacaa atggtcagta ggtatatggt    352020
     atgcttcagc ctactccgac atcgctttca aacgtccgta gccaggtacg gtaattcaga    352080
     cctgccgagg ctttgatgca attctctggt ctggagttat acaacgtgga aacactgtgc    352140
     cggcaccaat gaggccgatt ttatgtacct acatatatac tctgtccttg acgatgtatg    352200
     actctagctc aaaatgacct cgggatgtaa ccgacgttaa gataccgcta cgatggtcca    352260
     aggttctttt tggatgtctt tctggatgtc cttcatgtca tgtaaattgt attcttgaga    352320
     catgagtacc gtggatgctg tcgtcagctc cgttgccgta tttgatgatt tcttggaggc    352380
     cacttacgta ggtaactttg ctcttatctt ccctgttagt aactctttct ctcttttacc    352440
     aacgccctca aataaaatgt caatttcact tctttcactg tcaaacgaac tgctgtttgc    352500
     tattctagcc gaactagaag tcgaagatgt cctctcagtc ctcgaaaccc accccgatct    352560
     ctatcaggtt tcatacaggt gtctccgcaa acgcagacgt cacctctctc tgagatcgta    352620
     ctccatctct ggaaatatct ccagggtccg aatattgctg aaagcaggtg caaaagctga    352680
     tgattggtca ttaactttcg gatcgtccct tgcccgcgct gctgcaaatg gccacgaaga    352740
     aatcgtgaag ttacttcttg accacggcgc ccgaatggat cacgaggggt ttcaccatcc    352800
     actccaagtt gccgcattga agggatactt tactatcgtc aagttgatgc ttgattacgg    352860
     cgttgatgtc aacacaaaag gtccacttgg acacactgca cttaccgaaa ccatcctata    352920
     caagggtcga tattcttacc agaaaggagg gccgtggatg ggacgtggtc gatgtctgta    352980
     taggagaagc aaaacaccct tcagctacta cgatacaatg aaggtacttc tcgaatacgg    353040
     tgctaatccc agtattccaa agccttatgg ttcggcatta catacggcca tggaaaatta    353100
     tccctacctg cagcaggata ctgtgggctt gcttctggaa tacggagccg atccgaatgc    353160
     tcgaatttat ggcgacgtaa ctccattaca tttgattaat cctacatgta ccaagcccaa    353220
     tgaccctcga tgcactgaaa tagccaaact cctccttgcc catggtgcgg acgtgaatgc    353280
     ccaaaatacg gacggcataa caccaataca catcgcagca gctgctaatg ggcggggaga    353340
     agctctcact cggatctacc tcgaccatag ggccgacgtc aacatagctg attcttatgg    353400
     attaacgccg ctccatagag cggttgcaag gtcactcaac aatattccag taatagagct    353460
     gttgttgaaa tcgggtgcca atgtaggagc gaaggaagcc ggcggtaaca cacctttgca    353520
     tacggcagtc cgtttcgaag cacccaatga ggcaatccaa ttgcttttga agtatggagc    353580
     agatatgaac agctcaaata aagaatacga gtgtgacaca ccgttgaaaa tgatggaaaa    353640
     atggcttggt gagaccgtcg gtcttcgcta aacgtagtag tgtgacggct acttattatc    353700
     cttctagcta taatactaat aaagcgaaca aactctatag aaaggtatac atccaaggaa    353760
     atacctaaac ttgtatctaa aagaccacta aaaagaccac cccaagaaag taagactgtg    353820
     tcagcgacta gttcagtatc cttatatact accgcataga tatgagtgga ttgtgaaggt    353880
     agaggatcaa ggtgctgtag gcaagcacat ccagattaca ccaatcgtcg agacggtccc    353940
     ttgggtattc gttcatatgg agctcgccac tgatcttcgc tttggttgat tagcgcttta    354000
     atttaaggcg gaggttattg gtttggatta aggatggatg atcaccttga aagacatgcc    354060
     caatgaccgc aatggttcca taaagacatc gttattagat caagtaccta tatacgaagc    354120
     accaaaaatt actagaaaac taaacaatcc aaatccccca gaatcaccag aatcaccaga    354180
     tttcaagtcc caaaaacacc aatagatcac cccgtaagat ccaaaataac acaatcgtac    354240
     atcaagtcaa cctttcaaat agacatacac atcaacattc aatatggcaa tcacagattc    354300
     tcagagaacc tcgattctct tctcccgttc acggtctcgc caatagtagg cggcacagga    354360
     agactctgtc caatactact ttcctgcaga ctctggatat caccgccgac atccttagac    354420
     gaagattgaa ctcccgagtc atgacgggat tcatcatcgt tcgactgctc cgggctacgc    354480
     gagacggccc tgaggagcgt cctgctcaga cggttcctct tcttaccatt gccattttgc    354540
     ttggtagagt ttggcacaga gtcggcactt ttagtcttgg tcacgtcaag gtcgttgctg    354600
     tagtagctcg aagatctgtt gtgcgtcgcg acaggttcac ccacgccagg ggggtgcgag    354660
     ccaagtgctg cacggcgcgg ctcgtcgcga ccggttagag tggcgccgcc ttgaaaggcg    354720
     ggttcgttgt ctgtgtttga ctccgggccc ggctggtgtg gatagatggg gactgggcca    354780
     ctggagcggc gaacgagacg atcgcggaac cagttcttga gcttggtgtc ggcgcgcggg    354840
     cttgtgactg gtggcgtaaa gtagtgcaca attgttgggc ctgcggcggc ggcgtctcgc    354900
     tgctcgatct ggggcggctc agtctggctt cgtgtcggcc gccgtgggac tgccgcgggc    354960
     acgtcgtttt cgtcgggctt tgaaggttga gcctctggga cagaggatgt ggctgcaacg    355020
     acggtcgcgg gaccgggtgt ctctgtcaca atggaagttt cctcaggaat ggtgaccctt    355080
     gaaacattgt cctctgtctc aacagaggct tgctcgggga tggtcaccgt cgagatattg    355140
     ctgtctgcgg ttgtagtcgg agcctgctct actacagctc cctgggagac cgctccctgg    355200
     gagaccgctc cctgggagac aggtgcctgg gagacagggg agacagcttg agcctcttcg    355260
     gtctcagatt tctcaaccct agctcgttta cccttcttcc gccacaagaa gaatttggga    355320
     accttgccct cggatttgtc gcgcttgctt gcttctaatt cattggtcag atacatattg    355380
     agagagtgaa agacagggca actaaccttt ttcttgcttc tccaactcct tcacctcagc    355440
     ttcgcgctga cgctccacgg cagcatgtct ctgctcctcc tcagcatcca gacgggcttc    355500
     gatatcatgg gctctccgta gctcagcatc ctcggtaacc tcatcgagag caggctggag    355560
     gcgcgaccga gcgatggcgt cgatatcggc catgtccatg tatttttggc cgccgatgtt    355620
     cacacgattc cctcgggtgg tagcgtcttc gtaaacctct gcctcccgtc gcacgcgttc    355680
     ctgggcaact tcatcccact ccttctgcac ggaaggcgga gggcgaccgg tgtccgcgta    355740
     cacttgtgcc tccatgtcct gaagggtttg gtccacattg cggcgggcag cctgcataag    355800
     caattcacga tcctttgtct tttgctcatc tacttgatcc aacttggtcc gcagggtggt    355860
     catctggctc cggatttgcc gcgactgctc cgcgtcggtc tgggaggcat ccgcgtcgct    355920
     tgaagttctc ttgcggcggg ttgtcaagcg tgaccgttgt ggctgaggtg cagtgccata    355980
     atatcgctgg tagtcagtat gctcatcctg catgagcgcg agcttctcgg cagctcgctt    356040
     ttgcgctgcc tcttgtaggg cgatcgcacg tcggagggca gtcccgtccg cggttgatac    356100
     ggtcttgcgg tagcccagtt gactctgtcc tttttgagct gctatgaggg caggcgattg    356160
     gccggattct ttcttggtgc tcgtgactct gtacatgtcc tttgccattg agatggcagc    356220
     agcgtgttgc gagttccggt agttttgttc ctcgatttcg ctttggacag gtggcgatga    356280
     agtatacagc ttcgggttag tgttaaccgc atgttggatc cggctcgctt ccatagcagg    356340
     atctaagtgg tcaagaggac ccccctcttc cacgggggcc tgtaattcgg aggtaagccc    356400
     tggttcactg ggtgccgagt cggccctctt acgcgagagc gtgtaggcgc ccgacgcggc    356460
     cttgattgcc ttgtccctcg ggttgccacc gacggctgta tagttgtaac catcagttac    356520
     tgagctgccg cgtctgtggg cagctgatgt gggggcctgg cacacagagg ctctcttttc    356580
     acgaacagcg agcatcgcgg ctcccagtcc ctctgcactg tgctggctgg tgggttgggg    356640
     ttgctggggc ggagagtaat ccttcacgca taatgcagcc ttctcagcgg caggctgtct    356700
     agctggcggc ctccatacct cgacaggttt gcgattcgcg tgcgcgagag ccgaggcagc    356760
     ggaggcgtgg ctgagttttg gagtaccacc gaccgcgcgt gtgtctgcca caaggcgcat    356820
     tgtcagcttt tattcgccta tcgtatcgag ggatgatact cactgaactg ctgggtgttg    356880
     gttgcggtcg gagcgcggag agatgccctt cgttcaggct ttgtcacata tagggcagct    356940
     gtcgcggcta tttcacgtga ggtcagcgat ccgagcgcag gagatcatga ggatgcatcg    357000
     tcttaccatc atctgccagc cggggctgac gagtcatttg cacagttgcc atatttcagg    357060
     aactgcgaca aatttagaga caactgaagt gggaaagaaa agaaagagga atcgcagggg    357120
     acaaaactat cagtgtgtgg atatggaatg gaagtccgga aagcttcttt catccccgtg    357180
     acgtcgattg ggaagccatt gcatcatcgc tggggggaat tcgggggcat tttgacattt    357240
     tttatgggga agatcgatct gtcccgaagc cactcagagc tccatgggcg ctagtgaacg    357300
     atctaagtgg agtgaagatg ccgcattcga acaagcgtga ggcccatttt tcggtgatga    357360
     cgtctggact cgagggattc catgaaccct gatctacatc gatctacgat atatatgtcg    357420
     atcctccaaa tactagtgac gataacactc aagagtacct acctcggtag gtaagcaact    357480
     acataactac ctaaggtagg taggtacatt gattgagcag tgatgttagc cttaataaca    357540
     aggcagattc gccaaggatt tcatgacata actagctaga ttctattgga atcttgaagg    357600
     gcgatgaagt ccccataaag aatatctaca atgttaatgt agtaatctga ggacaaaatt    357660
     gcacatgtag ccatgaaagt ccaacgtatg accccatgac ctcaccaaag tcttgtgctt    357720
     cgccgcacca tagacctttg ccaagaaaga caagacggtc atccccaaga agtccaacgg    357780
     ctgctccata aattcggtaa tatgatgcgg atataatcgg cgcttaatgc gtcagaggaa    357840
     attgagtcaa tgcgaccctc atatagacgt atacagcagc agagagtaga aaaccctggg    357900
     tactacctgt aaactacgcg tatgatctct tctaatagat ttagctgcag caacagggac    357960
     agagcggagt agacgaaata ctgctgaagc ctgtatgtag atagggcttc ctactagatc    358020
     gtagaataat agatagcccg gggatatgtt gatcatcgtg agcggtcttc caaactacta    358080
     tagacggcag actaatgcgc tatctaagct cttgtgtagg ctctaaacac attaatagtc    358140
     gctattatct aggtatatat ctgagttcgt cctatactgg ttttaaaata acggccccta    358200
     ccccatatac ataacaaagg acctagagct agcttttgat acggactaca gttaggaaac    358260
     tttctctcga aacgccgttc caacgcatag atcacctgcc aggctataaa ccctccactg    358320
     gctagagaga gagagaaaaa aaaaatacca gcggggcata ggtagttagt aaataacgga    358380
     agtttggtcc ctatcagtct tttgcgaaag gccggtaata ggctagacgg ccctaccgtc    358440
     tgcggcctaa gagagcttcc ttaatcgcct agaccacgaa aacgaaattc gatgaaagaa    358500
     aagaagaaag aaaagagaca gagggaaaaa aaacacctca gccaagactc gaacttggaa    358560
     cttcacgatt accagtgact ttgtatagga gtcgtacgcg ctaccattgc gccacagagg    358620
     ccatagcgtc aattttttat gttatcaaga taattacagc gtgccccgta tggccgaatt    358680
     aggtattatg agaacatccg tggatgtaaa ataaatgctg tggtcgagtg tggcccaccg    358740
     gtggggcttg gcacaacgtc tggatcaatg gctatatcca cctgcaccct acatgtgtac    358800
     acagtaccaa caagaaaata tattctgaaa gtgaaaggct ttttacaaca tctcagttat    358860
     ttgaagtgtg acacccggtg acatagtcga ccttcatctc gcagccatta tcaaagtacg    358920
     catgaccaca agcgtggtca cagtcatcga aaatatggtc ataagccctg aaatgaggtt    358980
     attatcaatg tctgagttgc tgctggagtg gaacttacgc ttgcatagta gttcccttga    359040
     cttcacagcc gtctccttta atgaagacgc cacacccacc cgaagcgtgc ttgccatctg    359100
     tatagcactc tccagacttc cttccctttg tggtactagt tttgagccac attagcaata    359160
     gagaccttat tggcaggact ttataaggga agtgacttac ccgtagatat catcacctct    359220
     gatgtagctc ttcgcaacat cacagaatcc atgtaagttg ctcacaaaaa gatggcacat    359280
     ggtttggccg tgaccacatg ttgttgaaga ttcagaagga gtgtactggt tgcttgtcgt    359340
     cgttgtggcg gtgtcgtcgg tcgttgtggt agcctcagtc gtggaggtag aggtactagt    359400
     gctggtggca tagacagagg agaactcctc gtcaagagag ctagcgtcgc tagtaatggc    359460
     agcgtcatcg acactccagg cattatacct ccaagcagct tgtggagaca tggtagtact    359520
     aatcgtggaa gttgttgttg tggctgtggc atcgcaagcg gtgatggtct gacacttagt    359580
     ggaggtctcc gtgctgtagg tagatgaaac cttggaggaa gtgatgaact ctgtgcaagt    359640
     atctgcctcc ttagactcgc aatcatcatc ctcagattca catccttcac cggtacattt    359700
     accgtcttcg cagtgtggac ctgagcagct gaccttgcgg caactgggtc cggtacactc    359760
     tcccgtcccc ggattacagt caggaccgat acagcccagg gaaacgcaat caggtccagt    359820
     acagcgtcca ttgccgttac agtcgccgcc cctgcagccg tgggtgtcgc agtcatctcc    359880
     gtcacattcg cccgaatcgg ggcaatcggc accaatgcat gcggtgggct cgcagtcaga    359940
     tccgaggcag gtatgggatg atttgtcgca gtcaggtccg gtgcagcctt tcttgacaca    360000
     tagatctcct tcgcactttt tgcccttgca gtctggacca ctgcatggat tgtgtgacgg    360060
     aggagtggga tccgcagggt ccttccagtt gttgttggcg actgggtcgc tacagtctag    360120
     caagcatggc gtgtcacaga aagacttgca cttgctgcca cagtttgaag tgcaagtagg    360180
     ggccggaggg cctccttgag tccatgtgac gactggagtg ggaatatgag gaggcagaga    360240
     agtggttgac cagggccagg ggggagggac aaatgtccgg tcctcggtcc ctgtgtgtgt    360300
     cataaatgtt ccgttgacac caccgctact cgactgggga cttggcctgt ccctgaatgt    360360
     gatgggatcc agcgtgaaac tggggaacag agtctgagag tccctggtga gatcagttcc    360420
     tgtgatgttc cagttccacc aggggatgct gctcgcggta atagggggaa tcgagaaggt    360480
     ggtggtctgg atagtacgag caatagtcgt tgtgaccgta ggctgacctg agacagtcac    360540
     ggtcttggtt gtggtccagg cgacttcaag aggagtcacc aaaggatcga ctgagaaggt    360600
     cgttggggta gccaatgagg aaggtgcaac gatgatattg acgggagcaa ttgctgttgc    360660
     aacgtttgca tcactctttg catcactctt agattcaacg atagagccat ccacgtagaa    360720
     gtcgccagtg ccagaatcat tgccctgtgt acttgcccct tccattgatg catctttagg    360780
     gtcaaggtcg ttggggtttg cagaggagcc cggtccacct tcgtcaattg tccaagcgaa    360840
     gagcccacca agacacttac tattcgcaaa atcggccttc tgcttgagtg tcttggagtt    360900
     atcaaatgaa accctttgat tcgttagccc ttgacatatg gatcctcttg tttcatgaca    360960
     taccattggt tagtatccca tgtcatccag ttgacagcgg cctcctcgtt gtagaccaca    361020
     tcggggttat gctccttgat aactcgattg atctcgtagt cagtcagaat gccggtggtt    361080
     tcggtgcatt tgcctgcctt tccaccacca gcagagtcct gggtcttatc gaaggcacat    361140
     ccgggctccg cgcacgagct atccttcagc gtgaaggagc gcccatagaa tccaagacca    361200
     agcatgacct tagcagggtc aacgtcattt cgccaaagga gatccagacc ttcctttatt    361260
     tctgagacat gtggttagag cagaagacca gggttggggt aagaacatct caccagtgag    361320
     gttggtgtga gggttgacca ccgactctgt ccacttggta ttaccatccc aagtgccatg    361380
     gatatcgtaa gacatgaagt tgaaatagtc gacatattca gacagggcct ttacatcgaa    361440
     tcccttcagg taccctgtaa gaaaaaaaga aggtattagc cacattccaa tatcagaggg    361500
     ttcaaatctt gatatcgtac agtaggaagt gggaagagtt gcggtaatgc tataggagct    361560
     accacaggcc tcctttagct ccttcatgaa ggtgacgaag ttctccttgt cctcatcgcg    361620
     accacctaac aaattcagca gttagcagtt attcttcgaa tcatggaatc aaagcagatc    361680
     aatgcttacc tcgatcctca gcagtaggat attcccagtc aatatcaatt ccatcaaatc    361740
     ccctgtcctc catgaattca atggcagagt caatgaaaga tttgcgcagt ccacggaagc    361800
     gaaccatgtc ggagaagggt tcgcctccaa gatcccatcc accgacggag ataaaagtct    361860
     taagtgaagg cttcttcttc ttgagatcca ttaattcttc gatatattca tcgtcatgat    361920
     cgtacgtggt ttcgatagtt gagtcatcag tgttaatagc agcaaagcta taaaagaggt    361980
     gctaaaagag agaatcatgt gagcacagga ttttacccgg gaaataaaaa tattcacgta    362040
     ctgtccatgg gttgatatca atatctgaag gcgtcatggt atcgcatgag cgctcatagt    362100
     tccaagcttc gaagtaacca gcatagacat ctttgctgga ggttcccgag catgagctac    362160
     tttcgtgtta gcttcaattt caccgattga gaaagcaaag atagtaggga aagagagcat    362220
     acggttgttt gacatcgtcg catccgcttt ggcagccctt accacagaag tccgaactgg    362280
     taccgcagaa tctggatttt cacggcgtta gcatatacac aagctcagat caactaagtg    362340
     acagttctta cccaaattca gaacagcaaa catttaaggg acatgttgag ttggcaacat    362400
     gagcatattc tattatttta atggtcagat tctgccttcc aaggttgtaa atggcacccc    362460
     ttaaatattg caaacttact tccacactca gcctgagcat cacaattcga gatgcaaaca    362520
     tcatcgccac agaagttggg accgaagccg cagtagccct ctttgctaca gcaacctgtg    362580
     tcacacttct tgtcttttga gcaagtgcca ctggtacctt tagcacccag gactagatcg    362640
     caaaataaag gaaacaaggc aagagccttg gccgcggaaa ggaaacgcat gttttctttc    362700
     cccttgaaaa gaatgacaat agctttgaaa aagagtgtgg cttcaatcaa aagaatgtgt    362760
     tggacaaagc gattggaaaa gtcgattgct tggggtcttc ctatataaac cactttcgaa    362820
     tcaactaacg aggctcattc cattctaaga gcatttgaat acatttgagg aggtatttcg    362880
     aatacagtat cacggtggat gtgccaaaat acgtggggcc tcttgaagaa ttcgtcttgg    362940
     atgggtattg gaatttgatt tttcaggctt ttcatacatc ctcatccgtt cagtacctga    363000
     agatcactac ttcttgtgca tagacgatgt ttgggggccg ggggccaagg acagcatttt    363060
     cgggaggctc tgataccaag ccgggtgggt ggtgggtcaa gatccacatt gatacaacac    363120
     catctatatg atcgtcgggg gccgaaagaa gacgctaagt ttgaaatttt acatggcttc    363180
     ggtgagtttg gtgccgcgcg atcctattcg tgctcgaagc agctcttggg cctctaccta    363240
     cgcgtttaca cttagtttac ggactacaac actcacggaa tccgaatcat acacgcctac    363300
     atagaaacta catagactaa tgggcccact tattattcaa cacttcttca gaatatgggt    363360
     atatgcaagc gagttgggtc tcatccctga acccctctcc ttcgttgtga taggctttag    363420
     gggtgaaaag taacttgttc taactccagc ttcttgctat cctcctgttt taccataatt    363480
     atcattcttt ttgttgaatc tggtaatcat catgaagttg aacaccgcaa tactcgccgc    363540
     cttgcttgcg caagcagcaa atgcatggaa agtcggagat aaatctactg gcatgactga    363600
     tcctggcgtg acttcgaaat gtattcgctg ggccaatgat attggatccc acgatagctg    363660
     caaggcactg cagagcaaat ttgacatcga ctatctgcaa ttgcacgaat gggtgagcaa    363720
     ttaatatctt gctggccccc agcgtttatc tgggagctga aacaactgac ttctccacag    363780
     aacccatcgc tgctgaaaga tcattgtgtc ctgatcgagg gctggagcta ttgtgttgct    363840
     agctcaagct cgaccaacag caatgcggca ggcatgggga ccgaggcacc tacgctccat    363900
     agttccgctt ctacggggtc tgctccagcc tctgcaacga ccactgttac tagcacagcc    363960
     tcgggcacta ctagctcagc ctctgccaca caatcaggtg ttgcaacgag ccttacacct    364020
     agtcagggcc atgcttttgc agttgccgca cttttccttg gggcctctac actgctatag    364080
     tgctctcgga ctgatagaga gcgcaagggg gctgattttg gtcctagtct gccttgaaca    364140
     ttgtatatgg atttactcct tgtgttctaa tgttcttgtg cttgaatatt cgtatgcttt    364200
     aactctctta tgctgaatgt tctgtgctct taccttgtcc tcttaatatg ggacgatcat    364260
     tttttggggg gttgtaaata ttgtaatggc aataaatctt caagtcttat tcgaaaatga    364320
     atgactctaa tgtctcagcg gcttctcaat cacaaaccct gctcaagcgg aggatgaggc    364380
     ttctgtcttc acgttagacc tggcccaggc atcaaactta ataatgattg gataaactta    364440
     ccgggtccag ctacacagac attggtcttg cgccaaagat tagtgcattt agatccagtg    364500
     gcagggttca aatgatagaa ttgagccggg gtgaggtcat attcgctccg gatcgaggtg    364560
     cagtcatcat ccccagaaac aaagtgccaa tgggtgccta ggtcacattt gttagtgagt    364620
     ctaacgttag gagagatgcc gtggagaaag aaactcacaa tctttaacca ctccggtctg    364680
     ggttgggaaa gccgaggagg tggtagtagc agccgaagat ccagttggag aggcagaggt    364740
     agatgaagag gacttagcag caacacagac aaagtcacca ttctttaagc ctttgcagcc    364800
     ttttgaaatt gaactattaa tgttagacga tccatgcttg aaggtgcgca accatgaact    364860
     tacggattcc agctgtagaa ttgacctaga gtaaaggtca tatacttatc ctgaatgctg    364920
     ttgcaagagt caccgttctg caccaggtgg tatttggtgc aggacttggc aatgccactc    364980
     tgggttggtg cagcagtgcc actgtagctg agggtacccg ctggagtatt ggcggcacca    365040
     cttgctgaag aagtagctgc agccggacca gaaacgcagt agctccatcc agggaccagg    365100
     acacagtagt caagcttcaa ggaggggttc tgagcatgcg tcagttggca agtcgtattc    365160
     aagataaagc aaatagagct cgggtgagct tacccaggag acgagctgct tttgggtaat    365220
     tccaaagaaa tcaaccagcg cgtcgcaggt gtcactagac tggacatcat tcgcccagta    365280
     gtcacatccg acggcagcat tagggtcttt tgtgccagtc gccttgggac cattcgtcca    365340
     gtcaccttgg ctggctgcag cagccgcacc tagtaccagc gaattgatga gcaagttgga    365400
     tttgagcatc atgctggatg gggggttgtt ggtgtgtttc ctcggtagac tatacaagga    365460
     aaataaaaag cgaaatttga atcgactctg agaagttaaa acatggttcc caagacagag    365520
     cgggtatcct catagtaatt gtggaaaacc actaaactat acaatatccc atccgtttca    365580
     aaagctggca tggtgggttt cattcgtgtc attgcctcta tctgttttcc catatccgta    365640
     acggtatcat aacagaaagt ttacatacta acgagcatgt aaaatcgagt tctttacgag    365700
     tccactgcca ctgccaactc ggtcgatcta cttaataagg tatgcacaag cgaggctagt    365760
     gataagaaaa ttgggtgcat acaatgtaaa ttagttctac atggagccaa tactaaaaat    365820
     acagcattct ggttgccgaa tacatacctg cctaggtagg tacatatcgt gtagtttaaa    365880
     gtggatatag ttgggggccg gggcggatgg ataccatgtg ggttccatgt gggttccaaa    365940
     ggcttgagaa cggctgggtt gccacaatag gaaattcgaa cagcgctaga ctgcattggg    366000
     tattttagag cccgcgattt gtcaattgat gcaatcttcc atgtactaag cattggggac    366060
     ccactgcagg ctcttcgatc gcctcgggcc tcaaaatccg gtatccgtgt attttggccc    366120
     caacgtgcga catgcactat atctcctcgc cccctttatg ggactatgcg gttatctatg    366180
     gacaacgtat gagggatttt aaggtcgata cagacgatcc tcatcaatga aagggttgga    366240
     aacaagaaga ctgtcaaact ctcaaagggg ccaaatacat ggactatgta ttgttagaac    366300
     tgggcccgta cctagccagg ggatgcctgt agagcacggc aagtcagtag ttagtgaatt    366360
     gtgaaataga ctcttatgga gcgcagacct tcaccatcca tattgtatgc tctacacttt    366420
     cactcttttt gaacactctt taggcatttt tttctttgaa cacattcttt tgccatcaag    366480
     ccgtcgaatc ttacactctt ttgacgatgg tgatggtctt tggtcctcca ggaagggcct    366540
     tgctggtcat cattggccat ctattattct tctcggacat tttacaactt gcgcaaggtc    366600
     ttccatttga cttcaaccag actacttcgt ccattgattt agagaagcga gctccgggcg    366660
     ggcggacctg gacctcgcct gggaagtata caaatattcg tttggctgat tcgtgtgcgg    366720
     gaaaagagaa attcttcgag actacgtttg atgacatgtc gaaaatggtg agtcttcaat    366780
     gaaaacaatg tttcaccttt gctaaacttt gggcttggcc tctccctgat catcacacca    366840
     atgagctaac atcttgaata ggtctccgat gcaaaaaaga caatcccaac catcgagaaa    366900
     gccctgaaca aggatcgcaa gaagatgcta cccactgaaa aatcatacgt cgatatttac    366960
     caaagccttt atggaatgtt tgatctgaaa aagaaagcca aggttgataa cgccaaaaga    367020
     aagctccaga tactgtccgg taggtcaagt caaatcggat acagactttc gtggaccggg    367080
     cagacctgat gtatatcctt agatttcgtg ggaaagtacg accaaggtct ttctaggaat    367140
     cagttccact tcgatattta ttgtgacggg accgattggc aggacagcgg caagaaaagt    367200
     aaagatggcg acggtgagtc acacaccatg aaatccaaga tagaaaccat ctaatcttgc    367260
     gacctataat agctataatg gtcttgcaag gcgacccgtt ggcccaccca actctgaccg    367320
     agaaccctac cgatatatgc ctagaggcca atggggataa agaaaccctc gcctttgtga    367380
     ccactagtac gaacaagagc aaagactaca tgactatttg tccaaaagct tggaatgagt    367440
     ggcagggcaa ggatactctc gcaacaaagc aatcgaaggc gctgaagagt cttctgggtg    367500
     agacaatcga cgatctagtg aacgagaccc ccgagagtgt gcttctgcat gagctcactc    367560
     acgcgcaagc tttctttggc gccagtgttc ttggtaagcc agacaagtcc atttcctttg    367620
     cctcgcttag attgaagaga tttctgacag ctatgttgct tttgacatgc agacgataga    367680
     aaggtgggcc aggaggaccc agatgacgat gatgcttacg agtgggacct cctcacaaaa    367740
     cttgcagacg aagacaagga tgtagcccaa ccaaaaggag ccgcaagaaa caaagacatt    367800
     cgtccccttg ataatgccgg tatgattctc acttgataat tactcccatt ttgcagagct    367860
     aatcggggtt tccagatacg tcgatgtttt tcctttctgg tgagcgttat tgtggtccat    367920
     tgaagccctc tcctgatcgc tggactaatg ctgccattca ttctaggtct ttaccttagt    367980
     gcgaaaggca attggggaaa tggaatttgc cgggatccta aaaaggtggc ataaagccag    368040
     tctctatcgg aaagctcttt ctacacttgg caaaggtttt cgaggattgg cgaggattgg    368100
     cgaggattga cgaaggatta gtgacggtag aagcccatgt gagaagcttt ctataagtcg    368160
     tgtggacaga tgttagaaat cttcaatgtt cttatataca tcagcaattt tctgcatcaa    368220
     acgcagtatt tacagattat tcttgtttcg aaccataatc gatggatcta tatcgcgagt    368280
     agacccatta tttccgcccg cgaacctttg ctccatggaa tcatattgta cacagctcga    368340
     caaaatcaga aaatcaaagc aaaacacaaa agaaagagac gaagagaggc taggagccat    368400
     gtaattgaca caattccttt ggccgaacac aaaatgtgtg ccccatagcc gcttatttcg    368460
     ccctgtttcg atcaggaccg tatatcaggg ctaataccat gttctaaaca aatatcaatg    368520
     atgggttgat acccagagtt gatacccatc caagcgaagg acgttccacg ttttccacga    368580
     cttctcgcat ccaaccttgc cccgttatca accaggaaac gaaattcagg agccttccga    368640
     tattgtatgg caatgcgtaa tgccaggctt tgatcttctg catcagcacc gtactgtatc    368700
     agcagcttga taaggctgaa gctgtcatct ctgtgcatag ccagcgtgag tggagccagt    368760
     gattttgatg gtctccccgg ttgataattg atggatcgag atggcttcct gttggggtcg    368820
     gccccagctt ctaataacag tttggtcgtg cttaatggaa gcggagcaag atcgagcgcc    368880
     ccacaaagag gggactgact ctctataggc agttgaaagt tgacgtcggc gccttgggag    368940
     agaaggtatc gtatgcgatc gtcatcaccg cgttcggcgg catatttcaa catccagtag    369000
     agatctaact cagggtttgt tttgccatgg gggtattgac gtagcttctc aaagaggtaa    369060
     tcttcaatac tatgatggcc ccttgaggcc gcctgagcga gtggatattg acccattttg    369120
     tcttttgaca gttgttttgc gcctcggtcg aggagtgcgc gaactagagc aaaatggcct    369180
     tcgcgtgctg ctagggcaag aggggttaag ccatcagcgt ctcgataatt tatatcgacg    369240
     cctaagtcaa ggaggtgctc cacgatattg aggtgccctt gcgctgccgc ataggatata    369300
     ggatgctcct tcatattttc ttcccagata aattctctta gacgtgttgc aggtttttgg    369360
     accgagcagg caaagtatgg agagtcccat aggacgtttg cgccggcgtg aagaagccgc    369420
     tgaagggtat tatcagatcc agaagaagcc gcccagtaca gcgcggatgc gtcgtggtgc    369480
     tgtacattaa gccggtacag gtagtcgttg agtgtcttaa agagataaga gtggcatcga    369540
     agaagcgcat tcaagtcacg agattctaaa gattccgcga tgctcataag aagttccgag    369600
     ggtagtttga ggatagacat ggtggatgtc aaggagaaga agtgatagaa agaatcatat    369660
     caaaatgtga ctcaaggacc taaggacatc aaataccaat tggaccccac tgtctgaggt    369720
     attcccctgt attttatttc ctcggtgtcg ctgtactgta cgttacggat ctggaaatcg    369780
     tgacgatctc cactaatgag cacggaccca ttacaatacc tgccaatacc tgggtacctt    369840
     tagggagctc gaacacatgt accatgattc tcagtattgt aacggtactt tacgaagata    369900
     tgtattggtt cacctgaaca caacatttga acctcctttg ctctttcact cttaatctag    369960
     ccgactgcac aattcggttt attttttggc aatataacct gacatctgca taactagcaa    370020
     aaatatgtat gaaccaacaa caagagaata gtaaataatt ttgcgaagcg aatacaatgg    370080
     ctcatcggaa gctaatgaaa tgaccaggac gcggtaaatt ggtttaggct cattttcaac    370140
     ccggatgatg ggaattttga gggccacaac aatcgccgca ggaaacagca ctcacgcggg    370200
     catgtgactg ctcacacgat gtacacacat ccatggatgg attgtagtgc ccaacagata    370260
     cgggaagtgt ctgggttctg acggccactt cttcatctgc gattatctgg agattgatca    370320
     cggtagacct gctgtgttgg cgcggcctga aggcaagaat atgtgcgcta actattggcc    370380
     aattacaaac tgccatctgt ctgaggcctt tcaacaaacc atgtctattc atccacattg    370440
     tattctacat ggagatctcg agtgtgcttt ctttcccctt tggatattca gaattgaaca    370500
     ttgcaaacac acctcaagat gtggcagtgg ttaaaggaga aaagacccca tgttttccac    370560
     cgaccgaagt tgcccctatg gtcaactaga cccagaggag cgagatatct tgtcccgagt    370620
     gcaagtcacc gccccaccgg gaaacaacga gaagaatcgc tccaaaaccg aagccatcat    370680
     cgatgaagtc atccagataa tagaggatta ttccaaggaa taccggcaag cgggaataac    370740
     aatcaagtgg tcaacaggag aagacgttga cctccgaaag ctctcacgaa agatactcaa    370800
     cgctgcctta tccttcaaag acatcgttag cacagtggtt gcgtttgatc ccacccatca    370860
     tgccgcaagc gcatgggcgg tcgtctccct tggattgacc gtgggtttcc ctccagctat    370920
     tgggtgtatc atttcgagca aagtggatct gttgcgtcta gaatggaagt gttgtccttc    370980
     ttgaaagcgc gtttccttca ctggttagag gcgaggcaat gagcttacta ggacttgcat    371040
     caaaggctgt tgggatcata aatgctctac agtcaaatct agaggtgagt ctcaccctga    371100
     cctacatgtt agcagcaact aaaatcctac tagagcaata tggatctaga atgtgcgggt    371160
     ttgttacagg atgccaatcg attcattctt aagaatgtcc aagttatcaa caatgctcca    371220
     ctccaagtct actgttcagc acttgtgttc gcccctagga gcagtactat cagaaggctc    371280
     ttcaacagcc aacggtccag ttggatatca gtcctaccac aagtagaaga atcctggggt    371340
     acggagccgc agatcctcaa gggccattct gagctagttt cttcggtggc cttttcacgg    371400
     gatggccaga ggattatctc aggttcttac gataagagta ttaagctctg ggatgcgcag    371460
     acaggcttag ggctgcaaac ccataactat tcttgtccaa tttggtcagt ggccttctca    371520
     ctggacggcc tgaggatcat ctcatgttac tccgatgata ctattaagtt ctgggatgcc    371580
     cagactggct cagagccgca gactgtcgat ggtgattgcg gttgggtcga gtaagtagct    371640
     ttctcgccgg agagaccccc aattccacac aaatctgact ttcagatctc cctggaaaac    371700
     cactgggtca aatttagagg cgaaaaggta ttatggctcc ctcgcgagta tcgtgaatat    371760
     gtctgttctg ccatcacaga tgacaccatc gtctttgggt ataaagacgg acgggttttc    371820
     attgttaagt tttgtgcgcc tttaggttga ttcttgttta gttacgcact gcaaactggc    371880
     cacagttagg ttagaagggt tccaggtata cttgccttat aatccacagg tgtcaacgat    371940
     ctgtactctc aaccgtactg ttgcctaaca ggccttactg cagagtaggt cctgttgagg    372000
     tatcgagcaa tggtgtcagg tagagcgccg aatagatcta tgccgaggta ttggtctatt    372060
     cgagtaaaaa gacaacgccg aggtcattgt tcaggaagtg agaagcaata ctcgcaggca    372120
     catggatcta catatgggtt agatgacctg aaaagaaaat aaagtaagat atttcctgat    372180
     tatccctact tattcaccaa gaatccttcc gcggcatagt agatggtctg gcatggtctc    372240
     ttaattgacc aatgttggat gctaaaggat gcacaattaa atgcgaaaaa cgctcaacta    372300
     atatgtatcc gatcacgcca cataccaatt aagaaacagg caatcttata gtcgtggcaa    372360
     taatcctatg actgtaaaaa tgcgcgcttc catcagctaa aatcgtcacc tagcgagcct    372420
     agttccacat gtaaatgttg tgatacggcc gatcttggca tcaaagtgtg taaaaagatg    372480
     taaaatctga tagcacatac ttgctctatc actcatgtca cgtaagatca taaattccca    372540
     ccccttgaat tgctgaagtg ttgtggcgtt accagcatta ccggagatga agcatctcaa    372600
     ggatgtcatg acgggcaaag aaagaccggt tccacttccc gaagacatct atacccgaaa    372660
     ccaattagct aggtgaagaa agaaggccaa tgctgcacag ctagtgaaac ttacacatgg    372720
     gaacgctcag caggcagata ccgacttgga tgctaccgat gacaatcatg gtatgcttga    372780
     tgcctccgtg ggcaaaccat gtataggcga agaacgtcag gacaaagctg aacatgtttt    372840
     tgaaaaccag catgcaggta aatgcctcga tggccatctc gcctagtact gtcagcaatc    372900
     gcttccacac aagacctggt agtccacata cgatgagcat ctacgatata gagtgaagca    372960
     gcgactgccc ccatcaccat gccggcgatc aagaatgcaa agaagacgtc tggtagcagc    373020
     cagccatagt gcatcacatc gtctgcagtc cacccgaacc cgtaaagtcc gatgccgcag    373080
     aaaacgagtt gggggatcac caagaggatc cggaactcag gctcgtattt gccgtggttg    373140
     agccggatca tcaacttgtt aatagaatca gaaagcagtc cagagagaac aaggcccaca    373200
     atggaaccta tgaaggcccc tgtgtaaaga tatccggttt tgtcttcctc aaaccacatc    373260
     ggaggtccga gaaacacaat tgctagaact acaccgacga ataccgccca tccaattaca    373320
     gcgccttgga tcagacaagc ctggacgttt gtcagtgagt gaaattaagt gcgaagtagg    373380
     ttgcttaccc aaaagattcc gggatggaag aacaacggga atgggcgaag gagcagcttg    373440
     aagaagcttt catctgtctt ccgcccattg aagagcctga gtgattgagc gaaggaatct    373500
     ttctcgggga ctgttgtcgc ggcttcggtc tttgaacttt cgttggggcc tggtctaagc    373560
     tccttcgtat catcgttgga aattccgctg agcgaaacgt gagactccat ggactcgccg    373620
     tgcccgccgc ttcgcttgaa gtcggtgttc aagtaatcgg agcgtcggaa agcagtttcg    373680
     ggcacgaaaa agaacatcag cggcaatgaa gcaccgagaa aaattgccac aaagtagaaa    373740
     gaccactgcc aacccatgga cttggtgatt ttgccgacca caacaggagt caggaaggcg    373800
     gcaccaaaca gagcaacgtt ggatacagcc atccgctttc ctcgttccta tatggtcttt    373860
     atcagtctcc tcatacctta aatctgcagg gaaacgaagt cccaactcac atgaacaaaa    373920
     taaagatctc ccacacaggc attgaccaac gcctcgaacg gcgccaatgc aacaccctgg    373980
     aatatccgtg cccatatgag actattatgg ttcttaccac tgaccccagc ccagatgcag    374040
     ctgataatca tcaagacatg tccgatcagg aacagatgac gtttgcccca gactcgagcc    374100
     gttggcacaa tgagaatgcc tgccacacca acaccgcata ggtgataacc agtcaacagg    374160
     gcggcatctg tgaacgtaat ttcctcgtaa tctgcgatgg tgactgtatt tgcggctagg    374220
     atggagctta gggttgtgca gaggatggtc acgaaggaga ggatggcaag aatgatatcg    374280
     cgtcgccata acggccaatt ctaacaagac cgtttgggtc agcgcttgtg tgcttgtgga    374340
     accaagtctt ggagtccgtt gctctctgga acataccaat gggtcgtttg ggtcatcgct    374400
     cggctgcggg acaaggataa tcggctgctt gcccgacaag tcgcatttta aacctgaggc    374460
     gcctggggtc tgctcgctcg cgtcgctgtc ttgttcgtag atatcggagg tgcctggggg    374520
     tttgaagtcg tgagcaacac tgggtttgac cgcgtctggg caggtaaggc taggggaatc    374580
     ttacctggga catgcgcgag cttcttatct tccagtactc caagacccat gattgcagga    374640
     agctaacgtc gcgacgcttg tagccctgga aaaataatgc aggggtttaa aaaaggaaag    374700
     caaagtgaag aggggtatgg agtacggagt atcaaactaa ctctcgaccc tccaagaagg    374760
     aagctacgtg gaaaagcttg tcggggacca atagggataa atagtagcca tggatagaat    374820
     atatgaagag cttaacattt aggactatat tataggacta aatattagga ctaaccttag    374880
     gaaagataag cagctcggtc gatttgtaca ttaaggcccg agtgtgggcg taacctgcag    374940
     cgtcattgtt ttgaatgtga tggggcaaat tggaaatgct tgtctagtga tacaatatac    375000
     tgcctacatt caaggctcca tttaaggccg tctttaagcc aaccacagac cttttataat    375060
     tcagtactgg gcaggacggg acgagttgaa cgcggggaaa gctgagctac gtacgtaggt    375120
     acggacgagt tgcccaggta agactggatc ggcgcatcca agcttggacc gaggcatcac    375180
     attcgggctt gagcgtccaa tatttggccg aggtgcaggt ggatcactgt aaggaacgaa    375240
     ataaacctga aaagaagtcg ttttgctttt gtagcacact ggctcaaaac cccttcagtg    375300
     tcgagaaaat cagggactgg cccactgtgg aggaaacaaa gccactagtg ctgacccggg    375360
     ggcttgcata tttcccattt gaatgaacct tgcgattggt actgcgtata gagtgtaagc    375420
     cgtacaaccc gaatggtcat agaatagaca gagggtgtga gagtgaacca ttgcaagaaa    375480
     caaggcgatg ggagaggtct gtacttagga tatagttagg aaataaatgc cacagcccaa    375540
     acataaacat ccccaggtaa tgttacaagc gaaataccaa tacattgcga tgtcagcatt    375600
     ggaaacgtcc caatggagat atatcaactg gctctacagc aacggtccct ccaggcccaa    375660
     ccgtagcctt gtttttaaaa gagttctttg ccttccagaa cacataatta cagaagacaa    375720
     ggaacttcca aggttgagat cgagcattac tgctaacacg tgactggtaa gggtcatgtg    375780
     acaggtcatg tgatgatcag cgtcacatca tcaatgggct ccagagctag accccaagtt    375840
     gggaggcgca ttatctccac agcagtgacg acgtgatcgc gttctatatt gaagtcgaat    375900
     cctcgtcctt gaatagctat accccgcatt atttccaaat cccaaccacc gggccgacgc    375960
     tccccccacc taagactact ccgcagcgag cacgcgaagc gcgaagcatt tacgcgaaac    376020
     caatatccac tgcaaacaat tcagcccagt tttaatcatg tcgtcagtct ctccttcgaa    376080
     ggaacacgaa cttgacccag aggcgcaatc gggagaagag caagaccacc tagacaaaga    376140
     tcaccacgac gcgcagggac accaaggcga gtttgaggtg aaggagcagg atcggtggct    376200
     tccgattgcc aatgtggctc gtatcatgaa gcttgccctt ccggacaatg cgaagatcgc    376260
     aaaagaagcc aaggaatgca tgcaggaatg tgtgagcgag tacatctcat ttatcacgag    376320
     tgaagcctcg gagaaatgcc agcaggagaa gcgcaaaaca gtcaacggcg aagacatcct    376380
     attcgccatg acctcgcttg gatttgagaa ttacgctgaa gcactcaaga tctacctatc    376440
     caagtaccgt gaaacccagt ccgcccgcgg cgacaatcag agacccccaa gcgctggcta    376500
     tggagctgga gggcctgttg gtggttcgag tggcgctgga cctggactag ctcgtccaac    376560
     aggcttcccc aatgctgaag gcacaaaccc tatgtcgaac ctcaaccttg acccgtccga    376620
     gcaagacgcc tctgcctacg gctatccgcc catagttggc cagcctcaca acggcgccgg    376680
     cggcgagtcg tactagtgga tgatgtgaaa gggtcgactg aatgaccttg cggttagttt    376740
     ggatattggc tgcatgtcct ggaggtcacc gacgatattg attttaatgg aagtctgaga    376800
     tgtttcagct ggggtcccga cctcagcaat gtcatgacat ggcagtcttg agttcgcata    376860
     catcagccta aaataactcg aagaaacgcc ataattaatg cctaactcaa accctccatc    376920
     tagttaactt tacgatctgc acaagattaa atccctacgt actacgaata accttggaat    376980
     acgcttttaa ttgtcaacaa aatagaactc agtggcgtgt aaatttggaa ccaaaccttc    377040
     cgccgaaggc aatacatcca agtctttatg agatcctatc cgaagatgtt cggtgttgcc    377100
     aatatggttc cggcaagaca cactcaatcc aatgccagtg ggacatcttt gatttctata    377160
     atattcacct gcactggcca gtgtagggag agataggcgt ggggcacccg gggccgtgta    377220
     aaatacccag ttctgatatt taatatccaa tcattgaaaa atacctcgag accgaatttt    377280
     gtggagaacc acatgtaaaa gggtctggaa gttttgcggg gaaaaggtac cgttgatctg    377340
     cgtatttatg tatttttgac ccatctattg gggtattacc acgacctggt gacctagaga    377400
     acaaaacctc tcacatttcc tcccctgccg atagctcact tcatccaaca aacctcatac    377460
     ctgcaattat gaagttcacc attactttcg ccctggcagc tctgctgagc actgccgctg    377520
     ctcaaggtct gggtgatctg cccgactgct cggtatgtgt ctatagtcaa catacaagtc    377580
     tgctaaatgt gccgcctgct aaaacaaccc attgcataga aaacctgtgc tacaggttcg    377640
     atccccgaca actgcggcat tgatttcaag tgcatctgcg aggccaagtc cttcctggac    377700
     gatgtcgcct gctgcatcgc tgataaatgc tccaaggctg accaggaaag tatgttctcc    377760
     cttttccccg ccctccccaa ttgagtatac gaaagcggga ttattccaaa cgactacgtg    377820
     caatggacag cggaacatgt acaatgggct gacacgttat tcttcgccag caaccatcaa    377880
     ggtcgccaag tcaatctgtg cccggggtgg tgtgactgat ctgcccaccg aggttgtctg    377940
     ctcaagcaag tcgggttcca gctctggtac ctccaccagc gatagctcca gctcgaccga    378000
     gactggaaac aagtctagca ctgagacctc gggcgcgact actgtgacgg gcaccaatgc    378060
     ttctgcctcg gcctcgagca gcgcctcgtc cgcctctgct gcggcgacta gcaccggtgt    378120
     tgctgcgctt acccacaagg attcttcgct cgtggccgct gctggtgctg cagctgcatt    378180
     cgccattctg gtctagaatg aagcatgctg ggttatttca ggggagatag tatgtttatc    378240
     agcgttggaa tgtcctcatg acgatggaat gaatggaaac tggaaacacg tgaacccgcc    378300
     tgaggatgca cctgtgtctt attttatcca cgatgtctaa atgccatagc ttttcaatgg    378360
     cgaagggata tttctagtaa tacactcata gaaagacatg acaaggaacc gtgaaagtgt    378420
     tcacatttca cgggtatcct ccagcagctt ggtcaggcgt tcctggcgct cctcacggag    378480
     ggtggagaaa gtctgtagtg gcacattagc tcgagaaaca gacaacaggg tcaatcctgg    378540
     ctgattgata aaattcctac ttacccagaa ccaaaacatc atttcgaaga aagcaaagct    378600
     gaagaccacg cggttcttca ggcgatccag gcctccaata gccgcagcgc ttgtataaga    378660
     cgaggccagg tggtcacctt tgccttggta gataaagaac gcaattgcag catacacggc    378720
     aaagcgacag gcagcaacag cgatccacac actccagtaa atcgtcaaag acttggtgat    378780
     atattcgggc aaactctgta gaacctgcag atcttcggcg gggaggttac catttcgcaa    378840
     aggccggatg taggggagag cttcatcaag ggcttcgtgg aaggggatgt tggagagcag    378900
     gacgaggtca acaagggatt cgatgaagat gagtatggca caaaaggtga agggtgattg    378960
     ttgcgggctt gacagggatg gaaaatcctg taacagaggt gttagcagtc aattagatat    379020
     aggtatattc attgccaata tgatagaaat ggacttgtga atcggggatg tttcgagggc    379080
     atacaatctt caaggcttct cccatcataa acaccagatc ggagtctgtg atcacctccg    379140
     gattcttgac cagataaccg gcgatcacaa ctaggaaaac ggcatgtgcc tggataaggg    379200
     tcttggatga aattaaaacc atgatggacg agtcacaaag gcacgcgttt gtggacgaga    379260
     gggagttctg aaagtcacag acggagatta acttggagac atggtccgag tgttctttgg    379320
     ccgcaacaca tgtgggggga aaagcagtgc cggtcgagat ctccccccac caattcaaca    379380
     actacaatga ttggatctga tttacgactt gatgcatgct gattgaattg cgtgacttac    379440
     tggtgaaaga ttgcccaatt ctcgtcttac tacttagtgg tccaaccccc gatcatcctc    379500
     tgcaatgacc gaccaaaacc cgaccttcaa cacagaacgc catgtcaaat actacctccg    379560
     ttgcttgaaa accttcctac cgtccgccta tacttccaat gactccaatc gcatgctcct    379620
     cggctacctg accctctcag gattggacgt gcttggcgtt ctccagagca aaaccacacc    379680
     ggaagaaaga caagggtaca ttgactggct ctaccactgc caggtgccct caggcggttt    379740
     ccgtggcttc ccaggcacgg actttgggcc aggaaagcga aataaggata atgaagcttg    379800
     ggatccagct aatgtccccg cgacgttctt tgcgctagtc aacttgctca tcctcgggga    379860
     tgacctgtca cgtgtcaagc gacgagagtg tcttgagtgg cttcctaaag tccaacgcgc    379920
     tgatggaagc ttcggtgagc ttgttggtcc tgaggggagt gtagggggac ctcgcgatct    379980
     acgatactgc tgttgtgctg ccggcatacg gtatgtcctg cgcgggcgga gtgagacggg    380040
     gctcgagggt gtaccggata ttgatgtgct gggttttatt tctttcattg aggcgtgcca    380100
     ggtatgtggg gatcgtgagg ttatgtccgc aattgggaca ctaacgcagt ctaacgaatc    380160
     agacatacga cggtggcatg gctgagtctc ctttctgcga atcgcatagt tcgtatctcc    380220
     ctttccgccg catgaacctt ctgacaactg acaggtggac acacgtattg cgcgatcggg    380280
     tctctggact tcttgcgccg gacatgtaat gatctgaaac cggtgcccct actgtcggca    380340
     gggtccaatc aattcgaggc tttgattaca tggctggctt caaggcaaac agcccaacta    380400
     gaagaacccg atgaagatga agatgaggaa cagcgtgaag tgacagatac gggatctatc    380460
     gacaatagag ttcgcgggtt acccaatgtt caacccatcg gggccgacac aatatcatgc    380520
     gccggtttca atggccgatg caataaatat gcagacacat gctattcgtt ctggaacggg    380580
     gctacactaa tggtatgcgc acccatggct ggtggtgatt gtctactaac gcggatgtca    380640
     gatgctggac cagtattccg tggttgacga agttcgtaat cgtcgatact tgctcgaaaa    380700
     gacccaacat cttgtcggtg ggtttgggaa ggggcccggg gatcctcctg gtaaggtgat    380760
     agcatgcgta tatcgagact gcgttgctga ccaatcgtat agatcttctt cattcatact    380820
     ttggcatggt gtctctggct ttccagggtg aggtgggact tagccccgtt gatcccacca    380880
     tgggttcgag tgaacgcaca gtccgacatc ttgaatcgct gccttggtgg caatcatgaa    380940
     gtatataata cccgtgcatg taatatgacg atggatgttc agccattccg ccaattgact    381000
     catgtcagca cgcatcagcc aataggtgca gccgactaaa ttaattgggc gtcggtgtac    381060
     atcgtacatc gtacgttgta catgtcccgt ccacaagcaa gggtcgaatc ctagacagta    381120
     aggaagtaac aacgcatata tatcctgcct acagttcacg attgtggcga tcatggtcag    381180
     tttatggttt cagggctatt gtcgaagtct agcagagcca attaagtgca cttatgtaca    381240
     tccatgccta tataggtaca ccggcttgct gactattatg aacattgtca ggagattcta    381300
     aatagtagca gagtccggag cacataattt atctttaata tagaatgtct gatgtatatt    381360
     gtacacaaag ataataatag aagaccccca agggaagaaa aaaaaaagga gagcccgtcc    381420
     aagtcccgag ttctccacac ggtccacgtt cccgttgacg tcttggaatc ttccaaaggc    381480
     ctttgtatgc aatttccctt ctcctttcac catttgcggt gttactctat tttctccggt    381540
     tatctttccg agccccaagc tacccctatc tgaaacgtct ttcgacctcg cactcccgga    381600
     taccgtttat ccgcgcaaat cgtgtcccgt tgaatggcac ccccggcaca ccaaccattt    381660
     ccagtcaacc ccttgacgcg cagagactct ctcgacgaaa cttggcaatc ataacatatg    381720
     ccgccccgaa ctagagcggg ggttcaaagc cagaaacaga aggagaaggt gcgtcatcag    381780
     ggatgcgaca tagggagctc cgccggtttc ctttgtccga ggcttgcgca gagcccgtgg    381840
     aaatagggct aactcagaat tctcgacagc ttgccaactc ctacaatgaa ctccttgagt    381900
     aagcaatctc cttggtttcc ggctaaatgc caagttgcgc taacattata cttctccgca    381960
     gggagttctc ctccaaggac cttcggaccg taggtaatta cacattgggc aggctgattg    382020
     ggaagggctc cttcggaaag gtctatcttg cctcgcacaa gctcaccaat ggctccaagg    382080
     taagtcatgt catgtgaagg acaaagttgt ggaggcaata ctgatcaatc ggcaggtggt    382140
     gctcaaatcg tccagcaagg aggacaccaa tcttgtgcgc gagatccacc accatcgcca    382200
     attcctccat cctcatatcg cgcggctata cgaagtggtg gtaactgaaa gcctcgtttg    382260
     gcttgtgctg gagtattgtc ctggtacgtt acgcgcatgg cagaaaacgc gtaggggaaa    382320
     catattgaca aaagtcttgt gctaggcgac gaactctaca actaccttct tcgacacggc    382380
     ccacttccgg tagagaaagt taagcggata tttacacaat tggtgggagc ggtcgcctac    382440
     gtccacagta aatcctgtgt gcatcgcgac ttgaaactgg aaaatatatt actggataaa    382500
     caggaaaacg tcaagctatg cgactttggg tttacccgtg aatatgaagg gaaggctagc    382560
     tatcttcaga cattctgtgg gacgatatgc tatagtgcac ccgagatgct caaaggagag    382620
     aagtacgcgg gcgaaaaggt ggatgtatgg agcctgggga tcattctata tgcgctgttg    382680
     gcaggcgagc tgccgtatga cgacgatgat gaccaaatca ccaaaaagcg gatattgtca    382740
     gacgagccga ccttcaacga aaagttcacg gacgatgcca aggctttgat caatctcttg    382800
     ctatccaaac ggcctttgat tcgacccagt ctagacgaga tcctggctca tccatttctt    382860
     gcggagcatg ctcctgaaca actcgcaatc ctgaagatcc caagaccgtc gccgtttact    382920
     acgccactgg agaagactac gttgcaacgt atgaaaagcg ctggggtcaa tattgacgag    382980
     gtcattgaaa atgtcttagc tcagcggtgc gacccactgg ctggctggtg ggccctgctg    383040
     attgagaaag agcaacggaa ggaaagaaag agagagcgca agcgtcgtga gcgggaggcc    383100
     gaagcaaaaa atcttcgtcg tctgagcgcc gcgagcagtc gtctagagaa gcgatcatcg    383160
     gctttgatgg aggtggagga agaaggctca gggttgcggg atcgtgggag acgggataga    383220
     cgaagcttac catctcagtt ggcagtgcca gatcttcctg cacttcctga accgcttcct    383280
     gtattcccaa ttgaggccac cacgccacca ttgccgctcg acaaagattc tatacggtcc    383340
     cacaactcga cactacgccg gccagttcca ccgccaaaag acaggcggcg atcacgaccc    383400
     agcatgctcc atgtgagcgc atcacaaccg gagttgacgc agcatcacgg catcttccgg    383460
     cgtcgcacta gtcgtcgtca ccagtatccg atactcagcc aactagcatc tctcaagcat    383520
     tggtttgtag agtcggcgaa gagagcgcgg tctccccatg ccaaatcgac gaactctcgc    383580
     aagttccttt ccgaaaagtt gagcccggcc aagggtcaag ataccgggaa gaaacccgcg    383640
     gcgtcgtcgt ccccagcagg tcgggtcgca ggggaggagg ttgtgacacc cacccaagtc    383700
     aaacgaatct ccactgctag cagtctcgct cctagcagtg cctcataccg ccaaaaccgc    383760
     cattcttacc ctcggcagcc gcggccattg aacaccagcc ataatagtca tcggaactct    383820
     ctctcgccct cacctatcac accgcggggg tcctatcggc gttcatcggc cggtctacga    383880
     ggacggaagt ccacatcctc ctcggtatca tcgatccgca gcattcatca cgctcgtgct    383940
     cactccaagg cctcttcgat ttcgtccaac agtatggata ctatctcgac gcccactgcc    384000
     agagcctcca aatcgcctca ttcatccgtc aaagtcctgc caaccacccc gggtgcctcg    384060
     tcccgcttcc cgagcaatat tcggttggta agagggccag gcggagcacc tcgagagatt    384120
     ggcgaccact cagatccgat gtcgtcctcg ttcaatgagg cggtgccaac accattgctg    384180
     tactcgccct cttcaagcct ggtctttgca agacggaaaa gatctctctt taagggtcct    384240
     atgattcata ccagtaacct gccggggtct ggtgggctag ccaactcccc cattcccggc    384300
     cagccggtga ataccagcgg tcccgatgtc gcgacagggc ggcctgctgc acgcaagagc    384360
     caaattatcg aggaagagga agacatcgaa ggcattgagg aagaaactga agaagtcgat    384420
     gagttcgacg agcctggtac gcctgctggt ttagttgccc ccagtgagca cccagcagac    384480
     gagaacgggt ctccctcaag ccccagaacg ccattcgctc ctattcctgc ccttgaaacc    384540
     agtccccttc ggccccctcg ctcctcctct ttgcgctcgc cgactgatgc cgcagacaaa    384600
     atcggcatcg ccgaataata ccggtacacc aacccgacag cttccttgca atttcccatg    384660
     tgcattagat tcgggtgttc cttgttccat cccacgatcc cttattccta tgtttggtta    384720
     gatgatagag cttttatacc cccacttaca cagcgtgttt cgttttcatt tcctttgact    384780
     gccttttttt tttttttttt tttttttggc ataattggat ccatcattgg acctatgtct    384840
     ctcgctccct tgcacccttt tccttcacat tttcctacct tcgtgaagcg ccccctctac    384900
     cctacatttc cttgaaccct tatgatgatt cgaccctcgc ttgattttga tgtcttttac    384960
     ttagcattcc cctgtttcat atagaacttt gtctcatatt atctcgctgg atttatcagc    385020
     aacacaatac ttgcataatg aaattgcata gaccactgcc aacttcgata tccccgaaca    385080
     tgtatatttt ggtccaacgt tgaaagattt cctgtcagcc acccgcttga cgaacatcgt    385140
     tccttgtagg tcgacaaaaa tccatggcgc aagtcgcagt ctctcatctg tgccatgcgc    385200
     cgcgctgccc tggtgatatg ccagggatat aagtatggta ttggtggagc tgcacatacc    385260
     taaatggtgt ggtcttaggc aggagtagga ctcgtgcttt caggatgtga tgtgatctac    385320
     gtaggaggct tcaaggttgt ccgatatcat gtccgagaat gtttgcatct cttgcttagt    385380
     ataagtatca tcatatccct gtatatagca aacgcagtga tgtttgaata gtgcgttcct    385440
     cttgctttga gtgcccattt cgaggccagc cttcaaagca ggcatagcca cttcattcga    385500
     ctttaccctc ggaacatcct cagtctctgt tcagacacct tttcccgccc ttccgtccga    385560
     ggcgaatgcg acaactgcgc ggcaagggac ccttcacggg tgttgctttt ccgacgatac    385620
     ccaaaatcga gacgagcacg agatggcaaa tgcgtgttga ctggagttgt caacgacctc    385680
     acgagtgagg atcagtccgt tgtatatgcc gatacatgca tgtatatatt tctctacacg    385740
     gcttttgaga caggccccaa tgtgctgctt tcaaggtttg acgcccataa atgagctggc    385800
     attcgcagat aatgccagta ctatcatcct cctcagcaat ggcagtgacg gtgcaaaaag    385860
     taatatagtc cctatataca gaatacgccc aagcaaataa accaaaatca aaatcccaac    385920
     acccattagc cattagccat taccccaaag gagatataaa gcagagaaat gataatctat    385980
     ctaccgttcc acatggacag cttcatgctt ctcgcccaca ctctcatcaa taccatgaga    386040
     gcccataaca gcctcctcat ccttagtacg ctgaccctca agaccaacct cactctcacc    386100
     gatcttatcc acggtgttcg tatacgccgg aacgaagttc acggcaatag cataagtcca    386160
     agcgacgacc ataaactgca actagaatta gccagggact caaggaaaac ggaagcagat    386220
     aaagaataaa aagggaagga aaatgaactc gatccaagta gaacatacca tagtcggaac    386280
     aataaacgca aaccccgtat tatcacgcat atcagcgaca tgaccgagaa taggcggcac    386340
     aacagcccct ccacaaacac caccaacaat aaacccagag ccacgcttat aatggcgtcc    386400
     aaggccacga atacccagcg ccatgatcgt cgggaagcaa acagactcaa agaaaagcgt    386460
     catgaacaac ataacaacac caacctgcct cgtctgcgtc accgacgcag caaggaaagc    386520
     caccgtacac gacaaataca ccaggaagac ccagcgcgca cgcacgaact tcataatccc    386580
     cgagccgagg aatcggccga ccgcgaacgc gccctgcgcg ccggcgagat acttcgccga    386640
     tgtggcatcc ggcgtaccgg gccaggtatc cttgacatag ttgatgaagt agccggcgat    386700
     agcgactgaa cgagttagct tggcagaacg aaggataaaa tgaagcgggg atatgaaaca    386760
     caccctgcgc ccctgtatac gtgaactgcg ccagtgtggc atggaacagc ttgtactgtt    386820
     tccagaacgg cttatcctgt tcatcgacgt gtgtctgcgc gacctggaag gccatatcct    386880
     cgtctgtgac ttcggggata ttggagagga agaagacgcc cgcgagcagg aagacaaata    386940
     cgccgatggc gaggtagacc cactgcacgc gctgtagggc ggctacgtcg tcttctgtct    387000
     cggtgaaaaa gacatacgag cccaggactg ggccgacgac ggtgccgatg gcgttgaagg    387060
     cctgggcgaa gttgattctg atttcggagt agcggggtgg accgcagact ggacagatgc    387120
     aaggagaggt caatatctat gtgtgacctc gtgtggaatg tgtggttgtc ttaccggtta    387180
     ggtaggggtt agctgctgtc tcgagagaac ccagtccgga tccaatgacg aatgtggcac    387240
     cgcagaagcc gccgaaggat tggtttagtc ctgcgggcca catgcatagg gcgccaatgc    387300
     cgtataggca caaaccgaag ataaagacgg tcttgtagcc gaagttgcgg aggatccagt    387360
     ttgcgtagcc tagggaggct agggggtatg cgctgggttt tgttagagcg gggacttctt    387420
     ttccttctca atatgtgtat catggagaga tttcgtaccc gaagtaggct gcttgaagac    387480
     cagctgaacg acctcggtcg atatgtaggg ttttctggaa atgggagttg agggtgtcca    387540
     gtaaaccata cgcaaagccc taattgaagt cttagtagga ggactctctc tgtggaccaa    387600
     atacagcaac atacccatag aaagaacaag gtcgttacta gagtcaaggg ccacaggctc    387660
     tgtcgtagag tcagagtagc ggccgaagta gtcgcgcgat tatcaacacg caagcccgaa    387720
     cggcttttga ggaattcctt gacgcccatt cttaagatat agaagagact atagaaaaag    387780
     aaataaaaag agccgaaggg ctaggaccaa agggggtatt taaaagaaaa acaaacggtg    387840
     acactctagt aatttctgtt caatttctcc gcaaaactcc acactttttc cccagtccgg    387900
     ggaaagcccc cagacgatcc ctggggaacc caaccacgtc caatcacgtc caatcaaaac    387960
     tgccaactcg gagttgcacc gaggatcaaa gggtaacttt gatcgaattc gctgtggtct    388020
     gatcgaaatc cccgctctaa accctggggt ggcgtcagcg ttgcatggat tgtttcaacg    388080
     ctattcatct ttgggctacg cgggatgcca ttccggtcgt attacgggtt attctctccc    388140
     gtgtctggtg gaatgctact ccgaagtata ttggagacca tattacccta aacaggaaga    388200
     tgggcatcct acctagggac tatcccgcgt catcgcgcct attttggtta cgggaaaggg    388260
     gggtacacgc taatgtgtgg cattatctat gtagtttaat agccgtaaac aagagccgta    388320
     tctactacta gggcaccaat tacaactgga ccgcatcatc catcggtttc attccaaggt    388380
     tggaaaggga tcatggccct ccaagctaga ggtgtaggga aacaggcaag gtccgacttc    388440
     atcgaataaa gcgggttttc tacaaggacg caagtacaca tcgtcatact gtcccacaag    388500
     tgcaaccatc acaggttgta acctttcatt cagagtgatc tatgggcatc catgatagca    388560
     tgtcataact agttcgcgca atctcgtatt caacgctgac aaatatccag ccaaatcagg    388620
     cacaatctat ctctattaca caccggttag ctcctgctag ggcagacatc tgggaagttt    388680
     gggccatatt taggctttcg ccaatatagc cctatccttt atgcccgctt gggcttaccg    388740
     gcggtgccgt tctgggcgac cgggttgacg gctttcgtgt tgtagagacg acgctcaacc    388800
     aacttgagga actcgtcgat caatctaagg ggcgtggatt agtaggatat tctatcagta    388860
     ttaaccagga acaggcactt acaccacagg cgcactgatc accaacactg cctgccattc    388920
     attccagtcc attggcagaa tcgagaacag gctctggagg aaaggaatgt agaggatggc    388980
     aaagtgaagg agcatggaca gagtgatggc atagataagc atggggttgt tgcccaggaa    389040
     gaaagtcagg agggactcgc tggaggacag cgcgttcatg gcgttgagca tctcgatcac    389100
     cacgaggatg gaaagagaca cggtggaggc agacttgctc atgtcgttgc tgaacatttc    389160
     gcagccgatc tcggggaact gggcgctgca cttgtggtag tgggactgaa ttggatatgt    389220
     tagcaacaca tagttaatac gcgggaatat cataggacgt accaattgcc agaaagaaat    389280
     gccaggtcca tcggggttgt agataaacca ccagacgtaa ccaaagacgg tagcagcacc    389340
     gacgtagatg ccgataacca tgtagcggaa caacaaccag ccgccgacaa gcgcctcgtc    389400
     acgacggcgg ggagggcggt tcatcacatc gtggtcagga ggattaaagg aaagagcagt    389460
     ggcaggcaga ccatcggtga caaggttaac ccacaacagc tgaacgggaa tcagagcctc    389520
     gggcatgcca agggcagcag tcaggaagat agagacgact tctccaatgt tggaagaaat    389580
     caggtaacgg atgaactgtt gagtgttgct gtagatggaa cgaccttcct cgacggcgac    389640
     ggtaatagta gcgaagttgt catcagccaa gaccatatca gaggccatct tggccacatc    389700
     agttccggtg cccattgcca cgccaatatc agccttcttg agggcgggag cgtcattgac    389760
     accgtcaccg gtcatagcga ctacgtggct caaggactgg aggagatcga cgagcttgga    389820
     cttgtgacta ggctcagtgc gcgagaaaag ggaggcggtc tgaacggcct tcagctgttc    389880
     actttcacta agagcgtcga actcacgacc cgtgtagctc ttgccggtga gatcctcgtc    389940
     cgcgccgaac acaccaattg agcgacagat agactcggca gtattgcggt tatcaccggt    390000
     gatgacaata acacggattc cggcggcgtg gcacttcttg atagaattgg caacttcagg    390060
     acgagggggg tccaacattg cgacaagacc aatgagagtc atgttctgct ccagcttggc    390120
     gtagtcctcg gtggtggtgg cgttcttcaa gagggggttc gcagagatat tgtcaacact    390180
     tgcgatagcc atgacgcgga ggccacggtt accatactca acaacttcct cggagagaag    390240
     cttcaagtgg tccttggtca cagaaacgcg agatccgttg gcgccttgaa taacgtgtga    390300
     gcagcggtcg aggatgcttt cgggggcacc cttgaccagc agcttttgct ccttgccctc    390360
     accaacgaga acagacatac tcttgcggtc acgggagaat tcgtaggtgg ccttgagagg    390420
     aagacgggac tcgtagtgag cgctggcggc atgcaatctt tcggatgcag ggaggcggta    390480
     aagcttctgg ttcaaggcga tatcggtgga tccaatcttc tcaaccagag tacgcaaagc    390540
     tccctcagtg ggctcaccga tgctggagaa aactccgctc ttggcgtcgt gggaaaggct    390600
     agcggcgttg caaagggcag tgacctcggc caattgtgcg acggtcgatg aagaaacggc    390660
     caagttctcg acgaccttgc cattctgggt gagctttccc tcgggagtaa aagtagtgcc    390720
     ttcgacgtcg atctcctcga agccagtgcc agagctggtc aggtaaacaa tcttctcaac    390780
     actcatctgg ttagtagtca atgttccggt cttgtcagag caaatcacac tgcagctgcc    390840
     cagggtttcg acggaaggaa gagacctgac aactgcgttc ttttgagcca tcttgcgggt    390900
     acctagagcc aggcaggtgg taatgaccac tgccagaccc tccgggatag ccgccacacc    390960
     aagagagaca gcaattttca gatagtagat agcaccctta gtccagccac cgaacgcggg    391020
     gtcgttgaag ttctcatagt tgataaccca aaccaggaca cagatgatgg taataacctt    391080
     ggctagcatg tcaccgaagt cgttcagctt cttcttcagg ggtgtcggct cggagatctg    391140
     ggaagtgatg ctctcgtgga tatctccgat ggcagtcgag ccaccagtca acacgaccag    391200
     agcggtagcg tggccgttga ccacggtggt accagagaaa agcatgttga gctggtcctg    391260
     cttgacggcc tgcgcatcct taatagcgcg ggtctccttt gcaacactct cgctctcacc    391320
     agtcagaata gcctggtcga cgcggaagct gttgctatga attccgagaa gtcggcagtc    391380
     ggcggggaca cggtcaccga cagcaatttg aatgacgtct ccgggaacca actcctcggc    391440
     cttgaccttt cgcgtcattc catcacggac gaccttggcc tcgttggccg aatattcctg    391500
     cagagccgaa atggcctttt ctgcgctact ttcttgggtc actccgacca cggcattgag    391560
     gatgaggata gtaaggatct gtgaacaaaa catgccttgg tcagcaagat agaacacata    391620
     ggtatccgga tggaatgtag aatatccaga cacttacaac agcggggtcc acgaatgcag    391680
     tccaatcgtc actctcttca aagagagcta gcacaaatga cacggcggcc gagccaagga    391740
     ggataagaac caattggtcc ttgaattgtt ccagaatcag ctcccacatg ggagtcgggg    391800
     gttcttcggc aagagctaag taaacggcag acgtcagtcc tgacaatgtc atcattttgc    391860
     agcggagtgg gtactaaccg ttcggtccat attgttgtct ggattttaag accgcgttct    391920
     gcgacagacc ggtctgctct gatactttga agtgctccag cgactccgct ggagtacgga    391980
     gaaaagcgtt ctccatgatc gcgacaccct caacggcaat aggcaggatc aattgcgata    392040
     gccgtagagg tgaggaagaa tagttggggt aaacaaggca cagaggaatg ggggcgtgtt    392100
     ttaaggtagt gacatgcccg gggtaacaca gagtcggaga aaaggaagca gtccaaagcg    392160
     agggaaaacg cgatataaaa tagaaaaaaa gatcgagagc aagaaatgaa gatcgaccga    392220
     acctccagtg gggggaagtc aacgtgttct catccatttg attccagggg ctgagtaagc    392280
     accggccctg gcactgtggg gcttccagag ccccggggtc tacagggctg agggcgggtc    392340
     accggcaatt ctccgctttg atttctcttt ttcctcttat gttctgtctt ttattgagta    392400
     tgaaagcacg agatatgctt gatattatca ggattctacc tactaccttt ggcatagtca    392460
     gtctcttact ataccatcct ctcttttttc caaggttgag tgaattggag catgagcttc    392520
     tcgtagggct ccaacgtcat gc