(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_12

ID   PENCW_12; SV 1; linear; genomic DNA; GRV; FUN; 535560 BP.
XX
AC   AM920430_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 18)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c15, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920430.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..535560
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        complement(37..618)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(867..998,1089..1283)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976754"
FT                   /orf_name="Pc15g00020"
FT                   /product="Putative uncharacterized protein Pc15g00020 "
FT                   /protein_id="CAP82888.1"
FT                   /db_xref="UniParc:UPI0001831E8C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6F0"
FT                   /transl_table=1
FT                   /translation="MFRNPREVAPNAVSSAFSQILNPLPVISWGQLTMYHLGVLTGVGT
FT                   AIQKLKDSGFIQAPPNRRPAPEIIESLPDPQAVLNEINQGYERLDRYYTSFQSTFRLAG
FT                   IKSS"
FT   CDS_pept        complement(2730..4265)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234587" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670795"
FT                   /orf_name="Pc15g00030"
FT                   /product="Pc15g00030 protein"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP82889.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831E8D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6F1"
FT                   /transl_table=1
FT                   /translation="MAGLQLNIDWKSNRRAIAYCLVAAIGALCYGYDTIYYTGIQGMPW
FT                   FAKDYGEKNADGSYSLGTSFLSLSASIIYVGELVGAIAAAPINDFFGRRAVFLSASLCI
FT                   VVGAIVQVCSFGSDPVFYVSRVLIGLGVGQFTATCLMYIGEVAPSAIRGPALMCFQFMQ
FT                   SISQLVGACVNQGTQSIASAQSYRIPMCLLVVLPGVMLLCLPFTPESPVWYMYKGKREQ
FT                   AIKALRKINRSSRDYDPSADIQAIDDQVQMEREMAKDATWLSLVTDPIERRKLFYACGA
FT                   MFVQQINGIQFWYTYGVVFAQSIGVADPFTINTIIYVLQIITVGVAVVLGNKIKRRTNL
FT                   LLCSTGIFVSLIAVGGLGTTRSPEGTFGRGIGIGIVVLAYINIIFYNFSIGTLSYSIAS
FT                   EMSVGRNRNKITACAMGVFFLTVWLMVFTSPYMYYTGNLGPMIGFVYGGTTLFLLAYSW
FT                   FCVGETAGRSNAEIERLFQDKVPVRQWATYVIPSDDVAVMKKQGTEDEQIEMA"
FT   CDS_pept        join(complement(5920..6570),complement(5744..5777),
FT                   complement(5411..5550))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944408"
FT                   /orf_name="Pc15g00040"
FT                   /product="Pc15g00040 protein"
FT                   /protein_id="CAP82890.1"
FT                   /db_xref="UniParc:UPI0001831E8E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6F2"
FT                   /transl_table=1
FT                   /translation="MGSRTYPQRLANALTTRRWEYLAVICGILCALFFLIALAISGNIP
FT                   PTAPWWDAKRVHDHYWAHVKGTEASSIFVMVSGALYVVYSAVLARQIRKIPETNPIIAD
FT                   LQLASAAASFCGFMIAAIAMGLLTFRDYGPELTQLLNDIFWMATLLSWPIFLVQMWTVA
FT                   WAIFSDKSSNPVLPRSMGVVNLVTPIVFALGSGVHIHHTGPMAWNGGLVFWPSLTMKTG
FT                   NWCGRGVMEDWTNNVRYLFSMAKSLKNVEIMVMSNHLFLPSLNNFNSPNYAE"
FT   CDS_pept        join(7542..7960,8005..8206,8379..9124,9185..9999)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(12638..12756),complement(12481..12595),
FT                   complement(12135..12281),complement(10144..12072))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111164" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127857"
FT                   /gene_name="arg2"
FT                   /orf_name="Pc15g00060"
FT                   /product="Amino-acid acetyltransferase, mitochondrial "
FT                   /EC_number="2.3.1.1"
FT                   /function="acetyl-CoA:L-glutamate N-acetyltransferase
FT                   activity"
FT                   /function="acetylglutamate kinase activity"
FT                   /biological_process="arginine biosynthetic process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAP82892.1"
FT                   /db_xref="GO:0003991"
FT                   /db_xref="GO:0004042"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006526"
FT                   /db_xref="InterPro:IPR006855"
FT                   /db_xref="InterPro:IPR011190"
FT                   /db_xref="UniParc:UPI0001831145"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6H6F3"
FT                   /transl_table=1
FT                   /translation="MEVPVDFPISWPCCDTLHAVDPLISLYGVSQKRDEECTHILNASY
FT                   QSWYPQAVSYNRGSMDASYYFSFSLPWNLPSYIQYLVRPNDPIAVRPTQVLNVRAQQIA
FT                   EFSGSSESQDRLGHRAKEKLLDREFFLSLLSSASTKREAKSYLARLKASPAKSGQEPTE
FT                   SPKESISASLPSGVNLGSFYGASRAVYDSPVFRQDTTPTPRAQDIPERLHLALIKITTP
FT                   QLLDNSVINGVAKTLSQLVRLGMACCVVVDPGKTDGHAGRQTAIEQANRISAAVDEQPD
FT                   SRSFRLDSALSISERGSGLPTVLSRKVLLSALQDGHVVLVPPIAYTEENPRAVTVSAND
FT                   AALALTKEFAGLSFNPDPDEDPAVTAERIRNLQREVSLDRVIVLDALGGIPAFKGPQSS
FT                   HVFINMEQEFDQIKDELSQVRNSVSSKQGTSEATYSTLESNPFSKFVNRELVLPEKPTA
FT                   PPSPGAEVMEEVLDGHLENLRLAQQALAMLPSASSGIITSPQEVSYSARSPQQAASDLS
FT                   AVGTRRQRNPLIHHLLTDKPLLSSSLPPGRRGAFNGSGSNQFNPVTSHTTFVKRGMPLT
FT                   ILPNPYTKPWRAQMQPRLGLNDPTIDLPRLVTLIEDSFDRKLDVQNYLERVNSRIAGVI
FT                   VAGEYEGGAILTWETPPGVPDDGSEASAARMVPYLDKFAVLKRSQGAGGVADVVFNAMV
FT                   RTCFPNGVCWRSRMDNPVNKWYFERSSGTWKLAGSNWAMFWTTPGLVEDTQRFQDYEAV
FT                   CRSIQPSWADKKNVID"
FT   CDS_pept        join(complement(13769..14161),complement(13259..13711),
FT                   complement(13173..13208))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164049" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944409"
FT                   /orf_name="Pc15g00070"
FT                   /product="Pc15g00070 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP82893.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001831146"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6F4"
FT                   /transl_table=1
FT                   /translation="MSDQSEYLSESMSGQDNGLRPLSNADDLSLGNPNNSDLARIMSRA
FT                   GIQLANGFPVDDEDDDEDEVDEDYAAVDQDDDANDFPYWFRRPPAHNRTKLDELHPFVQ
FT                   LLSASNVEDCVKVEEAFPEQERCSHDKFVYRLTRCPELSLGLFTLPLLAEGETKPRPTL
FT                   VGHIIATRTSEPLVTDRSMRLPANWRNERWSVEDGQAVGHEEGGSTIAIHSLAVDPAHQ
FT                   GKQVGSTLMKSYIHRIREAQIADRIAIIVHDHLIPFYESFGFESHGPSKCQFGGGGWVD
FT                   MILEFGPEPLEE"
FT   CDS_pept        join(15275..15295,15369..15476,15563..15661,15718..17403,
FT                   17478..17519)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164071" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976755"
FT                   /orf_name="Pc15g00080"
FT                   /product="Pc15g00080 protein"
FT                   /function="GTP binding"
FT                   /protein_id="CAP82894.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR010674"
FT                   /db_xref="InterPro:IPR012973"
FT                   /db_xref="UniParc:UPI0001831147"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6F5"
FT                   /transl_table=1
FT                   /translation="MKTTWKDIAPVPTHQEFLDIVLSRTQRQLPTQIRAGFKISRIRFY
FT                   TRKVKYTQETFGEKFQHILDGFPRLQDIHPFKDLMNTLYDADHFRIALGQVSTAKHLIE
FT                   TVSRDYVRLIKYAQSLFQCKQLKRAALGRMATITRRLKDPLVYLEQVRQHLGRLPSIDP
FT                   NTRTLLICGYPNVGKSSFLRNITRADVDVQPYAFTTKSLFVGHFDYKYLRFQAIDTPGI
FT                   LDHPLEEMNTIEMQSITAVAHLRSAILYFMDLSEQCGYSVGDQIKLFHSIKPLFANKIV
FT                   FIVVNKIDVRRPEDLEPEYQEQLQEILKAEDVELLQASCTTTEGVSAVKNAACDKLLAE
FT                   RVSQKLKSGSSAATPGSRLGDVLSRIHVAQPMGGVRETFIPEGVKDLKKYDKNDPNRRR
FT                   LERDIEEENGGAGVYNFDMQRDYTLGNEEWNHDKIPEVWKGKNIYDFVDPDIESKLAAL
FT                   EEEEEKLEADGYYESDESVEDVEDADNRLKADLIREKRVLLRNEAKMRKSLKNRAAIPR
FT                   SAKAKKLSEMTRGLDSAGYDNGAAGSRARAANPPRGRTTIREPTADPDAMDVDDNPHKA
FT                   LARAKSRARSTPATDRRHDGVTTFSNRDKAERMAKLGQKKMNRMARAGEADRHTTASLA
FT                   KHLFSGKRGMGKTDRR"
FT   CDS_pept        join(20807..21020,21080..21195,21256..22617)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944410"
FT                   /orf_name="Pc15g00090"
FT                   /product="Pc15g00090 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP82895.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831148"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6F6"
FT                   /transl_table=1
FT                   /translation="MGVSTFMDKIKPGKAESQFSSQAATPARADSTTAEKDNLTLDDSP
FT                   VKYLTWRSFILGLCVSMGGFIFGYSTGQISGFTTMIDFKQRFAEYNAATGEYAFSNVRN
FT                   GLIVGLLSIGTMIGALVAAPIADRIGRKFSISFWALLHIVGIIVQIATTDKWYQIALGR
FT                   WVAGLGVGALSSVVPMYQSESAPRQVRGAMVSAFQLFVAFGIFISYIVNFGTETLGNAA
FT                   SWRITMGIGFAWPLILGVGTLFLPESPRYAYRHGRTEEARNVMCKLYGVPHNHRVVAQE
FT                   MADMKQKLEEELANGDAPWQEVFTGPRMLHRILLGIALQSLQQLTGANFIFYYGTSIFQ
FT                   GIGLSNSYVTSIILGAVNFGMTLPGLYIVEHYGRRKCLMYGGAWMFVCFMIWASVGHEI
FT                   LNTNPSSHPAGVAMIVFTCFFIVGFATTWGPIVWAICGEMYPFKYRAVCMGVATAANWT
FT                   WNFLISFFTPFISNTIDFRYGYVFAACCFLAILVVFFFVNETQGRTLEEVDTMYVLHVK
FT                   PWKSSSWVPPEGIIDDLHRPSTGGRKEGEAGTGEHQHHDESQEIRE"
FT   CDS_pept        join(complement(23813..23857),complement(22858..23757))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164105" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944411"
FT                   /orf_name="Pc15g00100"
FT                   /product="Pc15g00100 protein"
FT                   /function="coenzyme binding"
FT                   /function="phosphogluconate dehydrogenase (decarboxylating)
FT                   activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /protein_id="CAP82896.1"
FT                   /db_xref="GO:0004616"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831149"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6F7"
FT                   /transl_table=1
FT                   /translation="MAGRVSWIGLGNIGRGMSQNIAQKGPQTGPLLLYNRTTARATAHA
FT                   SELTNAKAVTTLAEAVNESDLIFTCVGDDTALDSIVTAILSDNRISQDLSDKTFIDCST
FT                   VHPDTSRRTEAAFHERGAGFVACPVFGAPNMADAGQLIVVPAGKRASIEKVRPFFDGVV
FT                   SKKTIDLSSGTGADVDVGRASTLKVLGNTFILNTVGVLAEALVAADASGLGVEPLQEWL
FT                   GLFAPGPFANYAQRMVGGDYCTREEPLFAVDLARKDLGHAYGIAKEGGLRMKNVEVMDG
FT                   LLEHVKEVKGVKGDVAAVYGAVRKGAGMEFGNQ"
FT   CDS_pept        join(complement(25010..25199),complement(24755..24882),
FT                   complement(24388..24704),complement(24264..24336))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000188980" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944412"
FT                   /orf_name="Pc15g00110"
FT                   /product="Pc15g00110 protein"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /cellular_component="outer membrane-bounded periplasmic
FT                   space"
FT                   /protein_id="CAP82897.1"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0030288"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000183114A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6F8"
FT                   /transl_table=1
FT                   /translation="MLTLTAVWEPSVPPLVSLNSHLLIAASTVSPYSYYATLYLRRNRK
FT                   ALESHGVEVEYARLRLLDGNKPPWTLPAKAAYSKFDSERACKYFGVPQIQTPEFFPILS
FT                   IMPQRCMTYIKSHFPREQYETTFLSLWEWMFYKNIDISKPEKLAELFQSNGYSDSEVRQ
FT                   ILAAASSPEFKQALTANTQIALDKGAYGAPWFWVRNAEGKEQPFFGSDRFAFMWMYLGL
FT                   PFQDVAIVEKSML"
FT   mat_peptide     join(complement(25010..25106),complement(24755..24882),
FT                   complement(24388..24704),complement(24267..24336))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6F8 "
FT   sig_peptide     complement(25107..25199)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6F8 "
FT   CDS_pept        complement(25458..27296)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944413"
FT                   /orf_name="Pc15g00120"
FT                   /product="Pc15g00120 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP82898.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183114B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6F9"
FT                   /transl_table=1
FT                   /translation="MIVPKGEAMQPSKIPFWRLIFDQKVVTEEVMQFPYKGSGTEDHPY
FT                   AVVWIPADPRNPMNFPPIRKWSITLLVSFVTLAVSLVSSAFSGGMRQIMEDFGAAQEIV
FT                   ILGVSLFVLGFAIGPLIWAPLSEMFGRRHIFTISFMFLTVFNAGAAGAKNIETLIVLRF
FT                   LAGSFGSSPFGNGGGTIADMFPASQRGIAISLFAAAPFLGPTLGPVIGGFLATAAGWRW
FT                   VEGLLAAFSGVLWLCIIFLLPETYAPVLLRRRAEKMSALTGKVYRSQLDIDRGPAPMGK
FT                   TLKTALSRPWVLLFREPIVLLFSIYMAIIYGTLYMLFAAYPIVFQEVRGWSEGVGGLAF
FT                   LGILVGMVMAVMYTFPENFRYAKKCSQTTDRLAPELRLPPSMVGGIALPVGLFWFAWTN
FT                   SPNIHWMASVAAGAPFGFGMVLVFLSVFNYLIDSYTIFSASVLAANSALRSLFGMAFPL
FT                   FTTYMYHNLGIHWASSVPAFLALACVPFPFIFYKYGARIRQRCTYASEADNFMRRLAER
FT                   NQAAHREEPGSEKGEKTNSVTRVSDDADSSDTDTLSTVPSRTIAPYASRASCQSGRSLH
FT                   RVATVTLYEENPYDLDLVNTRQSAISRKRVDEIPNK"
FT   CDS_pept        join(complement(28971..28997),complement(27929..28921))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164072" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670796"
FT                   /orf_name="Pc15g00130"
FT                   /product="Pc15g00130 protein"
FT                   /protein_id="CAP82899.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI000183114C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6G0"
FT                   /transl_table=1
FT                   /translation="MTLNSLPNEIFIQILSDFPTRALLPLMSVNHRFRALVLRILHYRL
FT                   LLSMPLKEYKLLLECFHPSSKLTEPHVFCKYLGTDGLNERHDETGLLYENIDAAHHLGR
FT                   VAGLYSRFRPEVSSDEEDERGTIRSKFAFSPGRMLLLSEVVGFIRADINGGREGQGEDA
FT                   VIREVTLDGYEDFSQLCVVANLVQVKPGTSLLLSASTIEDGFVRLWREWLRDQSGRKEK
FT                   TAEIDWEEDSERMFSDDDILWVDMSKTVGLKMHVRPKAWDPSLPVLIHQDDRNDDAWVG
FT                   YEVILEGESLLLWRSSRVDLIELHIRSTRLLMAVEQSKEEQKIHQTNAMVIGAPIPVS"
FT   CDS_pept        join(29714..29811,29875..30059,30127..30998)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000230490" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944414"
FT                   /orf_name="Pc15g00140"
FT                   /product="Pc15g00140 protein"
FT                   /function="UDP-glucose:hexose-1-phosphate
FT                   uridylyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="galactose metabolic process "
FT                   /protein_id="CAP82900.1"
FT                   /db_xref="GO:0006012"
FT                   /db_xref="GO:0008108"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="UniParc:UPI000183114D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6G1"
FT                   /transl_table=1
FT                   /translation="MENVLDDISHRRYNPLRGSSILVSPHRTKRPWQGAQESPSKTTLP
FT                   NYDPKCYLCPGNERAQGDTNPNYESTFVFVNDYSAVKEEQAAYEPSNQDELESRFLKAE
FT                   PVTGKCYVLTFSSAHNLTLADLAPREIVPVIDAWTEIYTAHLSPTSPLAKKASPTTLQP
FT                   TSTLTSATKPKEQYRYMQIFENKGAAMGCSNPHPHGQVWTTSSMPEEPAAEMDQLTKYR
FT                   RQHGGSHLLEDYAALESRKQERVVFENDAFLVVCPWWATWPFETMIVSRTHKRALVDLS
FT                   EADKMLLAEAIAEITRRYDNLFETHFPYSMGIHQAPLDGTEEEIEASYLHLHFYPPLLR
FT                   SATVRKFLVGYELMAEPQRDITPEQAAAKLRACGGELYRKKIDS"
FT   CDS_pept        join(complement(31618..31680),complement(31201..31545))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000164093" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127858"
FT                   /orf_name="Pc15g00150"
FT                   /product="Pc15g00150 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP82901.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR005352"
FT                   /db_xref="UniParc:UPI000183114E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6G2"
FT                   /transl_table=1
FT                   /translation="MDQYLAYLPQSEGFLPKWLFFVSVVSALNSLQAYTSPKYTSLLYS
FT                   NGTVPATPLSGRVFGTWTFLSAVIRMTAAYNITNSVAYDLGMWTYGIALSHFIGELVFG
FT                   NASLKGRFLNPLIVASGSLAWMLTQREAYLG"
FT   mat_peptide     complement(31204..31509)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6G2 "
FT   sig_peptide     join(complement(31618..31680),complement(31510..31545))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6G2 "
FT   CDS_pept        join(31867..32040,32106..32969)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000039237" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670797"
FT                   /orf_name="Pc15g00160"
FT                   /product="Pc15g00160 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP82902.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000183114F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6G3"
FT                   /transl_table=1
FT                   /translation="MDLSKHIECLSQWPAHIAPGLPTYGALFLLATGGLVIARKVWTFM
FT                   RVLLSLFVLPGKPLRSFGPPGSWAVVTGASDGLGKEFALQLAKSKFNIVLVSRTASKLA
FT                   TLSEDITKQFPQVQTKTLAMDFSRNADADYQALGELVSDIDVSVLVNNVGLSHSIPVPF
FT                   AQTPSAEMADIVTINCTGTLRVTQLVVPGMMQRRRGLILTMGSFGGLLPTPFLATYSGS
FT                   KAFLQHWSTALGGELAPYGIDVELVQAYLITSAMSKIRRASASIPTPRAFVHSVLAKIG
FT                   RSGGSPTYAYSSSPYWSHGIMAWFLTSVSGTMGKFVLGQNKSMHESIRKRALRKAEREN
FT                   AKKST"
FT   CDS_pept        33323..34048
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187629" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127859"
FT                   /orf_name="Pc15g00170"
FT                   /product="Pc15g00170 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP82903.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="UniParc:UPI0001831150"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6G4"
FT                   /transl_table=1
FT                   /translation="MSQSALPVTGTDDASYINSTDNRIHLLLAATGSVATIKIANIISA
FT                   LSPHVHKLSIRVILTTKAKQFLSGQSAEQPTVSSLGSLPGVEAVYDDDAEWGPEPWRRG
FT                   VDILHISLRRWADILVIAPLSANTLAKLANGLSDNLLTSVCRAWDTDGQVDGKRKRIVV
FT                   APAMNTAMWRHPVTGQHIRVLEVEWGVGKDNKGGETGWFEVLQPQSSKVLACGDVGSGA
FT                   MLEWTEIVKVIEDRLGLSD"
FT   tRNA            complement(35162..35244)
FT                   /gene_name="tRNA-His (GTG)"
FT   CDS_pept        join(35931..35935,36018..36762)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076637" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944415"
FT                   /orf_name="Pc15g00180"
FT                   /product="Pc15g00180 protein"
FT                   /protein_id="CAP82904.1"
FT                   /db_xref="InterPro:IPR019240"
FT                   /db_xref="UniParc:UPI0001831151"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6G5"
FT                   /transl_table=1
FT                   /translation="MLLSTRQPGTHTAGFFEKFCFEPRQPSKDLRSYLNILVRPTIFSM
FT                   DGQKRRGGLGRGGSRPSHPRVPPSIAINPGTSVNIILKADQPTGRTVPGRVSELLTRGD
FT                   HPRGVKVRLTDGRVGRVQSLRSGEPTREIDGGAEGAQESAPGIQLRVEGGHLNGRRNRF
FT                   TSRDMRLDGPEEPSAEPLGLDMYIRPAKGKKKSKKTQAGRNEQLEERLEDIGGATQLPG
FT                   SLKCPVCADFEGDEAAVAHHVAGHFGE"
FT   CDS_pept        join(complement(38980..38999),complement(38020..38932))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076638" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976756"
FT                   /orf_name="Pc15g00190"
FT                   /product="Pc15g00190 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP82905.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001831152"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6G6"
FT                   /transl_table=1
FT                   /translation="MDRQENQCPYVVGNTIKLHLKMKDNEVLTDARIIKLFEPFTLSSV
FT                   MVVRIACSDLALEGDMVLKLFDRRFATQLRKDEKLRPWTSDIESDYHQFVLDGGASQFI
FT                   TELNNNGDIAQQGETWNSSQDEAYLYDHLSDLYETEVRVYDTLRDMQGNDIPQLLAYVT
FT                   IPGCSLAEMQPASQYIDVSGILLEYIEGFPLTDIADHTPRECWQSICEEAIQILHRMGD
FT                   HGILNEDVKTRSFIVKKDTRAESGYKVVMIDFALCNFRKDYADNVDWSEAKAIQDEEGA
FT                   VGLIMQDRLECGFVYRRSNRYKKPADYYE"
FT   tRNA            39316..39387
FT                   /gene_name="tRNA-Glu (CTC)"
FT   CDS_pept        complement(39583..41199)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234803" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823572"
FT                   /orf_name="Pc15g00200"
FT                   /product="Pc15g00200 protein"
FT                   /function="aminopeptidase activity"
FT                   /protein_id="CAP82906.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR009090"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012857"
FT                   /db_xref="UniParc:UPI0001831153"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6G7"
FT                   /transl_table=1
FT                   /translation="MEITKEKVQEVLNKTALRCRGPGGAIAVVQDGEIIGQRVWGFADL
FT                   DQRIPMTAQTQMPICSITKQFVCALLIDLERNPTPTLAAKGDVRKQLSDHLTEILSPEL
FT                   TSDGELTIDRLCDMQSGMRDYWAMTTLWGSKPDDEFLIERDCGPLLARTKSFQFQPGTE
FT                   YSYCNVNFHILARVIERATEESLDKLLEERILRPAGMSTAFLCPNTAHHPSPCVGYEGD
FT                   EQHGFTAATNRMEWSGDAGLVASLADMIAYEKYLDRCYADPQSWYHAAIAAPKFKDGTP
FT                   ATYRYGLSHTDIGGVDTIGHGGALRGYRLHRRHAPRQRLSVVIMLNSDSGTFGPNIDIF
FT                   KDLLGLPKPVSASIQAAESWVGAFLDQDTQLSIVITKGARDGEVAISYDGSAEPIKLSV
FT                   PNHGKSDSMVATIDEDLLSIHRVRDNRMLSARRIVPKESILKGTSFQGIYHCAEIESTF
FT                   HCLGQDGMLYGAFDGYLGQGNATPMKYLGDDVWVLTCPRGLDAPAPGDWTIAFSRNDRD
FT                   AIQGCTIGCWLARKIDYVKKA"
FT   CDS_pept        42876..44360
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000179527" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976757"
FT                   /orf_name="Pc15g00210"
FT                   /product="Pc15g00210 protein"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP82907.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001831154"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6G8"
FT                   /transl_table=1
FT                   /translation="MRSAQFLALAMAVATSDAISQGFNYGALKVDGSLKTQADFETEFA
FT                   TAKNLVGTDNAFTSARLYTMIQGGTTNGPIEAIPAAIKEKTTLLLGLWASGGDMSNEIA
FT                   ALTSAINTYGEDFTNLVVGISVGSEDLYRVSETGVKANAGLGVGPTELVDYINQVRSAI
FT                   SGTSLSGAPIGHVDTWNSWTNGSNSAVIEAVDWLGFDGYPYYENTDPNSIDDAKALFDK
FT                   GVEKTKAVAGGKEVWITETGWPVTGPTENLAVANTANAKQYWDEVACPLLGNTNTWWYI
FT                   LEDAGTTAPSFGVTGSSTDTTPLYDLSCKASTSSSSAAASSSTSASGAGVAEKSGFVSS
FT                   ATSASPTGSAGSDASSSDSGASSSGSGSGSTSGSGSGSGSGSASSPAGSSSVRPTSAAV
FT                   TSGVRPSTKPKSKSASASASASGAASSSASGSSATATGGSNSGSGSSASGSGSGSGSSS
FT                   SDSASASPSLPVSSATRVAGSAAGALVAALALAFTF"
FT   sig_peptide     42876..42929
FT                   /db_xref="UniProtKB/TrEMBL:B6H6G8 "
FT   mat_peptide     42930..44357
FT                   /db_xref="UniProtKB/TrEMBL:B6H6G8 "
FT   CDS_pept        complement(45100..46122)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179684" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944416"
FT                   /orf_name="Pc15g00220"
FT                   /product="Pc15g00220 protein"
FT                   /protein_id="CAP82908.1"
FT                   /db_xref="InterPro:IPR022085"
FT                   /db_xref="UniParc:UPI000183122C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6G9"
FT                   /transl_table=1
FT                   /translation="MHDLLRDSLSSAPRDSPCGFAACGPADRVDLEEAARAGNFDLLRS
FT                   VTYNRAWIMGQSYCRSRESIDSCEPYLHSLWYVYYQCAKHVSHESFEQDRWVLDILRTR
FT                   GRGPLTRPAPGGGIDIARTPDGTVWNDLPFLATDMAECWINDCAEMDSKQRLNSASFLA
FT                   KLASTRIVNDRLCQIALVLFRNTFESERPLGGSNEPDDEDRRRTMHVLTIASLLPSACA
FT                   WIREAGHNIKLLSDVSWNDYSNSTIGRGGFTFVQSELGQRAPGGFSPWRWLYWLKRLHQ
FT                   IADEASKADEKLLAEQAAKAIDIMSSHVKERNSQILRVFEAAGDAVTKDKDFMGLKKEW
FT                   "
FT   CDS_pept        complement(47726..49288)
FT                   /pseudo
FT                   /gene_family="HOG000089184" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(50742..51028,51109..51239,51327..51370)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823573"
FT                   /orf_name="Pc15g00240"
FT                   /product="Pc15g00240 protein"
FT                   /protein_id="CAP82910.1"
FT                   /db_xref="UniParc:UPI000183122D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6H0"
FT                   /transl_table=1
FT                   /translation="MQLINHAVYAVTVLATIAAAVPGPIVARGEKFPVSNGDKSVMVET
FT                   EPSAETGNVLMALGEGDVDCKGSAFCEKLGSSCDDAYRKVIPSNTYSTYLSGTCGLFVS
FT                   GDHCEVMGQDLMDAYNDIRNRGHCNHCGRKQIANGWPQSRSFWLSVSRI"
FT   sig_peptide     50742..50801
FT                   /db_xref="UniProtKB/TrEMBL:B6H6H0 "
FT   mat_peptide     join(50802..51028,51109..51239,51327..51367)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6H0 "
FT   CDS_pept        join(51860..52817,52890..53308)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160780" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944417"
FT                   /orf_name="Pc15g00250"
FT                   /product="Pc15g00250 protein"
FT                   /protein_id="CAP82911.1"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniParc:UPI000183122E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6H1"
FT                   /transl_table=1
FT                   /translation="MHRSWNSWCSLRRMIFAVAIGACGVFVYLIWFGMNSDRDNVPLLL
FT                   TQLIPAGHCTCQSSTSFQCADCLTCLASPPPLEPEHLATWSFQYGRDDQNLGLTQNQCQ
FT                   AAFPGLSQDIQRGVEYWKSRGRISREDLRTIPFKDGMARAIISNGDLYVVATRAKGDDH
FT                   RRKILGTLGSIHRALSASSNRTSHPTIEFIFSIEDRVDDVDAVSHPVWVLSRKASEESV
FT                   ILMPDFGYWSWDKSNIGPYGQVVQSIMAAESNLKFADKEQKLVWRGKLSFAPKLRRALL
FT                   DIARGKPWSDVKELDWSKRANFLSMEDHCRYMFIGHVEGRAYSASLKYRQACRSVVVAH
FT                   QLQYIQHHHYLLVSSGPEQNYVEVERDFSDLPKRMDELLKNPDKAERIANNSVKTFRER
FT                   YLTPAAEACYWRALWEGWAEVSANVTRDVERPPVDRGLRYESFVLLDSNDMFKYSFGSE
FT                   "
FT   CDS_pept        join(53667..53806,53862..53896,53959..54714,54779..54885,
FT                   54957..55118,55178..55543)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163961" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823574"
FT                   /orf_name="Pc15g00260"
FT                   /product="Pc15g00260 protein"
FT                   /protein_id="CAP82912.1"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000159304A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6H2"
FT                   /transl_table=1
FT                   /translation="MDRDQQKYDVHSTMEVDGPSNKNKPTAPDEFDESYRTTRMEIWAY
FT                   YAYYIGNNGLSLFNFAPTAFQNLLYQAAPSDGLLDFIGRPRTINSIVLLSNGISFAIQV
FT                   VIFLVIGSFADFGHWRPNILIVLSIIAYAIGFGWLGVHTSDKWHVAIGLYMVGLIAYQT
FT                   TLTFWTAAFPGLARNSLELKEKADAYVAGTITRDEYDYADSMMRSKLANVAFYVQSVAE
FT                   IFILAIIVGIMFGLNVNASESNNNWGLSVLIAFASGVWLLVSIPWFALEKRRPGQDPGT
FT                   RSVLIAGLWQLWYAMKQIWHLKQSLLYLIGYFLLGDSLNTTVTVIATLQNSIVAYNTLE
FT                   LTYLLIAVGIYAFWTIQQRFKLGTKTMFNTIAVGIVLLDGWGMVGIWTDKFGFHNAWEV
FT                   WVYQAFYGLFICPWYSYSQIMISEVTPRGHEFLFFSLFSIIGKTSSFIGPIVSSAIIDA
FT                   SPSGNVSMPFYFLFALSVVSFLILFWGVDLKKSQREQERFLLDKLRRLNASTSSSDEGT
FT                   SAAV"
FT   CDS_pept        join(complement(57226..57285),complement(56105..57163))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116208" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944418"
FT                   /orf_name="Pc15g00270"
FT                   /product="Pc15g00270 protein"
FT                   /function="RNA binding"
FT                   /protein_id="CAP82913.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="UniParc:UPI000183122F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6H3"
FT                   /transl_table=1
FT                   /translation="MPSTHNKEKAWDTDDIDKWKIEEFKPEHNAAGSFAEESSFMTLFP
FT                   KYREQYLKEAWPVITRALEKQGIACTLDLVEGSMTVKTTRKTYDPAAIIKARDLIKLLA
FT                   RSVPVTQAMKILEDGVACDVIKIRNQVRNKERFVKRRQRILGPNGSTLKALELLTSTYI
FT                   LVQGNTVAVMGPFKGLKEVRRIIDDCMANIHPIYHIKELMIKRELAKDPTLAEESWDRF
FT                   LPNFKKRTLSKRHVPFKVTDKTKKTYTPFPPAPEKSKVDLQIESGEYFLSKEAKERVHK
FT                   EEVVERQRLKRDEKMREREKDFVAPEEVTPADLDEKKKKEKKEKKEKKEKKEKSKRKRD
FT                   AEEDVDADEAAERKEKKKKKKSKSKEASSDGE"
FT   CDS_pept        join(complement(60660..60839),complement(60443..60604),
FT                   complement(60323..60388),complement(60015..60134),
FT                   complement(59679..59915),complement(59443..59622))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076639" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944419"
FT                   /orf_name="Pc15g00280"
FT                   /product="Pc15g00280 protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAP82914.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI0001831230"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6H4"
FT                   /transl_table=1
FT                   /translation="MLVLSAAPLDQRQLTLMAARSPDSQTVELDREYLDTVTFQGREYQ
FT                   KYSIEHRTYFGPVDEEEAQRLEDQQQVFQRIFDNRLIFPPIRRLRRVLDCGHGSASWAV
FT                   DVAEQNPDCEVIGVDIAPHMSPDDMPDNLWLQVDDLNRRFTFPANHFDLVHSRLLATGI
FT                   NRSRWPSYLRDIVVLKPGGWVQMVEIYFNVQSDNGSITDEHALRRWSTQYLRALEDRKD
FT                   LRIGSKLRNLMTEAGLVEVDAKMIPLPLSPWSTRRMRNIGRYSCANMQQLLRSFALYPL
FT                   TQRLHMSQDTFNSLVEQAQQEAADPTLKAYFPL"
FT   CDS_pept        join(61551..61554,61649..61836,61974..62129,62243..62374)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823575"
FT                   /orf_name="Pc15g00290"
FT                   /product="Putative uncharacterized protein Pc15g00290 "
FT                   /protein_id="CAP82915.1"
FT                   /db_xref="UniParc:UPI0001831231"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6H5"
FT                   /transl_table=1
FT                   /translation="MVRRLAYNIVPTFLEGPRRPTVWIEYKSGHAAESDWDFYTPVKES
FT                   QISKLNMWGIPRLSSAVKVHFTMRFETRAMQPMYDMRHHTEEEKRRRVEQLAMVERTEK
FT                   KKIRVGIYANPCLDRMAMASSHFAYVRPSLLPYAVLCQVACPVRSHPNGSNSPSN"
FT   CDS_pept        join(complement(64213..64632),complement(63945..64152),
FT                   complement(63685..63893))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944420"
FT                   /orf_name="Pc15g00300"
FT                   /product="Pc15g00300 protein"
FT                   /protein_id="CAP82916.1"
FT                   /db_xref="UniParc:UPI0001831232"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6H6"
FT                   /transl_table=1
FT                   /translation="MPITLTSVLRIPFPHPSTTQDRLTLALSAAALVVSTLILPAAYRD
FT                   YKIFKSYGPGGLPNNALGWVVVRALFQPFGREMFSTDEYARRIAAAEGHGKGDDGFLIL
FT                   SEEQLGSRRGEGRPIVGPHVVPQRQLTQLPDKAVMEKFRTVFTAFGHRNHHLVKFQRSN
FT                   MERHADGLFVADHLPVSGIAQTMRREIAHVHSGNDHSVHVVLAPADCIKVIEAGLGQRH
FT                   AFSGTSAIGILSLGTRPDIPAEYVLIYAPRTEAEVETVMQIVSAGVKFMTGREDVR"
FT   CDS_pept        join(complement(65709..68102),complement(65445..65662),
FT                   complement(65299..65392))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163983" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944421"
FT                   /orf_name="Pc15g00310"
FT                   /product="Pc15g00310 protein"
FT                   /biological_process="microtubule cytoskeleton organization "
FT                   /cellular_component="microtubule organizing center "
FT                   /cellular_component="spindle pole"
FT                   /protein_id="CAP82917.1"
FT                   /db_xref="GO:0000226"
FT                   /db_xref="GO:0000922"
FT                   /db_xref="GO:0005815"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="UniParc:UPI0001831233"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6H7"
FT                   /transl_table=1
FT                   /translation="MSANDRAAYMSAPRPRAVSNRVDSETRGPSPLQVENKDPLRHSTS
FT                   SQKHGASRDQKSMSEKRQERMVVTSREKAVRRNPANPAASRGDWDRTRPRKPVQLDDTN
FT                   PSSRNGDNGAVDCDWSLRRNTMDFADHDLPFTAPWNPQASLIPHSTAPLACRVSVPPLA
FT                   STVPQALHPRPLRELSPDAQEAAILEDLLFVFMGFEGQYIHYASSYDPSIEKDRLTGPV
FT                   FKIAPGLDPTLRDLIQSMLKMATHYSAMEAFVEIQSRAECGAVSHSLCASIRKLLKDYL
FT                   ILIAQLEGQLLNNPTFTLHLLHLHTMPTSQCLSQLYSMGQELLLKNGLLDEDLEESIDD
FT                   FDEDVDNILEQLKEGGDLVPGSMARKKMCKGGNILGLLTGRLASFSGDPITKTLLQTLL
FT                   RDASRPYMAMLNEWLHHGGIKDPHAEFLVKEQKWIKREKLEEDYTDEYWEKRYTIREHE
FT                   VPPQLKSVQDKVLLAGKYLNVVRECGGVDVSKEVKDVPKTLDDPRFLDNVNSAYTYANA
FT                   SLLNLLVTKNSLTTRFRSLKHYFFLDRSDFFSYFLELGASELRKPARAVNEGKLQSLLD
FT                   IVLRQPGSVAALDPFKEDVKVRMNKIGLTKWLMQVVNVSGVNQEGAEAEKQQVSAVHST
FT                   DEDKDILGFDALELDYSVPFPLSLVISRKTVLRYQLIFRHLLSLRHLETLLVTSWADQN
FT                   KTTSWRHKSSDRRLEIWKRRAWNLRAKMLVFVQQLLYFCTAEVIEPNWLGLMDRVNSVD
FT                   ADASEMEENDMKQVNRTVDELMQDHVDFLDTCLKECMLTQAKLLKIHSKLVTCCTMFAS
FT                   WTAASLSRALASADPDLAGGKVPGADARGYDPTRIGKLEDTLKRYEDHFSRHLRILMDS
FT                   LNYFAATESVVLLKLAHSLTSISREESKED"
FT   CDS_pept        join(68443..68467,68524..68536,68603..68681,68826..69169,
FT                   69220..69499)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944422"
FT                   /orf_name="Pc15g00320"
FT                   /product="Pc15g00320 protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="CAP82918.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI0001831234"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6H8"
FT                   /transl_table=1
FT                   /translation="MFIARSEYDRGINTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEG
FT                   VILGVEKRVTSTLLEASSVEKIVEIDQHIGCAMSGLQADARNLVEHARVECQNHAFHYA
FT                   EPLRVESTTQAICDLALRFGESGDDEESVMSRPFGVALLIAGYDEDGPQLYHAEPSGTF
FT                   YRYDAKAIGSGSEGAQAELQNEYHRSLTLAEAETLVLKTLKQVMEEKLDSKNVQLASVT
FT                   KEKGFRIYNDEEMGHAVTQLGGNQ"
FT   CDS_pept        complement(69723..71264)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164004" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976758"
FT                   /orf_name="Pc15g00330"
FT                   /product="Pc15g00330 protein"
FT                   /protein_id="CAP82919.1"
FT                   /db_xref="InterPro:IPR007823"
FT                   /db_xref="UniParc:UPI0001831235"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6H9"
FT                   /transl_table=1
FT                   /translation="MFAVPGWSVENSALKPQTQAAQPKNESQPEKDASNANAKNNKRKR
FT                   ANDRVTAGNVDEMYRRHIEGTAKGGNRGADASVKPEKKKQNTEKKKQTLETATTQGPTS
FT                   ETAAADPEADQAEDKAPKKKKQRKNKKNKENKDNVPENKNEAGGATTTPAKEVPAAAAP
FT                   APVAPVLPPTSNLTPLQQAMRQKLVSSRFRHLNETLYTTPSAKALEMFSTNPELFDEYH
FT                   AGFARQVKESWPSNPVDDYIKTIRTRGAIPLPRRGKPLNPAKGYPLPRRPTGLCTFADL
FT                   GCGDAQLARALTPSAKKLNIKLNSYDLAAPDPLITKADISNLPLEDGAADVAIFCLSLM
FT                   GTNWVSFVEEAWRILRGDGKGECWVSEVKSRFGKVQRKKSQIGAHKPGSKADKKKSKKK
FT                   GGDDSDVDETDIFAEDVRPSDNNDETDISAFVEVFRSRGFMLRQESVDKSNKMFVRMVF
FT                   VKQGGAPTKGKHASALSAPAPGSKKRFVDRKPESESGMSPEQEAQVLKPCVYKIR"
FT   CDS_pept        join(71722..71851,71905..72557,72618..73720,73780..74068,
FT                   74171..74956)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944423"
FT                   /orf_name="Pc15g00340"
FT                   /product="Pc15g00340 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP82920.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831236"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6I0"
FT                   /transl_table=1
FT                   /translation="MADDLKDQLDMPADITVGGSAEASTTRSGPRRLPKKRTKTGCLTC
FT                   RKRRIKCGEEKPICTNCVKSKRICEGYAQRVVFKNPIGIFGSFSSGHGQDPQIEQPHMS
FT                   LPMHNDYGSQLPPQQAAAAAQHPMLAPRPVDPAAMGYRSFPSQTPSSSQIQPINIPPFY
FT                   YPAAQVQPPNHMWHTQPIAQTESTLVPPNGTDLPQAQQSPQFGQTSAPYRHHANVQEVP
FT                   RIASPVGRTAAEHASNVSPVPALNPMPGNRESEINPLPQMTQPLPTIYHYQPPPGQLPQ
FT                   QLRSHDQFIPHQVPHQPQVIYMEDESEDYYDVDSDDETVDQSQAEGFNQLSLIMASANR
FT                   DERQLRSFTTYLNEPNVLASYRPTLGSSPLNNPKTARIFAHFIHSTGPSISIFERHPTD
FT                   SSIVLGATVPPAQQGLWVYTLALKALEHPALLQAILAVSSLHIAYLQQVPTTVSLKHYH
FT                   YALKRVGSAVGLPLRRKQVGTLAATLLLGYYEVISADHSKWNNHLGGSTHLIREIDFAK
FT                   TTRDLRAHRRRAHEKRRQSGWSDSWWGMPDDVSEDDPFSEKEDSVDEGLLGAIIGRAVN
FT                   YDYFGCINEEGTLPSTKHFTRKDIEVFRIQCDLYWWYAKQDALQSFIGGNKLLMPYSQW
FT                   GQCPPRAGIGRLDAIYGSADHLWLLLARVTDFGFRDRKRKLRTLKSGGVDWRPGPEMFK
FT                   FMGRFAGGPPGQGPGPSAGFGPGRPPGFSSGPPMYGMIPPQPPARLPSGFQDRPREPRL
FT                   SPDEDDPDHEMSYKEAEQEWEEILVAMDTFSQALGRDFQPLPADVAPPISTPFGPALQY
FT                   RTHTIAVIWGFYYAMRLLLNRIHPSMPPAIMMAAGVCAPTTAGFAQIIGKILGGVYYPQ
FT                   RFNLEAGSLSPNLGSSLTDMSVPLFFAAVQYNDPTQRTWTTSKLRDISRLTGWKSADAI
FT                   AGGCEKAWIVAAKQGRGPPYQRSFETDRVREREQELEVSISIGSIGYPWPTTSMLM"
FT   CDS_pept        join(75528..76187,76237..76333,76401..76901,76953..76999)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823576"
FT                   /orf_name="Pc15g00350"
FT                   /product="Pc15g00350 protein"
FT                   /protein_id="CAP82921.1"
FT                   /db_xref="UniParc:UPI0001831237"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6I1"
FT                   /transl_table=1
FT                   /translation="MSRYDDYRSSTGTLDSRGRYDRYSRGPPVAERPRHAEERFEARLR
FT                   EEDRYGPPARAPGRLYEDDHLDHPSPAMSLVAHDRRRRRDDSPSFRRPQLIRRQSSLDT
FT                   FDRIPRRKMEHFDARDRPRAPRVPVVAPPRRHLSPGRYREREVYEDIRIAEPDYYGDEE
FT                   FRDVRDRDMVDRRRRSSSTVRRHHEEKPYPRKGKTRVPRHLAHIHAIMDLGYPFKEEDD
FT                   VIVIQKALSKAQIDEVLTLSREFRRPSPVETEYIGLSSSPPMRERPRERVTTEHLRVEA
FT                   SPRTSQAFIVESSPSRHRSRSRHHMDQYEEFVERPRVHGVSRRRAVSVNDRGPHLLSPV
FT                   QYIEERDSDPARTGSMVLVRPRESDHDMSDYIRSLEEETRLLRLERQGGIEITRQRETD
FT                   IIDDKGNQEEVTEIRRQERSEPNSRIMRAMMATLT"
FT   CDS_pept        join(77448..77482,77597..77752,77830..78391,78477..78608,
FT                   78672..78704)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164027" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944424"
FT                   /orf_name="Pc15g00360"
FT                   /product="Pc15g00360 protein"
FT                   /protein_id="CAP82922.1"
FT                   /db_xref="InterPro:IPR018859"
FT                   /db_xref="UniParc:UPI0001831238"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6I2"
FT                   /transl_table=1
FT                   /translation="MDRMQAFGKNFSASFTPFAQRTQQMIKEQLGQAEDKTQLPDEYIK
FT                   LEKRVDALKLVHQKLLQVTSQYSNEAYDYPPNIRESFNDLGRTINEKVQLLSQAGSPAE
FT                   AQAALAAPPSAKPQPKTFNHAIARASLAGSQTLAQSTEGEDPLATALEKYALAEEQVGE
FT                   ARLAQDAQIQSRFLAGWNTTLNTNLMFAAKARKNVENARLMLDSIKASKKAGAHGDLDN
FT                   LSEDARAEIEQAEDEFVGQTEEAVSVMKNVLDTPEPLRNLADLIAAQLEFHKKSYEILS
FT                   ELAPTVDALQVEQEASYRKIREGA"
FT   CDS_pept        join(complement(79560..79708),complement(79110..79353),
FT                   complement(78942..79010))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944425"
FT                   /orf_name="Pc15g00370"
FT                   /product="Putative uncharacterized protein Pc15g00370 "
FT                   /protein_id="CAP82923.1"
FT                   /db_xref="UniParc:UPI0001831239"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6I3"
FT                   /transl_table=1
FT                   /translation="MAPGLDTQRTQSEAWTHVWLSPFGLRNHAAVERATIITRPMTRLQ
FT                   LLNFIKAQPRVEIAWCLTRMLVWAESGRGVGELGWRAQRRQPLLGGISSLDECYRMPGS
FT                   FDGAGGRTSNRLSGAAWHNEGGVDESSYLDAGAPGAGLPEAELAGGGSI"
FT   CDS_pept        join(complement(81839..82027),complement(81724..81777),
FT                   complement(80561..81667))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164038" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127860"
FT                   /orf_name="Pc15g00380"
FT                   /product="Pc15g00380 protein"
FT                   /protein_id="CAP82924.1"
FT                   /db_xref="InterPro:IPR007290"
FT                   /db_xref="UniParc:UPI0001831307"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6I4"
FT                   /transl_table=1
FT                   /translation="MPICIECSYPVSHLYSAYSRADDRSQGKGVRLTQCPRCQRFADKY
FT                   VEYDFVVLFIDLVLIKPQVYRHLLFNRLGRDDNQFDRSIIRLGVLLLLFDVYLTWARIE
FT                   KDPSLATTFLSRAPIIIQYLFFLSLNAAATLAHHLTVRLLASILVPKSRRYSGPDSSSN
FT                   ANTNPSRKSTGDATLLPSGPPTPTTQPSPSGLPVNPHTQNPASHSASLLCPTPTPSSYS
FT                   EVASPTDLSPPPQGTSSMGPPPRPAPPLRRASTAPLQNIQPLPPPTAASPAAISTALLV
FT                   SSCAKLFPILLVIWGADGSGSLSDIPAHSPSAAQIRASTQPAAMSSAVHQSLFATATQT
FT                   SSLISAKAAIPTPPPDLARSSSFLESWLAATAASLRTSTPTSYLTGLFDLLASLLSLGV
FT                   VDTHLVLLSNIEALYILLGCGYLRAVAVAVAGQIVRWAVQRVILGAVGVG"
FT   tRNA            complement(82275..82346)
FT                   /gene_name="tRNA-Glu (CTC)"
FT   CDS_pept        83257..84825
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823577"
FT                   /orf_name="Pc15g00390"
FT                   /product="Pc15g00390 protein"
FT                   /protein_id="CAP82925.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001831308"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6I5"
FT                   /transl_table=1
FT                   /translation="MPICKPYDDVAWAISTQIWKDWPELLRTDEDIYNDIGIILSEEFS
FT                   DLQWELFEFLSTGGFNVCFKMNFTNNFCAVIRFPLPGAVMLPEEKVRNEVSAMQFILEK
FT                   TADQMPIRVPSVFRSVETKESTSDLGPLIIMNYIQHKESMSDLLEAPGREAGENPVLNP
FT                   GLELVRLESLYKELAKISLSLATLSLSRIGSLHKNNNSIWESSCRPLSYSMNEIVQLGT
FT                   LPRSELPTTTYDKASSYFEALAELHLSHLKSQRNEADIEADIDIDVLADTFRRRFVARF
FT                   LFRKLVRNPEQRRQWILHDNGPFPVWCDDFRPENVLIDETEKVIGVVDWEFTYTAPVEF
FT                   TYAPPWWLLLKKPEDWPGGLDEWCAEYEKPLQTFLGAMRKCEDEAIQNKQLLQSQRLSS
FT                   QMRDSWQSGNFWIMYAARHNFAFDAIYWEKIDQRFFGKTEIADDNNRDVWRKRLHLLEH
FT                   GEKKLMEEYVALKLKERSIGRLTWDPDEYTVGWIQRMKEIRWKEMEREEKERVERERME
FT                   ICAES"
FT   CDS_pept        join(86451..86538,86592..87847)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076641" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670798"
FT                   /orf_name="Pc15g00400"
FT                   /product="Pc15g00400 protein"
FT                   /protein_id="CAP82926.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0001831309"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6I6"
FT                   /transl_table=1
FT                   /translation="MQCYTLTSHCVSCEWKIRTDYPWMALYRAIYLTPEGTQLSSISEV
FT                   GSEELEEGDSTPDSDLELGPWWSMANSKPATAFLIHSCCWSLLIRHFANDEVDLDRLFE
FT                   VCRNRSASRTAEGVHDFDSLWSSLQHPLIRPIIRGIGDDTKQLSKIQRLNIGASNSTFL
FT                   GPDCFGRLPIEIRLEIAAYLSTADFLGLRLVSRAMVPVFSLQSFWRTRFRVNGDRGFLN
FT                   CLTDDRGKQKNWRSIYHCTARIEQAYLHVWSVRRQWRNNCWLRDRYSMTQALSGQTEFE
FT                   DNSLDEVAWKEAAAEIRCDRIPKRLWRDGFKCKCRQEEPIPVSHTALLHDLVIGMTVFI
FT                   LHEGTTRGRRSHIIGFDLISADAEIPNITLGHRLPGSQVTIDFYGRHLRGFGIVTGNSG
FT                   IRALRPVFDSGTITSWIGDSEQDEMTMQLILKDDVKAISAKFDVSHFP"
FT   CDS_pept        join(complement(91502..91597),complement(91340..91435),
FT                   complement(90435..91283),complement(90314..90378),
FT                   complement(90151..90262),complement(90056..90094))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000012239" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944426"
FT                   /orf_name="Pc15g00410"
FT                   /product="Pc15g00410 protein"
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /protein_id="CAP82927.1"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniParc:UPI000183130A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6I7"
FT                   /transl_table=1
FT                   /translation="MSSPQQRLNSVANQLAPGSARQKILAKNPDDVVITYLARTPLTKA
FT                   RKGGLKDTTVDDLLISLLTTVREKSNLDPNLVEDVCVGNVLCPGSAYVARSAVLAAGYP
FT                   VTAAASIANRFCSSGLLAVQNIANQIIAGSIDVGVAVGAESMSKNADGGAPEMSERITK
FT                   HPIASQNSQPMGQTSENVANQFNISREQHDRFAANSFQKAERAQKAGWLEDEIVPVRTQ
FT                   IKDPKTGEVKDIVVVRDDGIRYGTTPESLGKVRAAFPQWAPSATTGGNASQITDGAAAL
FT                   VLMKRSRAQQLGQPIVAKFCGATVSGLEPRIMGIGPSLAIPKILSKFNLSKDDIDIFEI
FT                   NEAFSSMGVYCVNKLGLDESKVNPRGGAIAFGHPLGATGARQVVTALSELRRQDKRVAV
FT                   TSMCVGTGMGMAGIFVSEH"
FT   CDS_pept        join(92358..92643,92716..92871,92928..94074,94141..94284,
FT                   94344..94515)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000044189" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944427"
FT                   /orf_name="Pc15g00420"
FT                   /product="Pc15g00420 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP82928.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000183130B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6I8"
FT                   /transl_table=1
FT                   /translation="MDILSEVGAPAVAMASALSVAAGAYLNAKLAIATDLRTIHSDKAA
FT                   AKRLSERIAKLDGSTTIYKMLERAVEVEGRATTDALWFEQKTWSYGQLKDLVDRMAALL
FT                   KSRDINPGDTVGVFTTNSPEMVMTVYALSKLGAVAAMINTNLRDDTFTHCVNVSGSKLI
FT                   ISTADLCQHVCVDLPHFTLSLGSFEGAEAGAIEPITSGTLQQFSPLGLAAAKRSPKDLS
FT                   LLIYTSGTTGKPKACAIRNMLTLITSNPHSADVSNHSKYHPFRVYSPLPLFHGTAFFTG
FT                   LCAAIGNGGTLCLGRKFSASKFWKEVHDSGATRILYIGELCRYLLATPPSPYDQDHKCI
FT                   VASGNGLRGEIWEKFRERFNVPEIREFYRSTEGVAKFDNHGVGAWGAGKVGFSGPIRRF
FT                   LEDDTFIVKYDTNTEMPYRDPATGFCVRAALGQEGEAIGRVRDRGMLIEYLGNEGATEE
FT                   KLLRDVFQKGDLFQRTGDLVVQDESGWVRFQDRVGDTFRWKGENVSAGEIRDHICRIEG
FT                   VHDAVVYGVKLSGYDGQAGAAGITLESPEVETELMSTLCKALKKKGVPSYALPRLVRLT
FT                   EKVATGVTFKQAKGDLAKKGWNPRQDSGGDILYWLNGTKYQKLEEQSWAEIESGKAKI"
FT   sig_peptide     92358..92426
FT                   /db_xref="UniProtKB/TrEMBL:B6H6I8 "
FT   mat_peptide     join(92427..92643,92716..92871,92928..94074,94141..94284,
FT                   94344..94512)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6I8 "
FT   CDS_pept        join(95184..95401,95471..95687,95758..95847)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163950" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944428"
FT                   /orf_name="Pc15g00430"
FT                   /product="Pc15g00430 protein"
FT                   /protein_id="CAP82929.1"
FT                   /db_xref="InterPro:IPR003172"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI000183130C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6I9"
FT                   /transl_table=1
FT                   /translation="MKFLSAASLLVLTAPLANAAALSIFDPTQASLKANDNEKYPVKGE
FT                   NPLQYCAKPDNYKLEIESVDLAPNPPLPGQTLTISAKGTLLERIEKGATVNLEVKWGLI
FT                   TLIKQTVDLCDELKNVDLECPLEKGEMVLTKEVDLPKQIPPGKYSVLADVYNKEQNQVT
FT                   CLKADDIVFHF"
FT   sig_peptide     95184..95240
FT                   /db_xref="UniProtKB/TrEMBL:B6H6I9 "
FT   mat_peptide     join(95241..95401,95471..95687,95758..95844)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6I9 "
FT   CDS_pept        join(complement(96992..97057),complement(96881..96913),
FT                   complement(96657..96794),complement(96428..96568))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000056545" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944429"
FT                   /orf_name="Pc15g00440"
FT                   /product="Pc15g00440 protein"
FT                   /EC_number="3.6.3.6"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="hydrogen-exporting ATPase activity,
FT                   phosphorylative mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting V-type ATPase, V1
FT                   domain"
FT                   /protein_id="CAP82930.1"
FT                   /db_xref="GO:0008553"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0033180"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="InterPro:IPR005772"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="UniParc:UPI000183130D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6J0"
FT                   /transl_table=1
FT                   /translation="MTPPIANSVPQERQFLAVIGDESVTGLLLAGVGHVTEPPDSQRNF
FT                   LVVDSKTETSEIERAFQNFTQERKDIAVLLINQHIAERIRHSVDAFADPFPAVLEIPSK
FT                   DHPYDPEKDSVLKRVRRLFGE"
FT   CDS_pept        join(97425..97682,97777..98883)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163938" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944430"
FT                   /orf_name="Pc15g00450"
FT                   /product="Pc15g00450 protein"
FT                   /protein_id="CAP82931.1"
FT                   /db_xref="InterPro:IPR018819"
FT                   /db_xref="UniParc:UPI000183130E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6J1"
FT                   /transl_table=1
FT                   /translation="MPRLVRRRPLSERIRSHLNPYDFLLWLSEEFEGGDWDQLEKNWTL
FT                   PIGIALNVIFLIARANSRSGGSKAFDDVFGDDDGTSLLGWLASFIVHLMAVASTANAIY
FT                   TFQKTRHYRLFENSIDNNPATPSAHRVRVDSSPMMPSPLRYIAKALSTESAHSRAHPDA
FT                   QRDVWELAIWDPSPLCLRLFCLFSPGHVLVYWLFLPTQLSDPRPSVTIVTTIVLTALLS
FT                   VQMSFISSSYTQQAKDQKVVHKEVFKEYDTKYVQPRTHPLMRDVGTQFSDPYGEPPKTE
FT                   DECNRVETYSPAHIINRGFKTSPNPNYLKHVDPEGFTPVRQPTASTPISSMFQGPPTNT
FT                   PSMSRDGSPMARGTSRTTMRQPQFRSTATTTGDGGSLGIYSHANSPLRKSATTSFDRRL
FT                   QSNGDFVYKERGTTPLMRSSSPLKRSSVPGGMNPGDPATINRSDNISNRREAGRF"
FT   CDS_pept        join(100854..101019,101052..101186,101247..101356,
FT                   101409..101579)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944431"
FT                   /orf_name="Pc15g00460"
FT                   /product="Pc15g00460 protein"
FT                   /protein_id="CAP82932.1"
FT                   /db_xref="UniParc:UPI000183130F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6J2"
FT                   /transl_table=1
FT                   /translation="MIEITNKYLRLSTQNEAATRCIINDILFALLDTVVPYPNNGQWPL
FT                   NLQMETSLTSPKGTCDYTLWYGDKGGADKAINLVLVEAKKLGLASQGDDQALGYMACVH
FT                   QERRTQPSQNSTVYGLSTDGEEFRFLRINERSEFTKVIMTKTPGGNYSRITSMIAFIMR
FT                   EAVSQSSYTSRNTSKDVSMEDDPVTLPPDV"
FT   CDS_pept        102344..105535
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944432"
FT                   /orf_name="Pc15g00470"
FT                   /product="Pc15g00470 protein"
FT                   /protein_id="CAP82933.1"
FT                   /db_xref="UniParc:UPI0001831310"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6J3"
FT                   /transl_table=1
FT                   /translation="MDEAPVKLPDGHLVNLSPRPIRQSAYKAYRAEYKSSTEASATPPP
FT                   RYRQEGTSPEYAVSGGASGNISQLPKATKLPVPRSLAESRKDDSNQTTSPTALPKLFPA
FT                   SHSSGRLGDQSGPLDKGHDQYWRKIRDKLQESPLSTRRVKSKESDNNQSPNSRISYHRS
FT                   RPPASTSQDRASPRAGTPRSGIPSPSTVKSSPAQGSRNDASTRPVDSQSKWRKKDDQWV
FT                   LMDVTETASLKSSRTDATTDSSARSHPSVSPVSAENSSITDWEDRFVVNMPTAKDPNPP
FT                   MMTAQQIAEYQRSIERVHRDGGQMADPDTVPSRNVSPEIRFNPSEQKAQSPRAINTYDG
FT                   VYEGPQAPTLSRDEHCPSPQPQQNAQPEQVSQPHLQQPQPQSTTAPQRQIANRYYSPDE
FT                   IGCNRISTIWEESPTKPKEKRSLQNADGSFLGCREISGEKNPDEILRFASSDDASLHPP
FT                   PLALGSKNKQKVLKEVKKATDRQPAHRDEGTTVLREELPQTSQNTRPAQCSKPSVMCQD
FT                   QSCSQNPSPIPRTRSQDSSKENYHPTSNTPQRSGSQEENLGDDDVFIITPTITRTMIPT
FT                   PDNKASSPKPQGLRRPGGTNHTVTAEAIKAVRAKAQMISTPSGLRPGEPTVDTRPTGRT
FT                   LTTSQTLPVSSVSTRTTKDEDEEDRNQDHAQDRCSERAAGTTSNTIRGFIRTSGLAKPS
FT                   GLVRSPTDSLAAILRNRTESLRTRAESLRHASGSPQRSDQKQSPSPPPILPSRDNSESS
FT                   RSERSFRSTNGTSPVPANRSPSPPKVATPEKKPEENKQPSSRPPAPSKPTTKRVTLSEE
FT                   PPSSAKPDKPRLSTKKISALAKPSTLEKICKSTSTTPPAPEKSSPPKAKTPDASPKKAE
FT                   QAKALPRLHTSGKVLEIAELDGLQVASPKESLQSNITDVSADLGDMHSEDKDGSDGQGL
FT                   HPLAFSLLFNILVVAVTQVNKALRMGTDSPYVKFVVNNTLNMTCHCWHVSKCIYITVSH
FT                   YQATGAWPKPRRDQAITRFVVELLQAIVYLLILGFAAMLMARTVGYVVLVSSWIAWFAR
FT                   PFAWVFQCVGRALIM"
FT   CDS_pept        join(complement(107812..108635),complement(106751..107759))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246234" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944433"
FT                   /orf_name="Pc15g00480"
FT                   /product="Pc15g00480 protein"
FT                   /function="methylenetetrahydrofolate reductase (NADPH)
FT                   activity"
FT                   /biological_process="methionine metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP82934.1"
FT                   /db_xref="GO:0004489"
FT                   /db_xref="GO:0006555"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="UniParc:UPI0001831311"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6J4"
FT                   /transl_table=1
FT                   /translation="MHIREKLAKNEAEGKTGISFEFFPPKTAQGVQNLYDRMDRMHGLG
FT                   PSFIDITWGAGGRLSDLTCEMVSVAQSVYGLETCMHLTCTDMPVEKVDQALQAAYKAGC
FT                   TNILALRGDPPREKEAWEAAENGFCYAKDLVKYIREKYGNHFDIGVGGYPEGADDNTDV
FT                   DQLIDHLKEKVDAGSSFVVTQMFYDAENFIEWVKKCRAKGINVPIIPGIMPIQTYASFI
FT                   RRSNWTKVKVPSEWMEALEPVKNDDSAVRDIGKTLIANMCRQLIAAGIKHLHFYTMNLA
FT                   QATQLVLKELELTPSEDSPIQRPLPWRPSLGLGRRSEDVRPVFWRNRNSSYVARTQTWD
FT                   EYPNGRWTDSRSPAFGELDAYGVGLKGTNEQNIKLWGEPKSIKDISDIFVNFLTGKLDR
FT                   LPWSDSPITTEAHEIQEDLLKLNQRGFLTINSQPAVNGVKSSHPVYGWGPKNGFVYQKA
FT                   YLELLVPSNLIDELITRIEKNDDLTYHATNKKGELKTNTRDSPNALTWGIFAGREIIQP
FT                   TIVETVSFLAWKDEAYLLGEHWSKCHDAASPSRQLIQHVMEDWYLVNIVDNDFHRSNAV
FT                   FELFNGLEIKDLNVEVTGKPLTNGHAEPNGVAAN"
FT   CDS_pept        109363..110100
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000037974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944434"
FT                   /orf_name="Pc15g00490"
FT                   /product="Pc15g00490 protein"
FT                   /function="orotate phosphoribosyltransferase activity "
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="pyrimidine nucleotide biosynthetic
FT                   process"
FT                   /protein_id="CAP82935.1"
FT                   /db_xref="GO:0004588"
FT                   /db_xref="GO:0006221"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="UniParc:UPI0001831312"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6J5"
FT                   /transl_table=1
FT                   /translation="MSTVPPPSADQDYKSTLLPLLISNNVLSFGTYVLKSGRESPYFFT
FT                   SSLLHTAPLLRASSAAYASVLSAEPFVTTNADGTAQPNFDIIFGPAYKGIPICASVTNE
FT                   LAVRDSLSGKTTWDNVSYSFNRKEAKAHGEGGNIVGAPLKGKRVIIVDDVITAGTALRE
FT                   AVGIIEKEGGIVAGVVVLLDREERVSDTEPKSAIGVAQRDLGGKIPIRSVIGLHDLIEK
FT                   LGDSIGAGEIQRLKDYRERYGAQ"
FT   CDS_pept        join(113657..114007,114070..114245,114305..120262,
FT                   120325..120530,120611..121121,121182..121230)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163916" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944435"
FT                   /orf_name="Pc15g00500"
FT                   /product="Pc15g00500 protein"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP82936.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00018313E4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6J6"
FT                   /transl_table=1
FT                   /translation="MNWRYTIPVLAFLATPGISWPYDETLVAYNLNENQTATNPSDYWG
FT                   EWPDHTYFPSPENWRFPVYTLFLDRFVNGDPTNDNVNGTLFEHDINSNQMRHGGDVVGL
FT                   LDTLDYLQGMGIKGLYLAGLVLMNQPWGSDGYSALDTTLLDQHFGTIQTWRAAITEIHN
FT                   RGMYVIFDNTVATMGDLIGFEGYMNTTTPFSVKEHKASWKSDRQYVDFRYGNTYNETCD
FT                   YPRFWNETGYPVDEYVDYQLRGCYDSDFDQYGDIEAFGVYPDWKRELAKFASVQDRLRE
FT                   WVPSVRERLIRHSCMIIASFDIDGFRYDKATQATVDALGDISGAYRDCARRVGKNNFFL
FT                   PGEITSGNTLGSIFHGRGRQPDMQSQTLEEAFMMTNASDPDYFIRDQNKQATDAAAFHY
FT                   SVYRSLTRFLGMDGNLAAGYDVPVNWTEAWYQMVLTNDMVNANTGKFDPRHMYGATNQD
FT                   VFRWPTVEYGIERQLLALFITTLHMPGIPMLLWGEEQAFYILDASAANYIYGRQAMSPA
FT                   TAWKNHGCFQLNSTQYFQWPIESGRLGCHDETVTYDHRDPAHPVRNIIKHMYQMRQDFG
FT                   ALNDGWWIQLLSNQTHNIYLPGSNGVPTETGMWSVLRSPYYQLQDLGEMGNQTVWFVYQ
FT                   NENRTVNYEFDCSDPTAALIAPFDTNTTVKNLFYPHDELTLQEGPAKLALNGSDNYNGC
FT                   LDSMKLQPYEFRAYIRKEKFVSPRPMITKFLPGHDAPLLSAVAPDQSESVDISLFFSTE
FT                   MNCSIVTDSISVESSTETGEWPYLDLDSVSCESVEPETTSWTGQIPSTWSWRATLTGVY
FT                   NGVHRLTVNNATSIDGRATNAIDHFLIRVGQSDNPMIFTTANYSSSLLHERKDGTLFIA
FT                   QHAAGADKYRYSTNWGSTFTQWLPYEGGNHSIQELPWSGTKKQRWEGKHVRIEYWSRLT
FT                   GSSDYVQEGDGPDWTPAIRRRFPHLFFNGPFNRYGYDAGLDNIVRQDTDGLWKFRFMTE
FT                   WPAQGQLNVWGINPDNQPDQSYIYGDSDGDSILDRLPPSSLSVTTINITHHPPNPHLAW
FT                   RIQLDDSNLQFKLVPAGSKYVQMALFFLLCIVPVITASTCAYIFKKTFYRIKFNQVGVS
FT                   EKKTLISMDFINKFKVGHMEDGQSRNPFKRLASRSNFLQSTSAFGNRTGHRRKVLVATM
FT                   EYEIDDWAIKIKIGGLGVMAQLMGKQLGHQDLVWVIPCVGGVKYPIDKQADSMFVMILR
FT                   NSYEIKIQYHQLRNITYVLLDAPVFRQQSVTEPYPARMDDLDSAIYYSAWNQCIAQAMK
FT                   RFPVDMYHINDYHGSVAPLYLLPETIPICLSLHNAEFQGLWPMRTQKEKTEVCSVFNLD
FT                   VDVVTRYVQFGEIFNILHAGASYLRLHQQGFGAVAVSKKYGKRSYARYPIFWGLRKVGN
FT                   LPNPDPSDTGEWDKALHKEGDINVDNDFENRRAELKRQAQEWAGLEQRPDADLLVFVGR
FT                   WSMQKGIDLIADVLPSVLESREHVQLICIGPLIDLYGKFAALKLDRMMKLYPGRVCSKP
FT                   QFTVLPQFIFSGADFALIPSRDEPFGLVAVEFGRKGALGIGARVGGLGQMPGWWYTVES
FT                   TTTSHLLKQFKLAIDSALNSKPEVRAMMRARSAKQRFPVAQWIEDLEILQSTSIRVHQK
FT                   ERAKAQSQSTAAGAYNAIYGMMTPQAASTRSGASTPPLQPSSRPGTTGSLQRSSMIYSR
FT                   DASPGYDGRPRSGLSRQVSHGVRPVSGTMEPRGRSDLGKGSVIEGDDSAGRATPEAEDN
FT                   SDDEMMATCYGDDDYSISPEGTDPGRAQTPQPPGVALTKEALSAQRASQGSLLARCSNT
FT                   PSSSSAPSTVGTDDTLIPPSRPWAEPGNRLGNASALSVDSVVGEKKDFKLQKVDPFFTD
FT                   SNGEYYRVFEKRLEELNGANSDNQLCIEQYLEKSEKKWFNKFRDARLGLNQGSPAGSVH
FT                   RGKAGTSPNGSVTNDDATSHESGERERKDAQPDEFLLGDDYVPPTGLKKWMQMRIGEWP
FT                   VYSLFLGLGQIIAANSYQITLLTGEVGQTATKLYGIATVYLITSILWWFFFRYCKSVLV
FT                   LSVPWFLYGTAFLVIGMAHFEPNSHSRGWIQNVGSSLYAAASSSGSIFFALNFGDESGA
FT                   PVKQWVFRACLIQGTQQAYVIALWYWGSTLTKATNAGVMDVQGSITNTWRMTAICTPIT
FT                   LFLWAIGLIVYFGLPNYYRQTPGKMPSFYKSVFRRKIVLWNWVVVILQNFFLSAPYGRN
FT                   WNFLWISQHASPWQILLLCVAFFGFAWIVVLFLLARLSKSHSWILPVLACGLGAPRWAQ
FT                   IWWGTSGSGLFLPWAGSYTSGALVSRSLWLWLGILDALQGLGFGMILLQTLTRMHICFT
FT                   LLVSQVLGSIATICARAFAPNNIGPGPISPDITAGAGALGNAWFWVALLLQLSICGGFL
FT                   LFFRREQLSKP"
FT   sig_peptide     113657..113719
FT                   /db_xref="UniProtKB/TrEMBL:B6H6J6 "
FT   mat_peptide     join(113720..114007,114070..114245,114305..120262,
FT                   120325..120530,120611..121121,121182..121227)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6J6 "
FT   CDS_pept        join(complement(124232..124438),complement(122052..124169))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670799"
FT                   /orf_name="Pc15g00510"
FT                   /product="3-isopropylmalate dehydratase "
FT                   /EC_number="4.2.1.33"
FT                   /function="3-isopropylmalate dehydratase activity "
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /biological_process="leucine biosynthetic process "
FT                   /cellular_component="3-isopropylmalate dehydratase complex "
FT                   /protein_id="CAP82937.1"
FT                   /db_xref="GO:0003861"
FT                   /db_xref="GO:0009098"
FT                   /db_xref="GO:0009316"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR012235"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015936"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniParc:UPI00018313E5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6J7"
FT                   /transl_table=1
FT                   /translation="MPSAESGPKTLYDKVFQDHIVNEQEDGTCLIYIDRHLVHEVTSPQ
FT                   AFEGLKNASRQVRRPDCTLATVDHNIPTSSRKNFKNAADFIKENDSRLQCTTLEENVKD
FT                   FGLTYFGMGDKRQGIVHIIGPEQGFTLPGTTVVCGDSHTSTHGAFGALAFGIGTSEVEH
FT                   VLATQTLITRRSKNMRIQVDGELPAGVTSKDVVLHIIGVIGTAGGNGAVIEFCGSVIRG
FT                   LSMEARMSMCNMSIEGGARAGMIAPDEITFEYLKGRPLAPKYGSAEWNKATSYWSSLKS
FT                   DAGAKYDSEVFIDGKDIIPTISWGTSPQDVVPITGVVPSPDDFEDENRKASCKRALEYM
FT                   GLVSGTPMKDVVVDKVFIGSCTNARIEDLRAAAKVVNGRKVASNIKRAMIVPGSGLVKE
FT                   QAESEGLDKVFTDAGFEWREAGCSMCLGMNPDILSPKERCASTSNRNFEGRQGAQGRTH
FT                   LMSPAMAATAAIVGKLADVREHVVASPVLGKASPKIDVQPVFESPETEDELDRVLDRPA
FT                   DNEPHTNSSAPASGGGKSTGLPTFTTLKGIAAPLDRANVDTDAIIPKQFLKTIKRTGLG
FT                   TALFYELRYTDDKENPDFVLNQGIYRDSKILVVTGPNFGCGSSREHAPWALLDFGIKCI
FT                   IAPSFADIFFNNTFKNGMLPVVVSDEVALQKIADEARAGREVEVDLVNQEIKDAQGNKI
FT                   TSFEVEAFRKHCLINGLDDIGLTLQMESKIRSFESKRTLDTPWLDGSAYLRRDRRGATM
FT                   VEAAPVPKTNRGDVKNEPLEW"
FT   CDS_pept        join(complement(126426..126672),complement(125797..126285),
FT                   complement(125208..125740))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000199856" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944436"
FT                   /orf_name="Pc15g00520"
FT                   /product="Pc15g00520 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP82938.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018313E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6J8"
FT                   /transl_table=1
FT                   /translation="MSTTSTCLQLEKLQKTPTTFHQNLFSESISDYSNESRSESEPPSP
FT                   RSEKSRQRVLLLKGAREQYALVDDHAIPSVLHEGEILAPPNYSQQLTGESIRAFNFGIP
FT                   SLPWINGRDLAGLVLHVPKGPSRLRVGDVVLVPSTDYRDIRKAAFQEYAIANDFNAARI
FT                   PSSTSIHASASVGVAFVAAVLALGVSFGLDFSLISQAPGPNLPNIIKRLDRTDIPTDIH
FT                   EECFASLLDSEKPQRGDWVAIWGASTTTGLITLQLAKLARLRVICVADAARHGAKLVQS
FT                   GADLLVDRHDPDRAVEIIRGVTGGKLRYAIDMVGRDTATQLEKALNPDGHAHLLGLTGL
FT                   PKQRNPGVQYHTVPIKLFHTAPAVGEAMVCWLEDLLQSTNLTLPEIVHAEGGLEGINAA
FT                   LETLRSGSVSGKRIVVDLGSLPR"
FT   CDS_pept        join(127948..128071,128131..128772,128896..129172,
FT                   129227..129323,129382..129561)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000199845" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670800"
FT                   /orf_name="Pc15g00530"
FT                   /product="Pc15g00530 protein"
FT                   /protein_id="CAP82939.1"
FT                   /db_xref="InterPro:IPR010291"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00018313E7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6J9"
FT                   /transl_table=1
FT                   /translation="MTRLPNNPLRLIMTNPEKDVAPSDVVTSADSFNSPLGGPRKVKWY
FT                   RSTFYNALILGICNFLAPGIWGAMNSLGGGGEEEPYLVNAANALTFGLMVVSCFFGSVI
FT                   VRFIGIKWTLIVGTMGYAPYAAGLYTNNRFDQEWLVILGAALCGMSAGIFWMAEAAIAL
FT                   SYPEPYNQGRFLGFWLSFRVGGQILGGVISLGVNAHRSTSGSISYTVYLIFIALQALGP
FT                   FAGLLLNNPSQVQRKDGIPVQLQVANSIGYEMKTLGSFLSGVIALIIGNLLGAFLDTKR
FT                   ISLKKRSRYAFLLVVGWQGMCWIWASVLTTEFNKTNPIYDWTDPGFGRAFVLFLFWVAG
FT                   FQLNYMYLFFLVGNLADDQEEVVRIAGLLRGTESAAQCVSYGLSSVNIMAAVGSIYLNF
FT                   GLWAIAIFPAWLIVKEVGEAFGDKKIARETPGLRGTLDQE"
FT   CDS_pept        join(complement(131031..131269),complement(130793..130973),
FT                   complement(129754..130734))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163915" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944437"
FT                   /orf_name="Pc15g00540"
FT                   /product="Pc15g00540 protein"
FT                   /protein_id="CAP82940.1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniParc:UPI00018313E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6K0"
FT                   /transl_table=1
FT                   /translation="MHTSNTLSRKETWRLLALVGAGLAILNATFQGDGAPLVASIALCG
FT                   IVFAVAFSLVRWLGPAFIKAGLKGKDMAKPSRPEIPETMGAVCAVVYLMSLIMFIPFAF
FT                   YKDIVAATSGGGNRDVVIESQHIENGRFLHRFPHGKLASYLSGLLSLQSVVILGIGDDL
FT                   FDIRWRHKVLIPAFSAIPMLIVYFVDFGVTQVVVPVPLQPYLGDIVDLGWLYYMYMAAV
FT                   SIFCPNAINMLAGINGIEVAQSLVIAIQLLFNDAMYLAPMTPYPHPATDSHLLSIYFLL
FT                   PFIGVSAALLFHNWYPSKVFVGDTYCYFAGMVFAVVGILGHFSKTLLLLFIPQIFNFLY
FT                   STPQLFKLIPCPRHRLPKFSASTGLLDASVTEWTSPPSPLIDTALRLLHTLGLVRITQD
FT                   ENGRITESSNLTILNLWLVWMGPMREDQLAWHMVAVQTVCGMIGLFVRHRLALLVFHHD
FT                   NREFGFIA"
FT   mat_peptide     join(complement(131031..131167),complement(130793..130973),
FT                   complement(129757..130734))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6K0 "
FT   sig_peptide     complement(131168..131269)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6K0 "
FT   CDS_pept        join(131594..131803,131877..132735,132794..132900)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127861"
FT                   /orf_name="Pc15g00550"
FT                   /product="Pc15g00550 protein"
FT                   /protein_id="CAP82941.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00018313E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6K1"
FT                   /transl_table=1
FT                   /translation="MGAVERPEISAGFADFDAGHRDLVTVTRFNFYGNRIVTASSDHRM
FT                   KVWDLKDGQWQLVDTWRAHDAEIRDATWNGPFTGQHIGSVGEDMKLKIWQEDVTQPPNS
FT                   GRRFKSVFRMTAPQRHPFVSLDFRNIDLESWLAAITRDGYLMVMEPVSPDSLADWQPVD
FT                   QFRVCTAPERGEETSFKVQFHHDPTDITHTVLPDSDRKSLSLVVAAMDTVKVYRTDANR
FT                   RFYHAIELNGHGGLVRDISWANGSVRGYDLIASGGKDGLVRIFEVYTMPAGQAQNSNGR
FT                   KADLRMQSQSQSQSQSPSLRATSQSGIGSALASRVPASVTDRQANGESQFRHSFKQVAC
FT                   IDTKHLDVWQVQFSFSGDSLISSGDDGAVRFWKRSLSGEWLEFAETDMASQ"
FT   CDS_pept        133269..134846
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823578"
FT                   /orf_name="Pc15g00560"
FT                   /product="Pc15g00560 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP82942.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00018313EA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6K2"
FT                   /transl_table=1
FT                   /translation="MAIGPTIGTGLFIGAGQALAVGGPASLLLSYIILSILTFAMTTSV
FT                   AEVSTHLPSPHGTLVTNGYKYMSKSLAFASAYLRWYTLALFVPYEITSAMVNLGLWKPG
FT                   STIAIRLVIITTIVVGCNFLPERIFKSSERLFTAIKIGTIATLFVLSLALGLGGVDTQP
FT                   SWGFKYWKHPGAMNEYLVRGVSGRFLAFFQCLLDGSIAFAFAPELIVHHAEMPASLMPS
FT                   IGESAILGAGIPGVVKADVAQTAFPYILSSLAMGVMAPSNDTRLTNNGTGSGFSPYLIG
FT                   LKDAKIQVVPTIAMVAILLSAVASGRSFLYLSSRTLCAMSELGHAPSAFSTRNRGHVPY
FT                   LAVVASALFSCLAFVSVKIPSTIMHTYLLRLVTSACFISTLVSCAIYIRFNRQLRAKGV
FT                   TKRYSFSVQPFATYFGMAISTLLLLGGGLWAGPKRNLTSRATRLIIAYVNIGVFSLLYL
FT                   FRRFQEFAPVAEIERQMDMGGRSHGDRAGPREPRTQKTNPHRGEVDVIPEASGAFELRA
FT                   SQATFREQ"
FT   CDS_pept        136643..139558
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670801"
FT                   /orf_name="Pc15g00570"
FT                   /product="Pc15g00570 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP82943.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00018313EB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6K3"
FT                   /transl_table=1
FT                   /translation="MTDTSSLAITHATTDSYPVHAHRGSPAAIDGAASDSGAPDEEPYT
FT                   IKCICSFDEDDGNTVFCEGCETWQHILCYYPDKKVPDVHNCVDCEPRPLDNRRAHERQR
FT                   QRRIREKSEDGDRKSRRSGPKTQKRKSNDAEVNAFGHGRHDSGSREQPPSKKAKVSRRP
FT                   STSISGISVPGQSAESQNRRSSTSVAMSPTTIPGPPIPHYSDEFLSLYDRDDQFIESKS
FT                   ILNYGVDFVNEIVAWLKDPQILARVTDGLSVEDFAKRSEEAMDRSRWPSLTTETITDST
FT                   IEIGGKHPVHKILKTQDPVRKDDVVGEIFGQLGHVKDYKKLDSNRWEELGHAMPFVFFN
FT                   RQLDLYIDSRQEGNELRHVRRSCEANVNLKIYITNGRQYHFCFVAKRDIPANSEITTMW
FT                   YFDDSFFPSDTTVKEEFKDRVVDPKDAAICISTTLANFGGCACGNPQTCVLNKLDRRAK
FT                   PPANKRPKSKVKGKGKKPKPLGIHDIGRAGSDTKHSDEHDPPADTRSNSGSARGRHTGS
FT                   RDLSPTALQLTLPALSSRERRKIADAEKQFQQLEQLKTVNPKRKKRSSGHPRRSTLATV
FT                   SSSTQTGDGFKPYHEPGVTRSSEMAGQSPQLQVAYVDAQTELYADDVARSFLRAERLRR
FT                   GYKLDMIHPTLMLKIRWCAGHHIAEDWAQRNAWESGDLSVVPSGVLPWWYGWFPLPIDD
FT                   RPHIELLQEDSDRMGIPADHGPLAMPPRWSFHQSKYPQPEYKYHGIAIRGMHYDLPARP
FT                   NQGDVDTRSAMSYRLESSASGPSSDLLKPAVPPYWPSTAAHTFRMPGAGNRGNLHVSMP
FT                   PPRASNIPSALSPGSMSTGSLASPSSHDTASPISLMPTSGSALAATPAKKKLSLGDYLI
FT                   RRGTMATTPTSEPAPPASAPPPPPPPAPPAPAPTTPAPPPGDSRLRTQHFLAITTVFGD
FT                   NHEPPHKTEPGGDKNEPSDSPDISMEDAPETTPTKNPSIPS"
FT   CDS_pept        join(140239..140395,140447..140547,140603..140965,
FT                   141103..141849)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163872" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670802"
FT                   /orf_name="Pc15g00580"
FT                   /product="Pc15g00580 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP82944.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00018314CA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6K4"
FT                   /transl_table=1
FT                   /translation="MNDSNQSIVLNEIDPGSTEVSEIEQPTLPPADGGKGAWLMLASCC
FT                   FIQIPVWGFSTVFGVFQEYYSTHDVLQGSKNNLATVGTTSTGLLYLLSPITFTLLTRYP
FT                   HLQYYCAPAGLAITVVGSLLSSFSVQVWHLIAPQGVMCAIGNGLLFSPSSLYLDQWFLR
FT                   RKGLALGTMWAAKSITGVALPFIASACLNRFGSSNTLKAWTVVTLLTTLMALPFMKPRI
FT                   PVSPSASARRLDLSFLKQATFWMLQTGNIIQSFGYFLPTTFLPSYSTTTVGLSQNTGTM
FT                   LVSLFNATSIFGGIALGALCDRFSVTNIMLLSSVGSALSVLLFWGMASSGSDSSQTAIA
FT                   LLTIFSITYGFFAGGFSSTWSGVITQIKRDSSPSLDTGLVFGLLAGGRGIGNVISGPLS
FT                   TVLLQSGSLRGSSGLSGNTGYETQYGTLILFTGITAFFGAWSWIWRYVSPTLGCLR"
FT   CDS_pept        join(142154..142630,142715..142840,142900..143628)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163861" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670803"
FT                   /orf_name="Pc15g00590"
FT                   /product="Pc15g00590 protein"
FT                   /protein_id="CAP82945.1"
FT                   /db_xref="InterPro:IPR007852"
FT                   /db_xref="UniParc:UPI00018314CB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6K5"
FT                   /transl_table=1
FT                   /translation="MATEAALQDPLLSLRRAIASGNLPTPTTSSEPSDQPATDDLAKAT
FT                   HLYFTQPAPQTIALSTPTRFISASTNSPVDLRSILFAWQNKDVAIPEYIAKAQEFNEAL
FT                   KQQTKEGAKEESVQILIFLERLDLFTWLEGASDDSEHIKPLEGAAAAAEAAAAAAAAQA
FT                   GTQLGRPQKQVDPRLQEIYNGERKTGDRNTVLRGIKPTDFSHVRKSAELFLDRNRSRPG
FT                   QPNAKPGIKGSIPAPSAGLSMASRKSSSSHSRPDPIILISPSASSLIRMSNVKSFLEEG
FT                   IFVPPDHPTLSSATDANLVKLERPLRLNGDASNPASASSRAGGKPTRPTKFIVVDGTTN
FT                   FKPEYWNRLVAVFTTGQTWQFKSYKWSSPPELFKHATGVYIGWRGEDVPSQVKGWGRGV
FT                   ETFAVERWDEKNGVHGGGRWRDREVVEGIWTAIEEGMRLRGWGK"
FT   CDS_pept        join(complement(146389..146829),complement(144855..146330))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127862"
FT                   /orf_name="Pc15g00600"
FT                   /product="Pc15g00600 protein"
FT                   /function="signal transducer activity"
FT                   /protein_id="CAP82946.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniParc:UPI00018314CC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6K6"
FT                   /transl_table=1
FT                   /translation="MPTQTRSHSREDSLPSVPDSDFSGTISRNRRSFAALAQKTYALAT
FT                   LSGSTLRSSTSYGSLSKPHKLSETPVTPPFDGDTYVQLTGTSRPSSPALVDNPPTSLLK
FT                   RRLTIQRLPTLPNETRSSPPAPKMHQTSSRLLRMTEDERPFTKDFMDLFSTLMVSLKLD
FT                   SHRVRFTRYDHTFTSEEAINNLGSLKFSQSNRMPDPKDPSRIVTTTTTTTFSMAKEMAR
FT                   SVCQRFVDARFIESVDGKALLIFPLKGALFQLTPKGINILQRFCQRNGITARHVMDVLE
FT                   SPRNTMQLVNLERDTDSDKLSHDRATIEVIFRRFAGQDGPNIKSSISTSDSDSLSDYTN
FT                   GLVGVKVARERKLLDGKVYSNTFTGKAAVDWLMDCSTTIERRETCLISELFLKYGLITM
FT                   IQDDKQFPDVGTNVHFQPSKYAIYGITERGQRVCGWIAREKTREVAPTYDSRGMPRDSN
FT                   NARLTHILQDPALRLLFREFLRYSLCEENLSFYLDVSEFTTNYHKAEKIGTFNKVDSVR
FT                   ETLAAAYGLYNAFLAPGSPCELNIDHALRNSLASRMTKAVGDDESMFKSLQEVVHLFEL
FT                   AQTSVFKLMSSDSVPKFLRDPKYSVVLQEHDVDILGGSRSYSPTPARPPSIPERSMSRS
FT                   ARA"
FT   CDS_pept        join(150311..150409,151050..151156,151429..151855)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976759"
FT                   /orf_name="Pc15g00610"
FT                   /product="Putative uncharacterized protein Pc15g00610 "
FT                   /protein_id="CAP82947.1"
FT                   /db_xref="UniParc:UPI00018314CD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6K7"
FT                   /transl_table=1
FT                   /translation="MFKWIGNPKLRPAKRLARGGFPAKSKVAVRHSTECGLSDWDLNYA
FT                   LMLPGLAMLNSKHLINPGPGMVARSGATGVGEAYGVAEVATWNSGEVDNLDLEHRSDHP
FT                   LVTEGHASVSKASTYHGWHNPVLGPCGLRSLSLVVQSHAQSYWDDNPDKGHALIDRNSP
FT                   CETSENTSGIPCTQHFANRASSDLLPIQWHAGGDSTYVYMSRRWAPR"
FT   rRNA            152170..152285
FT                   /gene_name="8S_rRNA"
FT   CDS_pept        join(complement(158310..159860),complement(157620..158240))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163839" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944438"
FT                   /orf_name="Pc15g00620"
FT                   /product="Pc15g00620 protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAP82948.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI00018314CE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6K8"
FT                   /transl_table=1
FT                   /translation="MARAPKRRRVSEDVDGDIEMGNDTQDVFSVPSSPNNHRTSPTPVK
FT                   SVSRRRSTRGDNPDPETTGEGGKDDKDEVQTPARAGTRTSGRQRKTPKRYEEEAVTPSS
FT                   RRKPATTPARSARATRSAQKPRQSPMEDGGEREFEEEDEEEEEDDDDDDDMDLDEPSPE
FT                   PARRTITRTRSRRSTAKPRSKKALATEPKEKSPSPEYQDGLDDLVTMQLQQDLYHDQSE
FT                   THEPADGSEPLPEYAEMFQALCQTGLEDEMRILSTILLEKLSGKRQIPVRGLESEYQKV
FT                   HQLIEQTVSVGEGNSMLLLGSRGCGKTAIVESIISSLRKDHSNDFHVVRLNGFLHTDDR
FT                   LALREMWRQLGREMHTEDDAAKVSSYADTMATLLALLSHPEELFGASGDPASKTAAKSI
FT                   VILLDEFDLFVTHPRQTLLYNLFDIAQARKAPIAVIGLTTKVDVTEMLEKRVKSRFSHR
FT                   YTYVPLARSFDTFSDICLGSLDLSDAEMADIADELGSERTLVESEKWKSLLGGWKEYLK
FT                   HMWDDKEFQFHLRRIYNQTKSAKEFFNSALLPISDLLHSVSIPDTPIPEVPTPKSFASQ
FT                   SLDCPDPAPLPFSTSITSSSPSSLPLALLVAATRLAALFDPGNDGSQSQSMGPLALSFP
FT                   AAYAEYVRLLTSAKTSASVSGAAATPGRVWGRDVARESWEKLLSWGLVTPVGSGNGTAD
FT                   GQMFRVEISFEEVIEMAGSGGALGQWWRE"
FT   CDS_pept        join(160730..160837,160941..161354)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163826" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127863"
FT                   /orf_name="Pc15g00630"
FT                   /product="Pc15g00630 protein"
FT                   /protein_id="CAP82949.1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI00018314CF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6K9"
FT                   /transl_table=1
FT                   /translation="MSDNADNAISAPSRKLDEFEELVYEYTGRMGMGNEGHWDVDARSC
FT                   NLRFESATRGPPATVSFLLTITPPLSNYMGNLHGGCAATLIDVLSTTILLGISEPGKFS
FT                   FGGVSRNLKVTYLRPVPTGTEVRLVCEVIHVGKRLALLRAEIQKAESGDVCVIGEHEKA
FT                   NTDPEVTQRI"
FT   CDS_pept        join(complement(163396..163441),complement(163314..163338),
FT                   complement(163193..163243),complement(163105..163132),
FT                   complement(162709..163054),complement(162092..162643),
FT                   complement(161785..162042),complement(161640..161728))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163825" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944439"
FT                   /orf_name="Pc15g00640"
FT                   /product="Pc15g00640 protein"
FT                   /function="Rab GDP-dissociation inhibitor activity "
FT                   /biological_process="protein transport"
FT                   /biological_process="regulation of GTPase activity "
FT                   /protein_id="CAP82950.1"
FT                   /db_xref="GO:0005093"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0043087"
FT                   /db_xref="InterPro:IPR000806"
FT                   /db_xref="InterPro:IPR002005"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="UniParc:UPI00018314D0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6L0"
FT                   /transl_table=1
FT                   /translation="MDEIAPEYDVVVLGTGLTECVLSGVKGNKVLHIDRNDHYGGEAAS
FT                   VNIEALFKKYGNVRPGEEPWKKYGRVNDWNIDLVPKLLMSNGELTNILVSTDVTRYLEF
FT                   KQIAGSYVQQGKGPKATVAKVPSDAGEALRSSLMGLFEKRRAKKFLEWVGDFKEDDPAS
FT                   HQGLNIHACTMKEVYDKFGLEDNTRDFVGHSMALYPSDEYINQSGAAVETINRIRLYVN
FT                   SMARYGKSPYIYPLYGLGELPQGFARLSAIYGGTYMLNTDVDEVLYENGKVSGIKATMK
FT                   DRDDQSEAMKFETKTKKIIADPSYFPSKSKVTGYLLKAICILNHPIDKTDSSDSVQLII
FT                   PQSQVGRKHDIYIAMVSSAHNVCPKGYYIAIVSTIAENDANHHLELEPGFERLGKIEEK
FT                   FMGPPIPLYEPIDNGEESNIFISKSYDATSHFETTTDDVRDMYRRATGEELKVEGLRED
FT                   QQLATE"
FT   CDS_pept        join(complement(164473..164836),complement(164226..164392),
FT                   complement(163903..164073))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048327" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944440"
FT                   /orf_name="Pc15g00650"
FT                   /product="Pc15g00650 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrial ribosome"
FT                   /protein_id="CAP82951.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005761"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR010729"
FT                   /db_xref="UniParc:UPI00018314D1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6L1"
FT                   /transl_table=1
FT                   /translation="MQQVPRIASRLRGLAMAELPPTYLAPSLHPSVTLSAIQSSSFSST
FT                   ASVGANPRRDKSKNRGVSAIHRTGPRTPFVVSRWPLPKPVSPKDMQPRETDPNHGLWAF
FT                   FPPNRQPLPTPEYDNAHGRAWAIQELRERDWQDLHGLWHVCVRERNRIATSDLERERIQ
FT                   AGYGGFESQERDKVIRSTMRNIKHVLRERWYAWEDAKRMYKRGYRPENFYGLEDFEVEQ
FT                   ERVEEAQGKDQ"
FT   CDS_pept        join(165668..165747,165827..165968,166059..166539,
FT                   166591..166856,166915..167269,167328..167423)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(168357..168750),complement(168255..168293),
FT                   complement(168142..168198),complement(167701..168089))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163793" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823579"
FT                   /orf_name="Pc15g00670"
FT                   /product="Pc15g00670 protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAP82953.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI00018314D2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6L2"
FT                   /transl_table=1
FT                   /translation="MPEEPALQAFFKSKVYASSFKRGEMVTRPFAEMLVDQTKVAAESK
FT                   ANPAQHLVVLDNACGTGVISSALNDKLDDSVKKMWKLTCGDISSPMIESTTHRMQEEGW
FT                   PNAEAKIVDAQKPELASAQFSHIFTAFAYMALPESLKALDETVRMLQPGGTIAFSTWIE
FT                   PGWIAVARAAIESMPGNLSFPETPKLLAALTDGQWDSKAWIETQLEERGFQDIDVRPTT
FT                   TKLTITSPIFVDMTMLMIPTMVKTFWTDKQREEHQDKVRPAIEKYLEDSYGYGNIDTEW
FT                   MAILSTARKSG"
FT   CDS_pept        join(169492..169518,169571..169611,169699..171856,
FT                   171908..172282,172336..173274)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163792" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944441"
FT                   /orf_name="Pc15g00680"
FT                   /product="Pc15g00680 protein"
FT                   /function="ATP binding"
FT                   /biological_process="chromosome organization"
FT                   /cellular_component="chromosome"
FT                   /protein_id="CAP82954.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0051276"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="UniParc:UPI00018314D3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6L3"
FT                   /transl_table=1
FT                   /translation="MRITEIVIDGFKSYAVRTVISGWDEAFNSITGLNGSGKSNILDAI
FT                   CFVLGITNMTTVRAQNLQDLIYKRGQAGVTKASVTIVFDNRDTAKSPIGFEEYANISVT
FT                   RQIVLGGTSKYLINGHRAQQQTVQNLFQSVQLNINNPNFLIMQGRITKVLNMKSVEILS
FT                   MIEEAAGTRMFEDRREKANRTMGKKELKLREIEELLKEEIEPKLEKLRSEKRAFLDFQQ
FT                   TQNDLERLTRLVVAHDYVRGGERLRVAGEECENKRNKAQALEDNAHKLKSEIAHLEEDV
FT                   KRVRAARDKELRKGGKFQGLEDEVKNYSHELVRLTTVFDLKNASMDEEKEKRRTIQNTV
FT                   TDLEKILKEKRKIYEKLQAQYDTAKAELDAQNVEVEQKEELLQTLQTGVASKEGQESGY
FT                   QGQLQDARNRASNAATEQEQGKLKINHLEKRIKEEEPRAKKAKEQNLGLLRDLEGLKSQ
FT                   ANKLESELTRLGFEPGKEEQIYQEQTELQRDIRDLRQRADELKRQAANIDFNYADPYPN
FT                   FDRSKVKGLVAQLFTLNKDQVPAATALEICAGGRLYNVVVDSAETGTQLLQKGKLRKRV
FT                   TIIPLNKISAFKASVEKIGAAQNLAPGKVDLALSLVGYDEEVLAAMNYVFGNTLICDDA
FT                   DTAKKVTFNPSVRMKSVTLEGDVYDPSGTLSGGSSPNSSGVLVTLQKLNDITKELRSKE
FT                   RQLATLEDHMKREKKKLDSVRSIKQNLDLKNHEIKLTEEQINSNSSSSIIQAVEEMKSN
FT                   IEQLKNDIADAKSRQAEASKDIKRIEKDMSEFSDNKDSKLEELQTTLDKLKKSYAKNSS
FT                   SVKELQKELQTSRLDSEQVGSDLSAAEEQLVESENTLSAQVQEIESQKREQARLKDAHD
FT                   IAQAQLDDERAKLTGFDEELRELEEAMKSKSSQITEDALEAQKLGHQLEKLQKDQYTAS
FT                   QAVAHMEQEHEWIADEKENFGRANTPYDFQNQNIAECKSTLRNLTERSQGMKKKINPKV
FT                   MNMIDSVEKKEAALKNMMKTVIRDKRKIEETIMNLNEYKKEALHKTWVKVNGDFGQIFN
FT                   ELLPGSFAKLDPPEGKDITDGLEVKVSLGKVWKQSLTELSGGQRSLIALSLIMALLQFK
FT                   PAPMYILDEVDAALDLSHTQNIGRLIKTRFKGSQFIVVSLKDGMFQNANRIFRTRFSEG
FT                   TSIVQALTPADLK"
FT   CDS_pept        join(173745..174023,174147..174440)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163771" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976760"
FT                   /orf_name="Pc15g00690"
FT                   /product="Pc15g00690 protein"
FT                   /protein_id="CAP82955.1"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="UniParc:UPI00018314D4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6L4"
FT                   /transl_table=1
FT                   /translation="MSDEEPSLNIPSLLTLAVVSYFVIRWFFNRDESAAGGSRGRGRGN
FT                   VVDPAQVEQIAQMFPQLSTRDIMWDLQRNGGSVAATTERILTGRGLETPPPSFQPQVAI
FT                   PPTNIPPTQTATAASAPKADAQDLISRYNLSAKAESPPAESHSEVPSKSTWSQNKEERQ
FT                   RILQKRRDDMILAARRKMMQKNLGDAQ"
FT   CDS_pept        join(complement(175625..175738),complement(174983..175569),
FT                   complement(174792..174909))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163760" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127864"
FT                   /orf_name="Pc15g00700"
FT                   /product="Pc15g00700 protein"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP82956.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="InterPro:IPR007257"
FT                   /db_xref="InterPro:IPR016906"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="UniParc:UPI00018314D5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6L5"
FT                   /transl_table=1
FT                   /translation="MAFPLPRGVTASEIAFLAEMETVTIVPRQRLEGLELLGGPIEPLV
FT                   PPRRASLPLWLALLLKRQRRANIIPPTWLHPEPLALILEVESQHQDYKNAFSPPPPLPG
FT                   QPSILDRDALPSARPQYTPDGNRYYAAPPFLHQNTAQTVASSRDPPSLPFHWVEVGNLL
FT                   LDAASDDLVDPDQIRRLLKDLREVRMAKMRSGVDVLDAAATGGGGVALTGVGSMELGED
FT                   RGFITGVVDGLRRIGSSKEQARREQMAEQRANGGYDGTQDDDEEEDYMEF"
FT   CDS_pept        join(176110..176908,176974..177111,177173..177742,
FT                   177956..178221)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163749" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823580"
FT                   /orf_name="Pc15g00710"
FT                   /product="Pc15g00710 protein"
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP82957.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="InterPro:IPR007006"
FT                   /db_xref="UniParc:UPI00018314D6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6L6"
FT                   /transl_table=1
FT                   /translation="MANPPESDLSRSARWLVPFFLVLVPLWVSLVNKAVPEPYLDEVFH
FT                   VPQAQAYWSHKWTQWDPKLTTPPGLYLCSYTIFAIVLLLRGSPTKLTPDVLRMTNVGAT
FT                   TVVFPWRLQKLLDTLQRTTNTRPLGANVSHTVLNICLFPPLFFFSGLYYTDVLALLVVV
FT                   EAYNWDLKRDTEGHQQGDSGKDKKEGLSNGILETLGFLAFALAALVFRQTNIFWVSVFL
FT                   GGLQVLRKIRKSATPCMSSKVSTIVKQGLQNEVYDPLVSEASLEDYPKTAISLATVGLK
FT                   KPFSLLVSLIPHIIVLAAFGAFVLWNNGVVLGHKEFHTAGIHLAQMLYIWPYFTFFSWP
FT                   LFILPLVNILALKPLPKYLNLGFPPKQMKYPKLKAALVVIPLMLAVVHFNTIVHPFTLA
FT                   DNRHYVFYVFRILLLHPAVKYAAVPVYFLCGWVVISAFGFTTIQRPPKALRVQQSASAA
FT                   PQAPVPAPAPAPAAQEPKSTSSSVRKPLQAHQQPPKGTKKPNRPTPLVEPRYLIIPWVM
FT                   WRVHLPPLPCLFRDRETRPRTEEAKRRSDLIVNLPKFVETVWFLIINLITGYVFLYKGF
FT                   EWPQEPGKTQRFMW"
FT   sig_peptide     176110..176208
FT                   /db_xref="UniProtKB/TrEMBL:B6H6L6 "
FT   mat_peptide     join(176209..176908,176974..177111,177173..177742,
FT                   177956..178218)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6L6 "
FT   CDS_pept        complement(178562..179761)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000042598" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944442"
FT                   /orf_name="Pc15g00720"
FT                   /product="Pc15g00720 protein"
FT                   /protein_id="CAP82958.1"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniParc:UPI00018314D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6L7"
FT                   /transl_table=1
FT                   /translation="MDTTFQAAIDTGKINGAVVCATDAQGHFVYNKATGERTLLSGEKQ
FT                   PQQLDDVLYLASATKLITTIAALQCVEDGLLSLDGDLSSIAPELAAKYVLTGFTDDESP
FT                   LDDPPARPITLKMLLTHSSGTSYHFLDPSIAKWRAQYANPENEKPRLVEEMFTYPLSFQ
FT                   PGTGWMYGPGLDWAGRVVERVTGGTLMEFMQKRIFDPLGITDSQFYPVTREDLRARLVD
FT                   LNPSDPGALGSAVIGGGGEMNLRGRGAFGGHGLFLTGLDFVKILRSLLANDGMLLKPAA
FT                   VDNMFQQHLGPEAAASHRAALASPLGPFFRVGTDPETKVGYGLGGLLTLEDVDGWYGER
FT                   TLTWGGGLTLTWFIDRKNNLCGVGAIQAVLPVDGDLMADLKQTFRHDIYRKYSAWKGQQ
FT                   "
FT   CDS_pept        join(179896..179928,179990..180029,180149..180259,
FT                   180308..180410,180554..180611,180701..180781)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944443"
FT                   /orf_name="Pc15g00730"
FT                   /product="Putative uncharacterized protein Pc15g00730 "
FT                   /protein_id="CAP82959.1"
FT                   /db_xref="UniParc:UPI00018314D8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6L8"
FT                   /transl_table=1
FT                   /translation="MAALGLTAPPEAKSNFMAIHFALWGKLRIHNSRVRAFKYYVVLTS
FT                   TGVCSSGGAIAVRSPRSDILLAAELVSGAGFWSWFWSWFLELVSGAGFWSCLVSGVWFL
FT                   ELVSGAGRETPLVPLPFVAFVPFANRVSRVVVNESSS"
FT   ncRNA           180020..180126
FT                   /ncRNA_class="snRNA"
FT                   /gene_name="U6"
FT                   /db_xref="Rfam:RF00026"
FT   CDS_pept        join(180980..181627,181698..181925,182004..183038)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976761"
FT                   /orf_name="Pc15g00740"
FT                   /product="Pc15g00740 protein"
FT                   /protein_id="CAP82960.1"
FT                   /db_xref="UniParc:UPI00018315C3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6L9"
FT                   /transl_table=1
FT                   /translation="MVNKIGLRGALSKLRKSPTQPTRERETRDISGPEILHPDLIYPLF
FT                   KRPDPKDSPIYSQLMFPPTSLPTVPMASDAKLDPRVMASTISNARLNALQSGDDLDSFF
FT                   QKSKDCIDAYTQAIKAMIEDASVRVKNGEEPPFDEIVQMKERFFKYCQTIVEEALALVA
FT                   RARAARHLQQTAVSISSTVPSLVSSTSTPAWYEPDVPWDLDRPDGKAGFSEALLASSGR
FT                   DRLRLYTVSSDDWVMVPSMPSPTSPTKIVAPDNMDPVEESIHLGAIVRIFGKVYTMSKM
FT                   MEAIAFYYGTEPDNSKTGLTYWITRSEQNVRTQEMAVLIDIVQNLYYALYARLTIEMAS
FT                   IDLCGSFPIDARRVRMEIPHLMPEANHLYRIALAFKEVLDSPQICAVLRKDILAYFQEA
FT                   YIDQPREEKRHLFTPDRDEYHQFAMTTVSRRRGSYCEKWGQLIPFFNSVSAETMASLSQ
FT                   KYLLLSPWHIPRDDIPFGDLPWLSQDAVGMEVWDSDVVNERHLSERAQINGTGMGDERK
FT                   KEPIPDLYYHVRQGKCICLSICQCSLHCIYSLEHCRCSERHVRIMAAKRGFAHRRNGGP
FT                   TFAATASTIARKFFDGLAELKRDVKDDVIASELENAFEFFAQFISNERLMTPSERSGKS
FT                   S"
FT   CDS_pept        join(184061..184172,184213..184837,184905..185622)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212558" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944444"
FT                   /orf_name="Pc15g00750"
FT                   /product="Pc15g00750 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP82961.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="UniParc:UPI00018315C4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6M0"
FT                   /transl_table=1
FT                   /translation="MPILTIFIFSEILRSVRYKKVQSAAQTSDIFHLSALAGEPGLSQT
FT                   LIFWSSASSSFYLSCLDAPEPLRRAHLGAQRAKLGMVTKAAAVSHSLSSLSSLSSTSWT
FT                   SISKWIANISINQAPVQTARLRQPSTARPYHAAVWPSYGITTPVPDQPFVSPKSPFRFE
FT                   TGYALCAKRPSRPFPPPFLSPPSSSFSDPLTTHGLSQDKRLSVEGELVRGLNNGDDAII
FT                   VAENFIGVDDGVGAWATKPRGHAALWSRLLLHFWALEVEKNFDHHTPTLDPVGYLQYAY
FT                   EETLRATTSPTEWLGTTTSATAILHCTKERDGTQKPLLYVTNLGDCKILVIRPSEKKVL
FT                   FRTAEQWHWFDCPMQLGTNSVDTPRKDAVLSKIAVQEDDVVLALSDGVMDNLWEHEVLK
FT                   VVIDSIDKWEEGRAATKNAAQHPHLSDDRNVYVARELLNAALTIAQDPFAESPFMEKAV
FT                   EEGLAIEGGKMDDISVVIASCKKSDG"
FT   CDS_pept        join(complement(186351..186473),complement(186135..186166),
FT                   complement(185876..186067),complement(185737..185803))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976762"
FT                   /orf_name="Pc15g00760"
FT                   /product="Putative uncharacterized protein Pc15g00760 "
FT                   /protein_id="CAP82962.1"
FT                   /db_xref="UniParc:UPI00018315C5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6M1"
FT                   /transl_table=1
FT                   /translation="MVCVKYSRIECSKSQELLRRPKLFFILPGGSGGVLVRAGDEATRA
FT                   SNGIPHRNHQFGGLQQELKEFQCKFPAGYRVPDLMDDTTDGSMTMTSEAKQSCLALEHP
FT                   EICASPSQGVGGDVAGQAFCDGYEHFVLMLDRE"
FT   CDS_pept        join(186479..186566,186622..186711,186776..187572)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212592" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944445"
FT                   /orf_name="Pc15g00770"
FT                   /product="Pc15g00770 protein"
FT                   /protein_id="CAP82963.1"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="UniParc:UPI00018315C6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6M2"
FT                   /transl_table=1
FT                   /translation="MRAKRSKKYRKLMHQYELTFGFREAYQVLVDSNFLRATDSFKMEL
FT                   IPALERTVQGKVKPLLTKCSLAAIMAAQPINPKTEKPYRPLFLPPPTELPLRHCSHNAD
FT                   STPIDEVECLLSLLSPNPDSKKNKEHYILASADPIVRKTNNSENQPRRRKTEEDRKEEE
FT                   AMRRSHALRAGARSIPGVPIIYVKRSVMVLEPMSGPSEMVRDGHERGKFRAGLDVDPML
FT                   GKRKRDGEADGESADEAEPKKKRGPKVKAPNPLSVKKPKKKTEAPAPKKDKTARKEIAD
FT                   DTEQHDGGEAAAAKPKRKRRHAKSGPREDLEAAEPNEAMEVDA"
FT   CDS_pept        join(complement(188447..188480),complement(188081..188361))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212591" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944446"
FT                   /orf_name="Pc15g00780"
FT                   /product="Pc15g00780 protein"
FT                   /protein_id="CAP82964.1"
FT                   /db_xref="InterPro:IPR013892"
FT                   /db_xref="UniParc:UPI00018315C7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6M3"
FT                   /transl_table=1
FT                   /translation="MHSHLHTSYNANCEEIMTALDECHAKGFLHKALGNCNDIKVDVNK
FT                   CLSAERYQRAKRNRDEARSNRRRIEEIWAKERELDQGPAVPPAAAANVAAAANTGAAKQ
FT                   "
FT   CDS_pept        join(188706..188947,189001..190360)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212580" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976763"
FT                   /orf_name="Pc15g00790"
FT                   /product="Pc15g00790 protein"
FT                   /protein_id="CAP82965.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00018315C8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6M4"
FT                   /transl_table=1
FT                   /translation="MSSMITTTTWVRRGVAAQFPTKYEIDEAEMGRISKLARMQLEDAK
FT                   DDMNAAQDGSGDEADDAMEEDTEGKTSATNGTDSKDDDDVLKEFDMDNYDKEEVDDDGE
FT                   KVTMFGNVQSLAYHQPNEEDPYLVIPEDEDDEEREELQIMPHDNLLLAGKVEDEVAHLE
FT                   VYVYEDKADNLYVHHDIMLPGIPLCTEWLDIPVGKNPEGRTQGNFVAIGTMEPDIEIWD
FT                   LDVVDCMYPNAILGQGGQDAEKTKKKQKKKAKANDEYHIDAVLALAANRQHRNLLASAS
FT                   ADKTVKLWDLTTATCAKSYTNHKDKVCSLDWHPTESTILLSGSYDRTVVAADMRAPDAQ
FT                   ARWGVDADVECVRWDSHDPNFFYVTTDGGMVYRYDMRNIPTTPAESKPVWSLQAHDSSV
FT                   SSFDINRTIPGFLVTGSTDKTVKLWSVENDKPTLVVTRKLEVGKVFSANFAPDQEVSFR
FT                   LAVAGSKGNVQIWDASTNGAVRRAFVSRMPDLAGDVQERTVGINPDNDDSDDDEEVEGD
FT                   EGEPRGGDGWESMDED"
FT   CDS_pept        join(complement(192171..192368),complement(191686..192084),
FT                   complement(191486..191624),complement(191330..191430),
FT                   complement(191207..191255),complement(191077..191156))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212535" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670804"
FT                   /orf_name="Pc15g00800"
FT                   /product="Pc15g00800 protein"
FT                   /biological_process="regulation of actin filament
FT                   polymerization"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="CAP82966.1"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0030833"
FT                   /db_xref="InterPro:IPR007188"
FT                   /db_xref="UniParc:UPI00018315C9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6M5"
FT                   /transl_table=1
FT                   /translation="MLLLDYQNALIQSLLTERFSGYALFLPLSTATPRIVYRSPRSRHP
FT                   ANKLDSEHPPPPLTKWFPTSTYGAQEVLEREYGPYIVSPEPGYDFSVQVDLENLPAEEE
FT                   ARNVLIMKLALLKRNAMAAPFERAFDEFNKLAEEASRYTSESAPQGIQEGGEVMAIHYR
FT                   EEEAIYIKANWDRVTVIFSTVFREETDRIFGKVFLQEFVDARRRVLTLQNAPQVLFRND
FT                   PPLELANVPGLSAPGGEVSYVTFVLFPRHLTPQRRYENISHIQTFRDYFHYHIKASKAY
FT                   IHTRMRKRTADFLQVLNRARPENEERERKTASGRTFRVQG"
FT   CDS_pept        join(192541..192557,192616..192867,192930..195528)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000212524" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823581"
FT                   /orf_name="Pc15g00810"
FT                   /product="Pc15g00810 protein"
FT                   /protein_id="CAP82967.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00018315CA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6M6"
FT                   /transl_table=1
FT                   /translation="MVKSYFKFEHSNTFGLVASASSNAVWAKDDQTGIARQTGAGRAIV
FT                   GASEEVLCWDVKKGELLGRWRDSACRAQVTVVTQSMTDEDIFAVGYEDGSIRLWDSRTA
FT                   TVIISFNGHKSAVTKLAFDNAGVRLASGSKDTDIILWDLITETGLFRLRGHTDQITSLH
FT                   FLFPSPELLTASGLSEHSGFLLTTGKDALIKVWDLASQHCIETHVAQSNGECWSLGLSP
FT                   DQGGCITAGNDGELRVWSIDEAAMMEISREKVGADGRRILTERGTFYRHGKDRTIGIRF
FT                   HPRADYVGLHGSDKSVEVWRIRSQSEVQKSMARKKKRRKEKEARTEENGPEQDNDKPED
FT                   VSAAPVSEVFVQHVIVRTGGKVRSFDWMTNKSSGLNLLAATTNNQLEAYNVVPANKKNA
FT                   DSEDPDYTRSLAVDIPGHRTDIRSIALSSDDRMLASASNGTLKIWNVRTESCLRTLECG
FT                   YSLCSAFLPGDKIVVVGNKNGELEVFDIASSTLLDTIKAHDGPVWSLHVHPDGKSMVSG
FT                   SADKTAKFWNFQVVQEEIPGTKRTTPRLKLAHTRTLKVNDDILNLRFSPDARLLAVSLL
FT                   DNTVKVFFVDSLKLFLNLYGHKLPVLNMDISYDSKLIVTCSADKTVRLWGLDFGDCHKA
FT                   LLAHDDSIMAVAFVPHNKDGNGHNFFSASKDRNIKYWDGDKFEQIQRLVGHHGEIWALA
FT                   MSHTGDFIVSASHDKSIRIWQQTDEPLFLEEEREKEMEEAYDSTLTASLEQEDGEDGEK
FT                   AEAVDAGKQTTGTLMAGEKIMEALELGLEDLEVVRDWRRVKAVNPNAAPPDRNPVYLAL
FT                   NNVSAEQHVLNTVQKIPAAALQDALLVLPFSKLSALFTFLNIWADREWNVPLTCRVLFF
FT                   ILKTHHRQIVASKMMRPMLDSIRASLRRVLARQKDEMGFNLSALQFIGNQIREQSTTDY
FT                   VDEETWEEQQASKGTGKKRQFVSVA"
FT   sig_peptide     join(192541..192557,192616..192679)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6M6 "
FT   mat_peptide     join(192680..192867,192930..195525)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6M6 "
FT   CDS_pept        join(complement(197573..197856),complement(196489..197515))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212503" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670805"
FT                   /orf_name="Pc15g00820"
FT                   /product="Pc15g00820 protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP82968.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR013536"
FT                   /db_xref="UniParc:UPI00018315CB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6M7"
FT                   /transl_table=1
FT                   /translation="MRELDPLISEYRHEKKRPREAEALLILRKVASLVKPIMRQRAWKV
FT                   GALCEFYPQQRNLLGLNVNSGQKICLRLRYPSDQRQFLPIEQVIDTMLHELSHNVIGPH
FT                   NQQFHALWNQLRDEHEELARKGYTGEGFLSQGKRLGGQRIPLDEARRQARAAAEQRRVL
FT                   AKNSGKKLGGTRVLRGTDIRKLRADAAQRRIEVTQGCASGTDRSTELAEEASHGFRTQA
FT                   EEDDANERAIMEAFIELIQEEEREKYESSYVPPSQENPAGPRAESSPPPTASDIPPAIS
FT                   ESLPVLPKEAPSLDRNKAVDLTADNSSYETPWICPMCTLENPSTFLCCDVCAAERPPPT
FT                   NTLSTSTPGQDSTQPVHLESQNPKKRPLSIDRKEEKQTNPGDPFVFKNRTRALDTLKSL
FT                   DRGADKKPLGWVCISCSSFMETQWWTCSCCGTMKPSS"
FT   CDS_pept        join(198670..198702,198761..199100,199165..199328,
FT                   199382..200224)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212492" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823582"
FT                   /orf_name="Pc15g00830"
FT                   /product="Pc15g00830 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP82969.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR013952"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018315CC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6M8"
FT                   /transl_table=1
FT                   /translation="MTSDDQFFFDYLAAIPHDVRRYSLEVADSIDRQVDHAAHAIKDML
FT                   AQQSWLPPTVRPARVSPRNRPSQGLTDRIQSWMGRNRAFTAAILAFIGTGVVLYYGNKK
FT                   LHGKRRKARRASNGARKEIVVVAGSPHEPMTRAIAMDLERRGYIVYVTVSSADEEHIVK
FT                   AENRVDVKALWLDLTTTSSSPSEIHPSLQELRSLITQPQSPIAGVPPHTCQLSGLIVVP
FT                   SPNYSSGPVATIPPSSWADTVNTRLLSPILTVQAFLPLLTLRSNNSTIVFAYPSISSSL
FT                   SAPFAGPEVATARAISGFAASLRQELRLLEQGNVDVVELQLGNIDLGPTYRSGQNQIAG
FT                   TEVLAWSTQQRALYASQYLSSVEQRPVASAGPSTVRGSPARNLHYAILDALEPTSRDMF
FT                   GRKVSKKSVLYVGRGARSYSLIGAWVPSGLVALMMGYRSGNGMNSETPSGSGSETGWER
FT                   V"
FT   CDS_pept        join(complement(201122..201565),complement(200449..200904))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212481" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944447"
FT                   /orf_name="Pc15g00840"
FT                   /product="Pc15g00840 protein"
FT                   /protein_id="CAP82970.1"
FT                   /db_xref="UniParc:UPI00018315CD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6M9"
FT                   /transl_table=1
FT                   /translation="MPRLSLTSLFGVDPITDDEHHFETSWILPPAILVCLRGLISLYIF
FT                   VTIFIFWGWYGTHDNRASIGHSFSYFTWLSYWGIGFYMLFAAIHTACYARTGHSFLLDR
FT                   WPRAFRVLHSLLYVTVTTYPFLVTIVYWALLFAPPWKIFTGWQNISLHCLNSVYALLEI
FT                   VLPATAPHPFIAIPFLLLMLLLYLCVAYITHATEGWYPYSFLDVGDHGKKSILVMEYCF
FT                   GILAAVLVLFLVSWALIHLRRRLTHGKIKRARRDPLRAHDAFAGTCGGEQLNEMKSMPV
FT                   YGEVMGRFTSSGGNCLGG"
FT   CDS_pept        join(complement(204081..204153),complement(203837..204019),
FT                   complement(203102..203692),complement(202153..203036))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217031" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944448"
FT                   /orf_name="Pc15g00850"
FT                   /product="Pc15g00850 protein"
FT                   /protein_id="CAP82971.1"
FT                   /db_xref="UniParc:UPI00018315CE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6N0"
FT                   /transl_table=1
FT                   /translation="MNHLPPEILRQICLSVCHLAHSFSAFSRLNHTCYEIAAPLFYQRL
FT                   SIKFWDAQSLRKTVSELTEGGQGRQFVKHARNLSVICLNPGVLLLKGWSNYRQWERDWQ
FT                   PLAALVARLCHLAEIEFLVRNDFPISLQEAISQHHPKCQLKIFWPQNVTSSVPGLKNQT
FT                   CPRVRKIMSNDDFAGIDINLLRLEGLHTLSVQIPSRSDSKGRWVEIDEMLPFLLLAPNL
FT                   KHLLLRKSSTAHRLPVAMLKQEWHNLAVSTQPVPVSSLHSISIGESGPPENILLKLASI
FT                   AAGLLPNLERLSISTNGRGWRCPDLKSDDDIGVSAIRAFNPLVYLHLRGFRSAFSLNQI
FT                   VQRHGPSLKGLIIVPCIRDKGRTEEDSGYKYPELDAFGISQLAKSCPQLEELRLPIKRS
FT                   IGGQEECEMYKAVGGFSNLHSLVLDLHFDPRPRPVDPTHEVETSVLQKIFVNAAMDEKL
FT                   ALQIWHLISSNQASRRLQNLRVVPFGLEFLPNDEHRLLDWFSRSFLITRYNFQNVGVPT
FT                   IREIGKREREIINQSRFQGSDERSVPERLAQILSNVWPSEPVNGWESGRSSSPLQPNDA
FT                   "
FT   CDS_pept        complement(204698..205310)
FT                   /pseudo
FT                   /gene_family="HOG000035269" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(206819..208905,208962..209106)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212470" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976764"
FT                   /orf_name="Pc15g00870"
FT                   /product="Pc15g00870 protein"
FT                   /function="binding"
FT                   /protein_id="CAP82973.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00018315CF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6N1"
FT                   /transl_table=1
FT                   /translation="MDMRGKLGECRSISHDTLRSGSPRVAHFDGEVPPALSPLDAFAAQ
FT                   SRFLARQLDESRRGDRRMSRLPPSSVARSLSQGRPGFYRSKSSTESRTELTRQPTQKGL
FT                   PEYEEPKYRPISEHPRLSSISHASTEASYYEDDDNNATPRTTMLNTGSEAYGMPRAESP
FT                   EDLAQRVSEAEGAPVGVAVAEPQGSSMDSPTSRLDIPRTLAPPVSPRSRPSSSAKVAHP
FT                   ESSDDDYSSSNAGSTFSNARKLSSGSAVSLPYSPMSTFPARPHPRSPSLSSETSGTGAN
FT                   QLPRPSFNFSRPLSRSSTSLSAPGATTPTEPILPSGSNHMYRRSKPTPLLLQTEDAAET
FT                   PANDGEPSSAVSSYVYAKYALPRGRFLSRDSVVFAGLQTPHFEWEEPLFEKTPPRNTEE
FT                   PRMARTPSPTPNRQFEHSPKPHSMYEVPASKPRSPTPTFQPQSPPQSPPQPQSPPQLQP
FT                   QTPKSQQVPQPLPVPLSPAEAARRPSAESTRQTTNEKDETVSSAGSASTMRPQTANPQV
FT                   TASGLTADDHVAKGIECHERGSLSESTYHLRVAAKQDHPTGMLLYALACRHGWGMRSNE
FT                   KEGVRWLRKAVDSVGLEMLADPDAPGASKAKELQKAYRVQFALSIYELGVSYLNGWGIE
FT                   QDKSLALRCFEIAGQWGDVDAMAEAGFCYAEGVGCKKDMKKAARFYRQAESKGMSMVGN
FT                   SWIYKDKYNEVESAGRSRGRNAGEKDKKPRSKSRTRSIFQRKKSNVSEA"
FT   CDS_pept        join(210608..210768,210859..211274,211349..211470,
FT                   211525..211842)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212459" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127865"
FT                   /orf_name="Pc15g00880"
FT                   /product="Pc15g00880 protein"
FT                   /protein_id="CAP82974.1"
FT                   /db_xref="InterPro:IPR022185"
FT                   /db_xref="UniParc:UPI00018315D0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6N2"
FT                   /transl_table=1
FT                   /translation="MSTTKPSFVEEESSVTPTPTKKSFGARLAAHFKKWWWVHLIIFIA
FT                   CFLIILLPVVYVAYPKIAQDAVNDSTLDIREMIISDPTPESFHLEQRQVLGSDSPYHPK
FT                   IYKFNSAVSLAGADPFAYVEVPEVKSKDGVEIHFEQKVDLTDASAFGDYTTAVMLNEEV
FT                   SLNIYGRPDLKQGGLPKVTVDYNKTVVMKGLNQLKGFEVAEFSIMFPPVNGYGMNGTVI
FT                   IPNASVMTIPMGNVTLKLELDGRPVGTTYLNNLVLKPGNNTVPMMGKVDQGAIITLLTS
FT                   DTNPYKDGVLPFDITGTATSYNGKELPYFTKALAAITLHVKLDVGAALAKAGIKLTL"
FT   CDS_pept        join(complement(212883..212960),complement(212500..212698),
FT                   complement(212200..212429))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127866"
FT                   /orf_name="Pc15g00890"
FT                   /product="Putative uncharacterized protein Pc15g00890 "
FT                   /protein_id="CAP82975.1"
FT                   /db_xref="UniParc:UPI00018315D1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6N3"
FT                   /transl_table=1
FT                   /translation="MAVPRGYTRVLEQSSETEAEKEGKLPRIHSRPHGRLRLSSICDAQ
FT                   STTLQTCRQYPLGHGNDPDLAQKRFPKEFKFANGSDSMSHNVLVSDCWICVLLGTSTSF
FT                   HPARTAIFNILQKPRDIQAKAFYTALDRTIELHCGGQQSDDASVRFGRYFASSAEERLA
FT                   RTLSF"
FT   CDS_pept        join(complement(215284..215350),complement(214419..215224))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076642" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670806"
FT                   /orf_name="Pc15g00900"
FT                   /product="Pc15g00900 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP82976.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI00018316BB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6N4"
FT                   /transl_table=1
FT                   /translation="MAAVQVCDAILEGMKDKVVLITGGASGIGKATAELCLKHGATVII
FT                   GDLNSLPSDLETSENLKFIQLDVCSWESQLAAFLQVEDWFGRIDHVFANAGIGPTTDFL
FT                   NDNLDENGHLTPPDLRTINVNLLGVISTVRLAAYYIQKNSAHRASGELGSIVVNASTAS
FT                   FQNFSAGDYTVTKHGVLGLIHGIGHQLEGKVRLNAVAPSWTASKMIDAAFIEGLGVGVQ
FT                   GPEVVAKSVALLFNDQQRHGDVIYSWEGKYREVNKAEGGFLAAADGILVNSANEEYVVK
FT                   KLREAKMIG"
FT   CDS_pept        join(complement(216641..217480),complement(216135..216569))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179043" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670807"
FT                   /orf_name="Pc15g00910"
FT                   /product="Pc15g00910 protein"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP82977.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI00018316BC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6N5"
FT                   /transl_table=1
FT                   /translation="MSRKPTITIIDGGIGGLALAAGLHLRKVPVQIYEAAPSFKGIGLG
FT                   ISLGPAAYRAMPLIHPAIQQIYNSLITTHADSPGYEEYLQTWFELVWATGPQEGNVLMN
FT                   LKALPSGQTALRRADFLNALVDLIPSDIVHFGKRVNTVVEHDDRVVLGFEDGDVVDADV
FT                   VVGCDGIRSRVKECMMPVESLRTKPVYSGMYGYRAVLEMGDMVKAVGEKRAHVATIYLG
FT                   RGVYALSYPIMRGRLVNIGIYVLSSQPWEYDSWVRPARREDIERDTRDMGRYVKALVEH
FT                   MPDPSQWAIFEHPHISTYARSRIAILGDAAHASTPHQGAGAGQAIEDAHVLAELLGDSR
FT                   VSSVDDVVAAFKAYDEVRRPRSQRVVTSSKENADIFCLCCDGVRDDPVKLRETLDQRLK
FT                   WLWDLDVQDQVERAREKMVEYLEIG"
FT   CDS_pept        join(217670..217767,217849..217978,218076..218198)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944449"
FT                   /orf_name="Pc15g00920"
FT                   /product="Putative uncharacterized protein Pc15g00920 "
FT                   /protein_id="CAP82978.1"
FT                   /db_xref="UniParc:UPI00018316BD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6N6"
FT                   /transl_table=1
FT                   /translation="MTVCPTSGSQIEGDNLFEYRTFAMEDDGLDRRHAQHGRRGLHHRE
FT                   GIGMDAVYRDRLEGEKYMLTLNLEGYKIVPIRGDLGRSRDPVAGIPLVPKWRIDICRRT
FT                   DKPEVHRTVRAV"
FT   CDS_pept        complement(218283..219911)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944450"
FT                   /orf_name="Pc15g00930"
FT                   /product="Pc15g00930 protein"
FT                   /protein_id="CAP82979.1"
FT                   /db_xref="UniParc:UPI00018316BE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6N7"
FT                   /transl_table=1
FT                   /translation="MSRNPPRSIASAGSESVGSLQRSSARGERSASNPALYMGDNDDTA
FT                   LPSMEFHSHHPQPSIAHRRTGSTLKTVMRKIFNRKRQSQADELEENPYESTFPATPMRK
FT                   SVPTKGRSMLAAPPPLNLNSHRSSPLSAENLQIAETHLSPLSPLFSPTLRDSMPGGMPR
FT                   RRRATLPSVVFSDDESRFAVASAISDPQEDRSHAPERRHSLLSHRLSRSTDALREITDN
FT                   LPETLVSWPQRTSSAPPRPASVPGSRSPPLDESSNSGQSGRPSSGTTVTSVTRMSAAPS
FT                   LMEVEEHAEQPSLPSNVASLVNTMQQDDSVTLEERLTTLEVKLIDLEFAIARLQTNSPE
FT                   NPTEKLSRPRHPPSSDSFPPHMRNKPSAFLSTSDRDESPSPLPTISARPSSTSTIRADT
FT                   MTPRTLRPAPSATSLSDYHGVSIEQYSTLVTLLRREQTARRNLETQVGGLRDDIRDLQR
FT                   AALESMQSGMGMMQPGHTAESRQFLRFRRALDDSDISPALRSDDKHAGIADSDSDWDRS
FT                   DIYSRDDPFGPPKWERQRVVTAPMI"
FT   CDS_pept        join(complement(222758..223317),complement(221249..222693),
FT                   complement(221096..221156),complement(220935..221019))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185831" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944451"
FT                   /orf_name="Pc15g00940"
FT                   /product="Pc15g00940 protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAP82980.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004483"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="UniParc:UPI00018316BF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6N8"
FT                   /transl_table=1
FT                   /translation="MPPPTPIPIPLFASTQLNLLHEEHAAEVSSSKLASTAATVSPSTR
FT                   RTLQATGYALTGLILSQCRTGLGGRVVGEFAPDPAVASEESRAADGTPRLGSHGIRVGD
FT                   VVRVSDVTGPGKKVGKDKDKEKEKDAEKGVEGVVTRTGDRAVWIAFGRQGGGGMSKEDD
FT                   EAVGELWGKKVWAIKLANDVTYRRMRQTMEKMVKMSESEYSHFMRVAFGHTTPLQLDTE
FT                   ACGPVEFTDPSLNDSQKEAIQFALASRDIALIHGPPGTGKTHTLIELILQLVQRRKRVL
FT                   VCGPSNVSVDNIVERLAPKKVPVVRIGHPARLLPSVLEHSLEVLTQTSDAGGIVKDIRK
FT                   EIDEKQASIRKTRSGRERRGIYDDLKLLRKEFRERESKCVDNLVRESSVVLATLHGAGG
FT                   HQLKNQKFDVVIIDEASQALEAQCWIPLLGADKVVLAGDHLQLPPTVKSTGQNSKDQTS
FT                   KGTEEKTGNNTDTETLKGVSLERTLFDRLLALHGPGIKRMLTTQYRMHEKIMRFPSDEL
FT                   YEEKLMASDAVKARLLIDLPYEVEGTDDTQEPLVFWDTQGGDFPEKAEDEISQKGALLG
FT                   DSKSNEMEAMVVARHVDNLIDAGIRPESIAVITPYNGQLALLSRMLREKYAGLELGSVD
FT                   GFQGREKEAVVVSLVRSNAEHEVGFLGEKRRLNVAMTRPKRHLCICGDSETISHGSSFL
FT                   KHWMNFLEENADLRYPDAGDLL"
FT   CDS_pept        join(complement(225228..225465),complement(223852..225140))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944452"
FT                   /orf_name="Pc15g00950"
FT                   /product="Pc15g00950 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP82981.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00018316C0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6N9"
FT                   /transl_table=1
FT                   /translation="MVTRGLWNLQINGILTSDAKSIQVCLPCVAGKWFRYCHPQARTSS
FT                   PGDEATFQKIKQLQEAKNKPDGWEEVSFPSPPHSVFRIKLAEVHEAPDLSFESLLQKAS
FT                   RPLERTLNLTSGKQTEHIVSGDLEINFDAPTPLNELQFRFFTDFIFQWRFYIDDHTLWQ
FT                   YPSTLLNTLVIAVLRLAAWDLEITHEDIDSRVELPIGFRSVPGWDSPETHIFWFHGFLV
FT                   VICDTLDTNSSVTAAVLRAKTLLNGYSRVSQKARLILVSLRHVQFVELSPEFVGRSEVL
FT                   PLVVNTSAEQCSPGFRALTHVLSSSCWKESLAHRERWGINMPPEIFDMILRALTPRDIL
FT                   SFCRSSLAVERWYYSSVPQFGDFRVRHFDSSVPCCGQLDAMDAAVCCSLCYVWKHTKCI
FT                   GLACTPPGRRYICPDCHEKKDRQCLVPGGINETSGRKWRGPGCRIRVAGHPKILELRLS
FT                   LPTHLRPERRLLGTLDRAPSLFINYAIRFGGAFSGLAYGLDEDLCQTENS"
FT   CDS_pept        complement(227150..228436)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000252209" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944453"
FT                   /orf_name="Pc15g00960"
FT                   /product="Pc15g00960 protein"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /biological_process="base-excision repair"
FT                   /protein_id="CAP82982.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniParc:UPI00018316C1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6P0"
FT                   /transl_table=1
FT                   /translation="MRTSRTSRDTAKVLQALSAPIGRQTRNSNASALNSFAYKANAIPT
FT                   IKTELESEDVSATSSLSAVKSDDESSLSELSEADTADIEDLLEPPLKRQKRNASPIIPR
FT                   VLKQSPNPRTSRKVTVKDEPDQKSTPAPKQRRLPARKTRDIDGSVKVEPPSNWEKMYGI
FT                   VQEMRKDGPAADAPVDTMGCSQLFWRASSPIDRRFQTLVALMLSSQTKDTVTAVAMQRL
FT                   HTELGDGTAPAQDIKIKQEDDDSKTVDSTLNLNNILSVDPTRLNELIRTVGFHNNKTKY
FT                   IKATALILRDQHGGDIPSTPEGLMALPGVGPKMAYLCMSAAWGEHVGIGVDVHVHRITN
FT                   LWGWNKTKTPEETREALQSWLPRNKWHEINHLLVGLGQTVCLPVKRRCGDCELARLRLC
FT                   KSEIRGLKPTMKVKQSPEVDEPKVKIEAL"
FT   CDS_pept        join(228630..228801,228865..229187)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127867"
FT                   /orf_name="Pc15g00970"
FT                   /product="Ubiquitin conjugating enzyme Pex4-Penicillium
FT                   chrysogenum"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAP82983.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0000F57AD6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6P1"
FT                   /transl_table=1
FT                   /translation="MASRTRGIDTRQRLMKELKAYNKEGENETFLYLRPVNDEDLLHWE
FT                   AVLKGPAASPYEGGLWGLDIRIPSDYPYAPPTIHFTTKIAHPNIAWSTGEICSSLNNDW
FT                   KPTVNLSGILAAIQLLLTVPDPDSPLNPDIAVLMRNGDLAGWESVVRYWTEEERWQGVR
FT                   W"
FT   CDS_pept        complement(229828..230730)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944454"
FT                   /orf_name="Pc15g00980"
FT                   /product="Pc15g00980 protein"
FT                   /protein_id="CAP82984.1"
FT                   /db_xref="UniParc:UPI00018316C2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6P2"
FT                   /transl_table=1
FT                   /translation="MLRISLLQLLFVTLLGLSAVFAADAVQGTSQRESPQEIADINAAS
FT                   LHGALHALSAKFRHGIFPTDLDAAEALQGEEPTIASLIKLAKRQDNATASSAAPVPTVT
FT                   TAPEPTSEPATSSAVETSETSSESSVEPTTSAQPTETSASSTSETSASSTSSASVPTET
FT                   SSTVSTQTTPQPTTATTTSSTAQTTKSETTSVPSTLSTTKSTSSTTSTTTHKTTTSART
FT                   TEHTSLTTSTSKSTTTMPDGSQSTITSITVITPEATGSPSGTAAGKPGLQTNAAALPTG
FT                   MAREIVAMVGGAVVVAMAL"
FT   mat_peptide     complement(229831..230664)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6P2 "
FT   sig_peptide     complement(230665..230730)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6P2 "
FT   CDS_pept        join(complement(232529..232674),complement(232352..232477),
FT                   complement(232161..232283),complement(231400..232108))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000158828" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944455"
FT                   /orf_name="Pc15g00990"
FT                   /product="Pc15g00990 protein"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP82985.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR002227"
FT                   /db_xref="InterPro:IPR008922"
FT                   /db_xref="UniParc:UPI00018316C3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6P3"
FT                   /transl_table=1
FT                   /translation="MIGFYQSFLVITFGVLVSAANFSLFGITIDIPLPERPCGNHNRDV
FT                   RKEWGELKRAERIDYTNAVLCMQGKPQHLPREEYPGVRNRFDDFVATHINYTLNVHLSG
FT                   LFLPWHRHFLWLWEKALREECDYPGHLPYWNWPLWSENLKASPLFDCSDSSLSGDGEYN
FT                   PGEQSLSGGAVTIPRGTGGGCVRCGPFKDMQIHMGPFDRNIVSFAKLPAPGFDYNPRCL
FT                   NRSLNNFVSSNYDNETIVDRLLAAPNMSDFQTIMDYWPARPKGVLGVHGGGHFSLGATL
FT                   QDLFTSPQDPAFMLHHGMIDRLWSMWQAKDEDHRRFALNGTSMLLNPPNATLVTVDMEM
FT                   EFGVLDRPRSVGEVMDPTRYGYCYSYS"
FT   mat_peptide     join(complement(232529..232617),complement(232352..232477),
FT                   complement(232161..232283),complement(231403..232108))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6P3 "
FT   sig_peptide     complement(232618..232674)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6P3 "
FT   CDS_pept        235192..235614
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18976765"
FT                   /orf_name="Pc15g01000"
FT                   /product="Pc15g01000 protein"
FT                   /protein_id="CAP82986.1"
FT                   /db_xref="UniParc:UPI00018316C4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6P4"
FT                   /transl_table=1
FT                   /translation="MPSWTIRKLVSLRDDDSVTIKAHAEGLAHKVAYGGSITVKIHTPP
FT                   LEADVAENIAEVRAEWSFGSPFIPTEQAWDLLVMNAMVDRRTGFISLDEPRPSHGRSPF
FT                   RRAMKSNNTSTVVSQVQNEEGFKHTVQQYSKWGSDT"
FT   CDS_pept        237384..238169
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000038020" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944456"
FT                   /orf_name="Pc15g01010"
FT                   /product="Pc15g01010 protein"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="CAP82987.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI00018316C5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6P5"
FT                   /transl_table=1
FT                   /translation="MDAIKGSLDQVLLQTTASWAHIVGKYSPQKIEFVGTLVAQVLTFW
FT                   LPSICYMLLEVIAPSFSERHKIQPAPKQPTRREIARCFMVVVQNQIIASILHLTLLSAA
FT                   SHAGMNSTYRIETSLPGPVEILRDVFLSLLMREVLFYYSHRILHIPSLYIPIHKKHHRF
FT                   TAPIALAAQFAHPIEHIFANTLPISLPPQLLGSHIVTFWIFLAYELVNTATVHSGYDFF
FT                   WYKARAHDLHHEKFNLNYGSLGLLDWVHGTDKLKKHRTV"
FT   CDS_pept        join(complement(238918..238982),complement(238662..238737),
FT                   complement(238240..238557))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127868"
FT                   /orf_name="Pc15g01020"
FT                   /product="Putative uncharacterized protein Pc15g01020 "
FT                   /protein_id="CAP82988.1"
FT                   /db_xref="UniParc:UPI00018316C6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6P6"
FT                   /transl_table=1
FT                   /translation="MGFQPLSIHRPETLDLTVPRPPYKLHPQARPPDPWSSPATWLGIS
FT                   LQPTFTILQSFTAFPNHFCQEQQPWNHGSHCLRNLGTSGYLTWEQPWKAALSEFVVCRL
FT                   PLGIDVKEGTEGTEGNEEVTKRGRKERSRTPYTGQIHGASLAAPILPR"
FT   CDS_pept        239744..241120
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000164982" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823583"
FT                   /orf_name="Pc15g01030"
FT                   /product="Pc15g01030 protein"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP82989.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00018316C7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6P7"
FT                   /transl_table=1
FT                   /translation="MKSSVASMATAITMGASTVLGAATNLKARESDITPITVKGNAFFK
FT                   GDERFYMRGVDYQPGGSSDLADPIADVEGCKRDIKNFKELGLNTIRVYSVDNSKDHDEC
FT                   MNALAEAGIYLVLDVNTPKYSLNRAEPEMSYNDVYLQYIFATMEKFAKYDNTLAFFSGN
FT                   EVINDGPSSKAAPYVKAVTRDMRTFLRARKLREVPVGYSAADVDTNRLEMAEYMNCGTD
FT                   DERSDFFAFNDYSWCDPSSFTTSGWDQKVKNFTGYGLPLFLSEYGCNTNKREWQEVKAL
FT                   YSTKMTPVYSGGLVYEYSEAGNKYGLAKIDGDKVTTNKDYDALKKAFEATENPSGNGGY
FT                   NSTGGASGCPKMQKPNWDVDSDSLPAMPKPAKKYLTEGAGKGDGFAGKGSQNAGTKSSG
FT                   TATQGSGEVSSATGGSAASGTSSEGAAASLKPFQFSFAPVTVGLVTVVSTVFGASFVLL
FT                   "
FT   sig_peptide     239744..239806
FT                   /db_xref="UniProtKB/TrEMBL:B6H6P7 "
FT   mat_peptide     239807..241117
FT                   /db_xref="UniProtKB/TrEMBL:B6H6P7 "
FT   CDS_pept        join(complement(241877..243147),complement(241704..241743),
FT                   complement(241619..241637),complement(241194..241252))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127869"
FT                   /orf_name="Pc15g01040"
FT                   /product="Putative uncharacterized protein Pc15g01040 "
FT                   /protein_id="CAP82990.1"
FT                   /db_xref="UniParc:UPI00018316C8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6P8"
FT                   /transl_table=1
FT                   /translation="MAITRAAFKKLLHRRRPTDDENEEEITPPPTQSGATVDTAPVETP
FT                   ATLTPESQKRRRGGEDGAGDDEKSKDTRGLKRARRTISERSSARSSLQINPATPSPEPA
FT                   EQYPGTGAPELEASPRTPRMRMTRASASMSASFNTDLIPILQSTPTRDEVRAFEERGIE
FT                   FENRMADNQNSSPSKALLSKLTVDDLTRATARTPALFKIWETSSRPAPEEITLGLESAG
FT                   LPDANYRHSILQNDILTKVSSYEHYTISGAIIAKKIFRESGPHWNEIALALYKHHHNID
FT                   TLRYVFMLHVKNDETLPLVGKMIYKSDGVAGGPEDRSGPPTTQTWDKGTGRFRRILGTQ
FT                   LGRAVGFLVLAAWPAGTHQISRILTWFIGGKLHMRFDIDKIGSSRASGSSRASGSGQAS
FT                   GSGRPSGSGRPSGSGEASGSGRARKISIHARSSREHVSGLTYKRQRISPQFAKPKRQLS
FT                   QGKR"
FT   CDS_pept        join(complement(244127..244309),complement(243966..244029),
FT                   complement(243698..243876))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944457"
FT                   /orf_name="Pc15g01050"
FT                   /product="Putative uncharacterized protein Pc15g01050 "
FT                   /protein_id="CAP82991.1"
FT                   /db_xref="UniParc:UPI00018316C9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6P9"
FT                   /transl_table=1
FT                   /translation="MTLAYSELSSTTEGIFSLNFSPASVQRVDAAPVAAKNPPLYGAAT
FT                   SRLRLGPGNKAGSILPLRGLKLSLVLEPIDGMLFGINPSCFVTSTIDDKVSRPHRDVAN
FT                   AGSWAFAVASAATLRSFQQNRSSKTSLLILMAMRMNL"
FT   CDS_pept        join(complement(245465..246165),complement(244784..245406),
FT                   complement(244655..244748),complement(244520..244556))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234686" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944458"
FT                   /orf_name="Pc15g01060"
FT                   /product="Pc15g01060 protein"
FT                   /protein_id="CAP82992.1"
FT                   /db_xref="UniParc:UPI00018316CA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Q0"
FT                   /transl_table=1
FT                   /translation="MGRLHQAGRPASSSHSLHSFDDAPPPYTDNTEPIIAPDQYVRPIQ
FT                   PAQPPTNIRPLRLIDSAYVLPGSENAKPRDKVSLTLDPALSSDCDRLYNVISRQMKLPP
FT                   RPLLYIHGTHTEVRKGEKKDEYYTVTDFCFALDLAETMLTGWEGDHMGANWRKVQILTD
FT                   EDVTPAYRGGILRSSTYTLPKSRAAISLSGDTEAILARNNADEQNNTSSLDAKNLMMWC
FT                   ERFCRDPAPVKSFTMHREVRGFNSNAMRNVLSSHIRELNYHGSIGFSLVISQGSVTIYS
FT                   PHWINRLRMNSFVWWAVVILQLWIITWPVIFFMEKRYEVVHTRWNASLVPESDSPLAKC
FT                   YPFGRDESSLAEYWAPAVKQAAWTRRHGEGNLLTRMDADRLQGHSTRQLLGLRGASSDT
FT                   ERERRERVNNGEAGFADNVVGLVRGLGEVGQDWRFSAGWGGNRCYGVVGRMMSLELDVV
FT                   IACFSLRKVLQANERYMPWVLLCIVK"
FT   CDS_pept        join(complement(247930..248019),complement(247362..247865),
FT                   complement(246420..247304))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823584"
FT                   /orf_name="Pc15g01070"
FT                   /product="Pc15g01070 protein"
FT                   /function="chitin binding"
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="CAP82993.1"
FT                   /db_xref="GO:0008061"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="InterPro:IPR001002"
FT                   /db_xref="InterPro:IPR002482"
FT                   /db_xref="InterPro:IPR018371"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniParc:UPI000183179B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Q1"
FT                   /transl_table=1
FT                   /translation="MGSFQMSIFLALCGLGLIHGTVALSVAARESKPTAGRAVYTYPYT
FT                   CPSILVGNEDTCDDLALKCGISAASFTSFNPDTACSSLPRGKPVCCATGTHTIPPDGGG
FT                   NCYAYTIRYGDTCKKIAEGYKITVANIETWNINTTAWYGCNKLQEGGQVCLSAGDPLMP
FT                   VAIAGAVCGPQVPGTARPLRGIGIAALNPCPAGQCCSTRGQCGTGPDFCGSSAPAPAAP
FT                   PTPETKAKSAKTTSATSKATSAASTTKPVTLTAKDVASTTKNKNPHFFTTDIPLVDVPL
FT                   TYLHATTSMPAADSTSTTTTAVGTDTGFLIVAHKISMLASRLREASTSTTKTTSSTTSE
FT                   TSTTKSSPASATQTVDGIVNIQNGWSLKMYDGIGCTGSYVLLQGHNKYLEDSDCMQFGK
FT                   GSKLETLVKDTAVSCHSWTIPESGNWEWTDCHKDSLDNPTSWRMSNGLCTVSPNDKCDL
FT                   VNDISQTYGWRGPGLCQDRQLMDPKFGSMKCYVG"
FT   mat_peptide     join(complement(247930..247950),complement(247362..247865),
FT                   complement(246423..247304))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Q1 "
FT   sig_peptide     complement(247951..248019)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Q1 "
FT   CDS_pept        join(250239..250250,250318..250340,250408..250441,
FT                   250502..250744,250796..250915)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823585"
FT                   /orf_name="Pc15g01080"
FT                   /product="Putative uncharacterized protein Pc15g01080 "
FT                   /protein_id="CAP82994.1"
FT                   /db_xref="UniParc:UPI000183179C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Q2"
FT                   /transl_table=1
FT                   /translation="MNFFYGNNNPQSSQRLLHKPCETVPEGIEGNRVELLACLSWAEQF
FT                   WMNTEGGFGLGEEGESEFLLPRDLIDGVAASVRHLVASFDNFTKAHRRGHPLAGTKLSQ
FT                   STKDAYAGWVSSRSSLESRIKQPPLPSVYSKPGSRSQRS"
FT   CDS_pept        join(251735..252651,252733..252938,253000..253094)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823586"
FT                   /orf_name="Pc15g01090"
FT                   /product="Pc15g01090 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP82995.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000183179D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Q3"
FT                   /transl_table=1
FT                   /translation="MASNQDISNQGISNQDVTEDFSDAFVQDVPKQDVYPHKRAPSNRA
FT                   AWLTGRSARPLMVCAAPYTPPSPHQIVVKNGAVAINTVECTKQLEGNMMAPRIKYPFVL
FT                   GNDCAGEVVQVGDMVSRFKVGDRVLAHALSMDPAVNKSSEGAFQHYTVINDNMAATIPD
FT                   WLSFEEACVVPLGFSTAATALFHEDYLNLNRPGVPLGTGPDWLPEVVLVWGGSTSVGCN
FT                   AIQLAAAAGYEVIATCAPNNFQYITSLGASAVFDNRDVFSVFSIIELCHHKRVVGAIAI
FT                   GKNSTEPCMAILARSIGSKLVARAKIKIWTKRCGVKTKFISDTSAAHTELGAMVYNEFL
FT                   PGALAAGVFVAAPKPRVVGKGLDRIQSAMDCHMRVHGVDCLIVSSRTSLVKQPSKSPGA
FT                   ALIFLA"
FT   CDS_pept        join(complement(255423..255452),complement(255213..255369),
FT                   complement(254918..255164),complement(254351..254867),
FT                   complement(253816..254283),complement(253444..253749))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161945" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670808"
FT                   /orf_name="Pc15g01100"
FT                   /product="Pc15g01100 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP82996.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000183179E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Q4"
FT                   /transl_table=1
FT                   /translation="MSGSRQQPGLACEECRKKKLRCNRRRPQCDQCEDSGTACLLNQVR
FT                   SPRGPKKGHLKALRNRIATLESIINCDQGNLGPKEVLDGNEKYNDETAQMLSPPQDYIP
FT                   NVTKTECHDIPYSIDASAITSPIIPMTPPNNESSDMIEADLDQLYFDRVHPVAPMLHQG
FT                   RYFSWSQRFNKPPSYICLQFAMWALAAASSAHLQHMRESLYTRARSGIEALDRDIESSS
FT                   AACLQAAQTWLLLTHYEFRYMGYRRAWLTAGRAFRIIQLAKLHEIDRLNDVSMNMAHPE
FT                   AWAEAEEKRRTYWLAYCLDRFLNISEEWPLSLHEEALCVYLPVSESDFQHSRPVIMDSL
FT                   YDEIETSGQKMLPPFAETIVLITLCWHSVAFQRAAHGGKTSPSDGDTWKRHTRLYQMVQ
FT                   QRLMLVSLPPSSPELHDPMRLFTNMLANAAVIWFYNIMEALQVEINDEIILVPLYSAYE
FT                   IVGLAKPLTRSSFFKAHAFSPMLLYLSAKFLKAHADQLSTCLSASEDNHQKLEDLRKAL
FT                   RVLQGGNNLAMSYLELLDSDSESLHKLCNLSTVQGCTMSEVTGQPEPPFFLDIMNLF"
FT   CDS_pept        join(complement(260588..260775),complement(260409..260518),
FT                   complement(259855..260337),complement(259280..259797),
FT                   complement(258301..259218))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225953" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944459"
FT                   /orf_name="Pc15g01110"
FT                   /product="Pc15g01110 protein"
FT                   /function="transketolase activity"
FT                   /protein_id="CAP82997.1"
FT                   /db_xref="GO:0004802"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="UniParc:UPI000183179F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Q5"
FT                   /transl_table=1
FT                   /translation="MAPALELLEKPAQYLPVKAVSAIGKGDATGLRLESPEKHERVMNV
FT                   FRAFIADLCQQYGEGHAGSPMGMVAIGISLYKYVMKYSPNNCNYFNRDRFVLSNGHACL
FT                   WQYLFMHLVGVKSMTLEQLKSYHSSKLDSVCPGHPEIENEGIEVTTGPLGQGLASAVGL
FT                   AMATKNLAATYNKPGHELVNNMTWCMVGDACLQEGVGLEALSLAGHWKLNNLCVIFDNN
FT                   SVTCDGTADIANTEDINTKMRATGFNVVDVYNGNSDVAEITNALLAAKLSDKPTFLNVR
FT                   TTIGYGAAKAGTADIHGAALGVEEVANFKRRFGLNPDEHFHIPQDVYDFFSDIPGRGDA
FT                   HEAGWQNALVKYQNEDPALAAEFALRVAGKMPEDWTKCIPRTEDQPTAPTATRKSAGIV
FT                   TNNLAVNINSVLVGTADLTPSVNVAYKNKVDFQSPELQTACGLNGNYSGRYIHYGIREH
FT                   AMCSISNGLSAFNKGTFIPMTSTYFVFHLYAAAGVRMAALQGLQQIHIATHDSIGVGEN
FT                   GPTHQPIAVAALYRAMPNVLYIRPCDAEEVAGAYIAAIQATETPTVISLSRQSLTQYPK
FT                   NSSREGTLKGAYVFAEAEGDDFDVSLIGVGSEMGFAMQTRELLLNEHGIRARVLSFPCT
FT                   RLFEQQSREYKQSVLKSRAGKPTVVIEAYPSNGWERYADASVSMNSFGKSLPSKETYEH
FT                   FGFAPESIAPKVKGLVEEVRRDGIGILRGDFRDFNGSLRIGVEH"
FT   CDS_pept        join(261885..261988,262056..263877)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234692" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944460"
FT                   /orf_name="Pc15g01120"
FT                   /product="Pc15g01120 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP82998.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00018317A0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Q6"
FT                   /transl_table=1
FT                   /translation="MPVTNAKESEGHATGTRRRRVRLSRARGLRTKTGCLTCRERRVKC
FT                   DDGKPTCVRCSKSNRSCRYAQVGDQGHATGPRAEFESLRAQSDLREERNEDSRSGRSDT
FT                   NVADVIQGDLHSSQGQQPSSGPAPYFQDTCPAPAEAFAPLQNNGSSETPLNDCLDNDQR
FT                   LSSIDSSFLGSPLSLSQIPLLNISPGEWFDLVARDAINNIQRLNDSSTGDPRWKFPEIA
FT                   LSRRQSPAPECPETQSEQAERHPDPQRLGLERRDGGIESPLLDYHQLPQPWNTTSRIEL
FT                   STLDLKFFRYFIDIVGPILDLFDPARHFTNVVPHLALRNTGLLRSLLAVGAKHMSLGLM
FT                   PGRGERASGEHATQNANTPASLAAVTHLPSESDPAPVHIATQYYYETLQYLSQTLLYPP
FT                   YAESREILATATMISMYEMFDADNASTSGDWEQHLRGSFWIQRSQDNDGESVDGLRRAV
FT                   WWAWLRQDIWAAFQTGRPTLTFWRARKKLEELDSDELATRIVYICGKCVEYAASDGMSA
FT                   NKDPRHRTHQGDRLLRALDDWHNVLPASYQPVTVATDSGSNTVFPSIWIHPPNHAGAMQ
FT                   MYHFARATVLLNQPSMGGLNAYCLREKQLSESVKVVCGIANACQEHEPAIAFVNVQALF
FT                   GGKCLS"
FT   CDS_pept        complement(264268..265134)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18976766"
FT                   /orf_name="Pc15g01130"
FT                   /product="Pc15g01130 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP82999.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018317A1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Q7"
FT                   /transl_table=1
FT                   /translation="MPPSIQDTTTGAPVAEVAAPAPAFLDTQPGPDHDWRITLKDKVIA
FT                   ITGANRGIGLAIAEVCLANEAAAIFSLDVFEPGEEFVALQNANPKRLSYVHCDVTSEES
FT                   VNTAIDAVISARGAIHGFIANAGMTKHQPALDFSRAQLDQLFNLNVFGAYFCATTVARR
FT                   FIELGIKGSIVFTASMTSYRPNRAAPSAPYGATKGAVRNMTHTLAMEWAKHGIRVNSIS
FT                   PGFIKTAMTYFVNQAPDWNLKMQYYGGMPRLADPKELGGAYVYLLSDGASYTTGIDIPV
FT                   AGIVGAW"
FT   CDS_pept        join(266303..266484,266555..266671,266737..267295,
FT                   267356..267766,267827..267958)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670809"
FT                   /orf_name="Pc15g01140"
FT                   /product="Pc15g01140 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP83000.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018317A2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Q8"
FT                   /transl_table=1
FT                   /translation="MDRDFESQLKDVSSHEIENVNIAESVSYSPEEEKALVRKIDLTLL
FT                   PTIWVMYLLSYLDRTNIGNAKISGMEVDLSLSSNEYSIALVVFFVGYVVFEVPSNLALG
FT                   RSRPSIFLPSIMILWGALTCVMAAINDFTHLVVLRVILGCVEAGFAPGVILLLSSWYKQ
FT                   TEQSKRFGVFISAAVLSGAFGGLIAAGIVDGLEGVHGIRGWRWLFIIEGAATVGFAIIS
FT                   LFILPDFPGTSRRLSDRERQIAVARLATQNVTATTEDTEKLSNWGACKVACRDLRTWTF
FT                   VIGYMVIVGSSTLTYFYPTLVQGLFGDASTKKINLLTVPIYGVAFIATGVTSYFSDKVP
FT                   NWRGVIIASWLTFSLVCSIIVCVVYNFTARYVLLVLMASGLWATNGGTLAYASSAFGGM
FT                   HPQARGVALAMVNALGNLAQIYGSYLFPEKDGPKYIMGFSVISAMLAVGVIDFLFLHVW
FT                   FRRRQRNL"
FT   CDS_pept        complement(269147..269992)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944461"
FT                   /orf_name="Pc15g01150"
FT                   /product="Pc15g01150 protein"
FT                   /protein_id="CAP83001.1"
FT                   /db_xref="UniParc:UPI00018317A3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Q9"
FT                   /transl_table=1
FT                   /translation="MTESRSNPEHHVGRSFLRDIPLSTKRYRYQGKEHFLRTRDLEFDR
FT                   FQRSKHDTSQYILFDIDADTLKRDFLDPDIEDNSFTFDSFNTEENLLIIKMQTQEHAQA
FT                   IEEFGYTIMRQLDDMGLRDVIQKFTKVEAYSQGKVPDHGWGPRRLNSDRRHRPTIVLEV
FT                   GVSESQPKLEADATFWLDPARGNANIALTPKLNRKKAQITLDRYEWDTANGEINRVQRI
FT                   QMTKGGKTKRKITVSNAPLIIPFEQFLERPTSSPVEKDIIIKESELRTIARSIWEVQRK
FT                   "
FT   CDS_pept        join(271157..271414,271481..271521,271585..271622,
FT                   271677..273355)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000280651" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127870"
FT                   /orf_name="Pc15g01160"
FT                   /product="Pc15g01160 protein"
FT                   /biological_process="Mo-molybdopterin cofactor biosynthetic
FT                   process"
FT                   /protein_id="CAP83002.1"
FT                   /db_xref="GO:0006777"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="UniParc:UPI00018317A4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R0"
FT                   /transl_table=1
FT                   /translation="MEIKRAAILIISDEASEDSSLDRAARALAPVLAKEEKWELSAIRI
FT                   VPNNYLQIQQAVCDWTSGPNWHHLVLLSAATGSAAKDNTLEAVTSLIHRHAPGLVQDMI
FT                   ADSLKFTPFAKLERPVGVCDKTLIVSLPGSPKGAMENLEAVMNLLPRVIPQNPRLPQPR
FT                   LQPYHDYHHAHGHPIRKAHMSPQDRPRSKSNRPAMGLNQRYRPCANPMLSVEEALRVIR
FT                   EQTPAPIVVETPITTSIIGSVIAEDVYASEMVPAYPTSLVDGYAIIAEEGKTTNAFFHR
FT                   ATITLPNRSGAFEPLHPGTIARITAGASLPPNANAVVMFDDTASSTLDGQDGEIVEILA
FT                   DDIVPGENIREPGSDVALNSKVLARGDLISPVGGEIGLLAATGTRTVKVFKKCRVGVLS
FT                   IGGDLVEHSNPSTLVRGQIRDSNRPSLLSCLDSWGFETVDLGLARETAAGEVEHTLRDS
FT                   LYGVDRAFSGVDVLVVTGSMSLGKLDFTPIIESTLGGTIHFDRVSMKPGITTTFATVPF
FT                   KATTADAATEKIRQKHASKLMFSLPGDPASTLATLNLFVLPSLQKFAGLGESSQAIATK
FT                   PGSTPQLGLPRVAVVLTHHFPLDPKRTEYHRAVVTGSRSDGRLYATSTGVNSVGSLAKA
FT                   NALVILRAGRGVGIKGEIVEALMMGPVYASDTRIIC"
FT   CDS_pept        join(273984..274207,274275..274473,274539..274838)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944462"
FT                   /orf_name="Pc15g01170"
FT                   /product="Pc15g01170 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP83003.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018317A5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R1"
FT                   /transl_table=1
FT                   /translation="MKLIIAGATSLLGTEIVRQSLQIRAITQVISLALQPVQLDKSIDT
FT                   SKLKNIVIRDYSEYPDDVKAELAGADACIWTVAVTPLRTGKVELKRVCQDYTKLGFKTI
FT                   CEAGPARPFRFMYLSAEGIPRDPTKTPVIMPDYHIMRCNTELMVLKFPTEKEGVEVCIA
FT                   RPGVIANSSTWSRALVANLFRIVNLFGQPLPYVQRSQLAAALLSQVMDGFEKQTLSNAD
FT                   LVRIGQREMNSRSIPQPS"
FT   sig_peptide     273984..274037
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R1 "
FT   mat_peptide     join(274038..274207,274275..274473,274539..274835)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R1 "
FT   CDS_pept        join(complement(275502..275611),complement(275359..275418),
FT                   complement(275196..275272),complement(274894..275114))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670810"
FT                   /orf_name="Pc15g01180"
FT                   /product="Putative uncharacterized protein Pc15g01180 "
FT                   /protein_id="CAP83004.1"
FT                   /db_xref="UniParc:UPI00018317A6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R2"
FT                   /transl_table=1
FT                   /translation="MAFCGCAHGRCLSVGMSNIEMFPSIGIVIMGLDIWSRWPSLWEKF
FT                   APNAIGSGFGHLNHSLRLDILQLDTNYSRLSEAGHMSCTASLPRPLHTAYIPEVYCSGT
FT                   AKFFPYSQRILNFPLSFPPSSWQRSTLVTPVASEDPIRILGNLISSPQVFQ"
FT   CDS_pept        join(complement(277389..277639),complement(276587..277286))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000150200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944463"
FT                   /orf_name="Pc15g01190"
FT                   /product="Pc15g01190 protein"
FT                   /function="catechol 1,2-dioxygenase activity"
FT                   /function="ferric iron binding"
FT                   /biological_process="catechol metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP83005.1"
FT                   /db_xref="GO:0008199"
FT                   /db_xref="GO:0009712"
FT                   /db_xref="GO:0018576"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniParc:UPI00018317A7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R3"
FT                   /transl_table=1
FT                   /translation="MSPTRQFDPNFTPSVINGMGPNTPERARVVLGSLIKHIHDFAREV
FT                   ELTSAEWMLGVEFINSIGQISTPIRNEGHRICDVIGLESLVDEIANKIVTEDGVSPTSN
FT                   VILGPFWSPNAPFRALGDSIIQDPNPHGRVTFMHGVLRDMETGKPIVGAVLDIWQASAN
FT                   GQYDFQDPTQSDNNLRGKFRSNEKGEFNWYCYHPTPYSLPTDGPAGVLLKLMDRSPMRP
FT                   AHIHLMITHPEYATVINQIYPSDDPHLAIDSVFAVKDDLVVDFKPKTNDPKATLDLEYN
FT                   VKMALKKHHPNPNSAPPVSSFERHAKAAKEAQGKL"
FT   CDS_pept        join(complement(279017..279843),complement(278550..278964))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217399" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944464"
FT                   /orf_name="Pc15g01200"
FT                   /product="Pc15g01200 protein"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP83006.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI00018317A8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H665"
FT                   /transl_table=1
FT                   /translation="MASMLNYFGFNAPASKEDTKASPVRALPASWYTSPEMYELERRAI
FT                   FSKRWLFITHSMRLKNTGDWLRYELAGFDFIITRDRQGDINAFHNVCRHRAYPVVEKEG
FT                   SGNSKILACRYHGWSYGLNGKLAKATNYQELSDFDKEQNGLFRIHLKVDVNGFIWVNMD
FT                   ANEVPEVSWEEHFRDVDKQERYKAYNFDNYDFDHDYALEGDYNWKILADNFNECYHCPT
FT                   THADIPAFLNMESFDSDLKDGHIQHHCESTPEQIEKGLYTASTYYFPMSAMVVSPHFIM
FT                   VQKFLPSSAKSSKMAYEIYRNRNSSDADFKLISDMYARVMGEDKVLCNNAQKNLDRNVF
FT                   TSGELHPKYEKAPLFFQSTVRDVITQHFEREKSEGREIWPAKPKMSCNAGVSEKDEQIC
FT                   ASLACGAQKAVLAW"
FT   CDS_pept        complement(280986..281753)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000218797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127871"
FT                   /orf_name="Pc15g01210"
FT                   /product="Pc15g01210 protein"
FT                   /function="FMN binding"
FT                   /protein_id="CAP83007.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI00018317A9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H666"
FT                   /transl_table=1
FT                   /translation="MFFQSAHEEKDKEALLHFIRQNPLGVLITGMNSSQQDFLQCTHAP
FT                   FVVDFPEETGKTDPYLRAHIAKQNPQVKTMMEAVDNKPPNVLELDDDVLVLFNGKHDHY
FT                   VTPKFYVETKPDTGKVVPTWNYSAVQAYGKMSLYYDSKTSETGEFLAKQLHDLSQHTEK
FT                   SIMGYTGGESPEPWEVSEAPKSYTDLLKKNIVGIEIRITKLQGKFKMSQEMRPGDREGV
FT                   IQGFAKLGGDTGNAISNLVKERAELREAKKRDL"
FT   CDS_pept        join(complement(284951..285089),complement(283604..284838))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944465"
FT                   /orf_name="Pc15g01220"
FT                   /product="Pc15g01220 protein"
FT                   /protein_id="CAP83008.1"
FT                   /db_xref="UniParc:UPI0001831878"
FT                   /db_xref="UniProtKB/TrEMBL:B6H667"
FT                   /transl_table=1
FT                   /translation="MQPNHCDLLGQAREPRAASRMTRDGHQPLRDNGQPQPSGAVPMRS
FT                   EDSWIDVSSQPSSSSFSSAATNEDIITTGLQVEYGEGRAHQRRNRRRRLQHLAAITTAQ
FT                   VDYASRDASQANSSQEEYEESESESDRVLSSSNEDIIRPTLPAALSARSAPPSSGSDAA
FT                   PSDDEDDTSTALGMGISPSPFVPQPNIFTHPPARSEPGWTARRSQPNVPSTSSHRASRR
FT                   GSYPSPQSSRRAQYQHSPYNMISPSHHADHDAALRASLSTLLSCAAAARGLPKNDNRPS
FT                   PTPAAPSEAGQPASFRLVGASVAMGEESSDEVTSSSPRYPESGPSIGAPQRHARAPAVS
FT                   SDPAVAKAKRRSSSPKDRGTASKKSRRVSMTDPAATVSPTIMTWVISAGVVVLFSAISF
FT                   SAGYMIGREVGRAEVGMMGDGVPGPRPSVGCGQEAVRGGLRKLRWGSAAAGSASLASM"
FT   CDS_pept        complement(285872..287395)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944466"
FT                   /orf_name="Pc15g01230"
FT                   /product="Pc15g01230 protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP83009.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001831879"
FT                   /db_xref="UniProtKB/TrEMBL:B6H668"
FT                   /transl_table=1
FT                   /translation="MSKTSTKGADKANKASKALNKVKDAGVTKASQSPAAKSKAIASKV
FT                   ASKEKASKKNKKKEPTPSSSESESESDEDMKDASSSSSSESESEEEKPAPKKTEKKTEK
FT                   KVEKKVAAKAESSDSSDSSDSESESEEEKPAPKKTEKKAAAKAESSDSSDSDSDSESES
FT                   EEEKPAPKKAEKKVAAKAESSDSSDSESESESEAKKASSDSESGSDSDSSDSDSDSEET
FT                   PVSKKRKADEEPAAAAKKSKTEDAPEGASANLFIGNLSWNVDEEWLQREFSEFGELSGV
FT                   RIVTDRESGRSRGFGYVEYTSAADAAKAMEAKKGTDLDGRTINLDYAAPRQANPQQDRT
FT                   QDRARSYGDQTSPESDTLFVGNLPFSATEDALHEVFGAHGSVLGIRLPTEQETGRPKGF
FT                   GYVQFSSIDEAKAAHGALNGHELEGRAVRLDFSTPRPAGGDRGGFGGRGGGRGGGRGGF
FT                   GGRGGGGFGGRGGGGRGGRGGFGDRGGRGGALNKGKGSIPEYKGTKVTF"
FT   CDS_pept        join(288276..288513,288567..288729,288799..289291,
FT                   289373..290182)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195048" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944467"
FT                   /orf_name="Pc15g01240"
FT                   /product="Pc15g01240 protein"
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="CAP83010.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="InterPro:IPR004856"
FT                   /db_xref="UniParc:UPI000183187A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H669"
FT                   /transl_table=1
FT                   /translation="MAPPTPSSHRPRKKRKIATSPSSNNNLILDLGEGKQSPAFPLVSF
FT                   LWAARAGVSQWLILPLVLMAVGLFRWAVSLWGYSGFRVPPMHGDFEAQRHWMEITTHLP
FT                   LAKWHIYDLQYWGLDYPPLTAYHSWLLGKIGSAFDPSWFALDASRGFEDPRLKVYMRAT
FT                   VVVSEYFVFIPAVVNFLRRYTRMQGVHAWSASIALVAVLLQPANILIDHGHFQYNTVML
FT                   GLVVASLDAILAGRMLWACIFFVGALGFKQMALYYAPVMFAYLLGVCTFPRINIPRLIS
FT                   IALVTLASFALLLAPVMMNKDSVTYGLLFQLTQIIHRVFPFARGLFEDKVANAWCAIHT
FT                   FYKLTRFDATLLQRASLGATLASIIVPCAIIFRHPRASLLLPALSAVSWGFFLFSFQVH
FT                   EKSVLLPLLPMTLLLAGNGGLSKETRAWVGWANMLGSWTMYPLLKRDELRVPYIVMTLL
FT                   WAYILGLPPTSFETYRSRPSVEDSNTHFEPSTLTTLLHFGFHLAMIAWHVLEAFVAPPP
FT                   GKPDLWVVLNALIGAGGFGIAYLWCMWKLYTQCRQISRQVTEEESQKKKQ"
FT   CDS_pept        join(complement(290879..290906),complement(290708..290769),
FT                   complement(290507..290647))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195037" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15944468"
FT                   /orf_name="Pc15g01250"
FT                   /product="Pc15g01250 protein"
FT                   /function="copper chaperone activity"
FT                   /biological_process="copper ion transport"
FT                   /cellular_component="mitochondrial intermembrane space "
FT                   /protein_id="CAP83011.1"
FT                   /db_xref="GO:0005758"
FT                   /db_xref="GO:0006825"
FT                   /db_xref="GO:0016531"
FT                   /db_xref="InterPro:IPR007745"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="UniParc:UPI000183187B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H670"
FT                   /transl_table=1
FT                   /translation="MSWLFGSSNEKSAAAPEQAPAPPAQSEKPKPCCVCKPEKTARDDC
FT                   MLFSKSDSPEQECKSTIEQYKTCMAGFGFKV"
FT   CDS_pept        291302..292561
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195026" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945468"
FT                   /orf_name="Pc15g01260"
FT                   /product="Pc15g01260 protein"
FT                   /protein_id="CAP83012.1"
FT                   /db_xref="UniParc:UPI000183187C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H671"
FT                   /transl_table=1
FT                   /translation="MAPPKIFSLEGKVLKLDSAEDMNAHIQPLIDNTDHTEIRLGGNTL
FT                   GIDASKRLAEVLQTQKCLEAAYLDDIFTGRLLTEIPTALNSLLNAILKIPTVHTVNLND
FT                   NAFGLRTQAPLIEFLSRHVPLRHLILNNNGLGPAAGSQVADALSKLAERKEEARNCGEE
FT                   VALLESVVCGRNRLENSSMEAWARAYKAHAAGLKSVKMTQNGIRSEGISHLLTQGLYHA
FT                   QSLEVLDLQDNTFTNVGSTALSNVLSGWPSLRELGVGDCLLSARGGVKVAKALAENKNQ
FT                   KLQTLRLQYNEMKAEAVKGFTHAAKTALPSLRRVELNGNIFSEEDPNIIELRELLEARQ
FT                   EEHGTDADPEGTWGVDELDELEEEDSEEEEEEEEEEEEEEEAKAEKDLRDADLVEEEKV
FT                   AQKDDKDVDDLADVLGKAAI"
FT   CDS_pept        join(292917..292988,293068..293169,293230..293331,
FT                   293482..293568)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945469"
FT                   /orf_name="Pc15g01270"
FT                   /product="Putative uncharacterized protein Pc15g01270 "
FT                   /protein_id="CAP83013.1"
FT                   /db_xref="UniParc:UPI000183187D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H672"
FT                   /transl_table=1
FT                   /translation="MEYISGQAGPFKSSCLGKVVTNNQPSNEGSHSKHSQDEQVARVHT
FT                   IEDALDGVRGNLSMLISAAEQINHTCAGVAEPFPFFGSQAGDESNFAPGLSANDCYDRK
FT                   LIGGHSKANSPSSGTE"
FT   CDS_pept        join(294748..294773,294891..294939,295022..295069,
FT                   295102..295189,295569..295676,295793..295915,
FT                   296330..296382,296525..296566)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128144"
FT                   /orf_name="Pc15g01280"
FT                   /product="Putative uncharacterized protein Pc15g01280 "
FT                   /protein_id="CAP83014.1"
FT                   /db_xref="UniParc:UPI000183187E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H673"
FT                   /transl_table=1
FT                   /translation="MYQIGMNISSRSSATHPKRLLYRESVILIRYKYLGDEVGLLLRVI
FT                   TLGVVKNLLDSVLRILITSLRTRYKLLVSDTLNLSALVPSSQLSSSPQKGRNIWPSSSL
FT                   VFTACRYPEALAEALRRQQEGKDVDVSKVHATARVSQAVPTCLESGRLRQPLPMECLRL
FT                   LVVISLPPIDIKFRQ"
FT   CDS_pept        join(297922..298100,298158..298368,298399..298848)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945470"
FT                   /orf_name="Pc15g01290"
FT                   /product="Pc15g01290 protein"
FT                   /protein_id="CAP83015.1"
FT                   /db_xref="InterPro:IPR021842"
FT                   /db_xref="UniParc:UPI000183187F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H674"
FT                   /transl_table=1
FT                   /translation="MAPTPVHPAQTDGHQYWTDPILCEETRARLEHFRSLRWLPPNFKP
FT                   KTLEGIAVVERYCRKYCIQSNEDYVDFLLLEDQTIYTNFFDWMFKTSRKKLLIHSYDEY
FT                   WRRLCQYFELFARRRVGEDARQQMRRSMLTLKFLAGVSPAERKIPRRTKDKNTPDVDAF
FT                   GVIYRHHWAHSRFFRHGSMIVQFATVQLWSAITGTRPGVLLPQDTSPGNPVLGKRKRDD
FT                   TFQSDLPKHISLKDLPDSVCYRDIELFYLKDLQGKRDVLRAIIEFRNLKGRPEGDLQ"
FT   CDS_pept        join(complement(300488..300563),complement(300281..300427),
FT                   complement(299211..300211))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945471"
FT                   /orf_name="Pc15g01300"
FT                   /product="Pc15g01300 protein"
FT                   /function="DNA binding"
FT                   /function="copper ion binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP83016.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001083"
FT                   /db_xref="UniParc:UPI0001831880"
FT                   /db_xref="UniProtKB/TrEMBL:B6H675"
FT                   /transl_table=1
FT                   /translation="MLLDGEKWACEACVRGHRVSNCHHHVDRPLIRIGKKGRPITQCAH
FT                   CRGLRESHTTHIKCECGKNVYDEDNFQYAGNNHQRCGCIHGQRCICALKKERTPNPAPR
FT                   VERPRSQPASMSKLVRTPSDRQARGYAYFPQDNSNKLNAEPNDMLSASGMPYPALLSNV
FT                   VCSSSDNGFHSGNRLFPAQAALLNNETSYSGFGNSTKRQSVLSNANLAWPGDPSPQFWN
FT                   ISQHSYLQQGVPQFGSFPMVPLPDLGNSDGTSAFLPSVLPSFDKIPAELAKTDVTPAAL
FT                   SPVLSTSTTSTTNVASQQTHEENLLNLPVDVYDSAGLGTLSDDWTDFPSGTYDPTLRTA
FT                   TDIQPPYTSFDVGTYSLGLPTLSSSDNTVLNCSDEVFGPENIQNDPHNLHSVSLQIGSG
FT                   SQFGFTPR"
FT   CDS_pept        join(complement(304709..304823),complement(304524..304655),
FT                   complement(304419..304471),complement(303473..304351),
FT                   complement(303276..303419),complement(302877..303221),
FT                   complement(302651..302820),complement(302528..302588),
FT                   complement(302282..302464))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076634" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671069"
FT                   /orf_name="Pc15g01310"
FT                   /product="Pc15g01310 protein"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP83017.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI0001831881"
FT                   /db_xref="UniProtKB/TrEMBL:B6H676"
FT                   /transl_table=1
FT                   /translation="MPGFAFQLRAICTLLAVQAALGSLRTFNFTVHSAQRSPDGYFREV
FT                   YVINGQQPGPMIEVDEGDDVEVFVRNELPVSTTIHWHGILQRGTPDMDGVPGVTQHQIP
FT                   PGGNFTYRFSVKDEYGFYWYHSHFRAYYNDAIRGPLMIRPAPSRRRPFEDMAASRVERE
FT                   QLLQAERDAVSILLNDWTHDLSDTIFSRYLETGAFPNCVDSILANGLGRVECLPKYMLD
FT                   AGPGLGLTDEVNATHHNPTATMATSVMQMPTMARRMEDPADDNPHGQMSMPPMSTTNPS
FT                   ESTMSTTGGMTMPSSDTMGESDTMGESMRLGPRGCMPPMMFRQGYDINSLPSETCVNTT
FT                   SQQLVVNANVSQGWLALNLVNSGAVSNLKVSLDSHSMHVYAADGLYVTLQEVKVLEIAL
FT                   GQRYSVMIKLDQPAGNYYLRFATYPNGDMQQVLEGQAIVSYNTTGNDTQDISVDPMSVW
FT                   MLTNGSATQGANELVESRLAPFEGNRPPTTVADVTRFFNINQTGIVTWVVDQYPYTEPT
FT                   IPIIYGNRSDGWNSNTTLHLPTNSTVDIVMNVANSSMDTMGHPMHLHGHKFWVLGSGSG
FT                   SFPYQSVAEAPSSLINLDDPPYRDTANLPPSGWLAIRYITDNPGAWILHCHIQWHIVSG
FT                   MALVLVEGEDQLDSLIRQGNNSDPTTPAISGTAPSYIANFFGILVALGTVLNALVVFS"
FT   mat_peptide     join(complement(304709..304757),complement(304524..304655),
FT                   complement(304419..304471),complement(303473..304351),
FT                   complement(303276..303419),complement(302877..303221),
FT                   complement(302651..302820),complement(302528..302588),
FT                   complement(302285..302464))
FT                   /db_xref="UniProtKB/TrEMBL:B6H676 "
FT   sig_peptide     complement(304758..304823)
FT                   /db_xref="UniProtKB/TrEMBL:B6H676 "
FT   CDS_pept        305333..306418
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945472"
FT                   /orf_name="Pc15g01320"
FT                   /product="Pc15g01320 protein"
FT                   /function="zinc ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP83018.1"
FT                   /db_xref="GO:0005385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniParc:UPI0001831882"
FT                   /db_xref="UniProtKB/TrEMBL:B6H677"
FT                   /transl_table=1
FT                   /translation="MDAELLRSLLQRDTGDITDTCETGNEYNGRLSLRVSSIFVIMAGS
FT                   MIAAVFPVLVIRSRAVGAKWERITHWAFFIAKYFGSGVILATAFIHLLAPAEEALRDDC
FT                   LTGPISGYPWVEGIILMTIVTMFLVELMIMRHSYLDLSQQNDIVHNGSRCLRGVDNFGG
FT                   WDQAKSHLPIEDNLSRPQEHQEAEMAEGNFAFVDDYAAQLIGVFILEFGIIFHSIFIGL
FT                   TLAVAGSEFTTLYIVLTFHQTFEGLGLGSRLAMIPWPTSRGWTPYVLGVVYGLTTPIAI
FT                   AVGLGVRNTYPPSGRTTLIINGVFDAISAGILIYTGLIELIAREFLFSSYMRRASPCTV
FT                   CSAFVLLCLGAGLMALLGKWA"
FT   CDS_pept        307101..307415
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945473"
FT                   /orf_name="Pc15g01330"
FT                   /product="Pc15g01330 protein"
FT                   /protein_id="CAP83019.1"
FT                   /db_xref="UniParc:UPI0001831883"
FT                   /db_xref="UniProtKB/TrEMBL:B6H678"
FT                   /transl_table=1
FT                   /translation="MVTQKSTLNQPRLFAPSGRLLIEWSPSCQICTASKRLPTIHHYRR
FT                   TCISHLCPPAYYADLVCTRARCYMSDLFDPTPSATPTGSVAGESGGRVSESIKDTMFYI
FT                   "
FT   CDS_pept        join(308053..308190,308339..308545)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945474"
FT                   /orf_name="Pc15g01340"
FT                   /product="Pc15g01340 protein"
FT                   /protein_id="CAP83020.1"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="UniParc:UPI0001831884"
FT                   /db_xref="UniProtKB/TrEMBL:B6H679"
FT                   /transl_table=1
FT                   /translation="MLFYLLPFNIGFPDLQPLLQSLLESGRYSDLTISCEGRKFAVHRA
FT                   IQPFNELVTFLYIRDYDDTGIPDIEDKKSVSGEVKDSHAVLWNNLGVFMAADKFDIAPL
FT                   KQLARTRLIN"
FT   CDS_pept        join(complement(312325..312665),complement(312007..312268),
FT                   complement(311637..311959),complement(310158..311577))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217223" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671070"
FT                   /orf_name="Pc15g01350"
FT                   /product="Pc15g01350 protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP83021.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR021842"
FT                   /db_xref="UniParc:UPI0001831885"
FT                   /db_xref="UniProtKB/TrEMBL:B6H680"
FT                   /transl_table=1
FT                   /translation="MSDVADLSSATDSDTSGVSFQPDIDATDDSDSGQASNSTELTTPE
FT                   PTCLPDNCSRPSTRPKRPVRRPADAGVLPDFSDDPDDDTDEDIANVPLDYGRSEQTKVR
FT                   GRRIEKRWDKYCRVKAAQAGALLKWDDPVEALREVTPNDVHRFFNYCMKLKYGEGGRHL
FT                   KGTSKASALKADWKGFRGYYRRITRTRITAEDSEEINAGIRKLVDKFDLDTQERGKEPV
FT                   YVQDLTELNETILRTQERRFHFGYERIQLCLFNMLGIYTVNRLHALLSLQFHHLRFSVQ
FT                   DNPDGGPPVLLVEIKSEHTKRFLGTSQINNFPFPEIINDPSLVFSPHTFIFGILLWLQA
FT                   FEVPTLSSMERLRKLFVQGGRQQMELPLKREVEGYYVFCKTDVINGRPVLQWNQPMTDG
FT                   AMSGRLRNLGEIHGLLQSMFAHRFRYGGGKMLNESSVVSEAQQNLIMKHADTRTFLNHY
FT                   LPRHIDTDMQNVMNGRESNKSLMRAITRMSRWIDKRRPRHLTSEQRASLREHPEYVEAT
FT                   RRMKEQAEECKCDPSAAMQSRLEKLKRETSNTFGRLERALRRKVRHEFDRKQAIIDIER
FT                   QLSGAAVDDEEAKKVLQVEDQMLPEQIDLLEKLFTWPTSQSLEAEWQRRNAAVATISRY
FT                   CGFLEGGPLRGRRKRAAPSDGFDEEQTSVLPEPAKKSCSSPEPSQQDILLVKAGNYIKK
FT                   AKKPRRCFQCYGDTELPIHRRTQKYSEYKSTLRHFREKHLQDRRCHMCDEDLLHEMHLR
FT                   RHAEEVHRLSTERNYYTKEDTGSDIDTD"
FT   CDS_pept        313190..314035
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(315218..316591),complement(315101..315160))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945475"
FT                   /orf_name="Pc15g01370"
FT                   /product="Pc15g01370 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP83023.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI0001831886"
FT                   /db_xref="UniProtKB/TrEMBL:B6H681"
FT                   /transl_table=1
FT                   /translation="MKTEIEQNCSHPQYEPTTLGDKESAPVQPSKCITDSDPSPDDCQT
FT                   ELERRKKIEGRKRFSRLGWKRLVVILIVEAVALGSLSLPSSFATLGMVGGIISSVGIGL
FT                   IATYASYEVGTVKLKYPEVEHYGDIGRLILGEKGFWIVTVVFIFQLLLNVGSHCLTGII
FT                   ALADITQSGICTVIFGLVSALILFLLAIPPTFADIAILGYIDVASIFTAIGITIIATGV
FT                   QSTRDNISLPGSDWSAWPKENVSFSTAMVAMNNIVYAYSFAPAIPSFMNEMHTPKDYTK
FT                   AIYTLGVVEIIIYTLIGSLVYLFVGKDVQSPALLSAGPLISRIAFGVALPVIFISGSIN
FT                   TSIIARYIHAYVYRHSVVRYVNTKKGWITWISLVAVLTFVSWVVAQAIPVFSTILSISA
FT                   ALFISGLCFYIPPIMWFVLVKEGSWFSWSNLQRASYNGIVFLFGIGVLVCGMYANVVHL
FT                   IQESRDSNSSRPFTCSSIA"
FT   CDS_pept        complement(317685..319211)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977025"
FT                   /orf_name="Pc15g01380"
FT                   /product="Pc15g01380 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP83024.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0001831887"
FT                   /db_xref="UniProtKB/TrEMBL:B6H682"
FT                   /transl_table=1
FT                   /translation="MKDQSRSDAESYPLLPEHCFSEPDGQGTEKSRTLYYWARFRQPSP
FT                   SWVVCVFTIYEFIFGVLVVPEFNATFALICHQRYSPSQIHGGGHRDLSKELEQCFANTH
FT                   AQSDLSRFLIYGQVTAGLLGAFSTPVLGSLSDRVGRKPILACTVIGPLLHEILVVLILR
FT                   YPDSIDLHWLLVGYAMEGLSGTMIAASSTSQTYITDLMPSSARARWFSYLQASFSFAGA
FT                   AGPLIASLLLTMPNPFQLIYWLAIGSHLSLLVFILFALPESRNPDSSGCPDLDGVTLEQ
FT                   IPGESYIRVCLTSLKSTWEAKWFRNKNMIILAVIDMIMFGNMIGLAPLQLAYPAFLFKW
FT                   QPTTQSFFMSISYSWSVLVLVVLFPPIMAWFCRRNRREGVPNLSAASNSGELGAIQVNL
FT                   VLQMIGYMGISLSRAPSHFVVSSFVVASTISINPLLTSCLTAHVPDYQSGQLLGVLSFL
FT                   HAIARIVIPALLNATYSMTIGIFPAPLFMLLSIVIGGLFIASIYIEKNTL"
FT   CDS_pept        join(complement(322116..322328),complement(321352..322059))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076635" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945476"
FT                   /orf_name="Pc15g01390"
FT                   /product="Pc15g01390 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP83025.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI0001831888"
FT                   /db_xref="UniProtKB/TrEMBL:B6H683"
FT                   /transl_table=1
FT                   /translation="MTIGGNDLGFSNIVKHCILRYYNAVIGWDAAWCSHYISTAKSLMA
FT                   DTGADGLQYKFTSIYLRIIGWTQSNPDFNLYIAGYPRFFNPDTTECNTVSFRYWGWDKV
FT                   DHSDVWLTTSLRNEMNDLVASLNNVIQAAVSDANKLVGRNVTHFVDVDPRFEGRRWCES
FT                   GVAEPDSSHKSTSFFLSGWPDITEGDTIQASADDSNDLSTLQASGSLPLPDGNTCNTTL
FT                   GIDPDPVAVYWCDLASAIASDPDGDLAQHVAVANTALASGDFTTQDISWILPTRQIKTF
FT                   HPRSSGMALYRDAILAVKQEVEYGY"
FT   CDS_pept        join(complement(325340..325426),complement(322960..325275))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076636" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945477"
FT                   /orf_name="Pc15g01400"
FT                   /product="Pc15g01400 protein"
FT                   /protein_id="CAP83026.1"
FT                   /db_xref="InterPro:IPR005197"
FT                   /db_xref="UniParc:UPI0001831950"
FT                   /db_xref="UniProtKB/TrEMBL:B6H684"
FT                   /transl_table=1
FT                   /translation="MNWFALLAMGVTFQVIHQANAKAVFAHFMVTNSENYTASDWQSDM
FT                   GLAKDAHIDAFALNMAWEDNTNSASVEMAFAAANAKGFKLFFSFDYAGNGPWDKGVVTS
FT                   MIQKYGSNSAYFQYNGRPFVSTFEGPGSADDWVTIKSETNCFFMPDWSSVGAKPAVELA
FT                   NGVADGLFSWSAWPWGNHTMDTYTDASYIQYLDGKPYMIAISPWFYTNLPGYNKNWLWK
FT                   GDSLWFDRWQELFGLDPMPEFVQIISWNDYGESHYIGPIHDNAMAAFDIGEAPYNYVMD
FT                   HPHDAWRKALPFLIDVYKLGKATMTDDIVVFWYRRNFVSACSVAGTTVNTASQLQIEFE
FT                   PSSALEDRIFVMGLFQTGNSAVFVNNHDIVVWDSVPNGDLEAGVWFGSVAATTGKVRVD
FT                   LLKGDATIGSAVGPEISHTCEGDFNNFNAWVGSVSGGIMSSSDTTSIDLADQACVEGKG
FT                   AYDFNDLCSFTCSYGYCPVGACTCERMGVARKLPNATGTIGYPAEGKDANYQGLCSFAC
FT                   NYGHCPSKTCDTTKYPMPVPTVSDFLPPACVAGTGPGPVSGLCSYACTYGYCPINLCSC
FT                   TKTGALVQPPAQTDGAGMAGPGYSDIFDNLCDFACSRGYCPSGICISKDGVSSANMNYH
FT                   YDDSAASKCDESQKQVIELELQYAVEMAQVSALNLQQGDYLDNLFNAKDDSQFISDTTK
FT                   TFKRIASLLAGSDPEFPLVLSCDRSVLTELCQQGYVAFMNNKEQRMTFCAPFFKPPDPA
FT                   STLPQIWPTEDLLEDTQMDLRKASRARSAVLVHESTHTRYGMLGKPL"
FT   mat_peptide     join(complement(325340..325363),complement(322963..325275))
FT                   /db_xref="UniProtKB/TrEMBL:B6H684 "
FT   sig_peptide     complement(325364..325426)
FT                   /db_xref="UniProtKB/TrEMBL:B6H684 "
FT   CDS_pept        join(complement(327761..327810),complement(327154..327711),
FT                   complement(326481..327093))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177863" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823832"
FT                   /orf_name="Pc15g01410"
FT                   /product="Pc15g01410 protein"
FT                   /protein_id="CAP83027.1"
FT                   /db_xref="UniParc:UPI0001831951"
FT                   /db_xref="UniProtKB/TrEMBL:B6H685"
FT                   /transl_table=1
FT                   /translation="MDPELVSSIKYFERDRPPNTPRLSMEIEPNRVMSLDNPIGVIITI
FT                   RRAEDDCSNPCIFRWNILRDGWGPSGFMLFQHTSDGLKKVEGKHNSPPLQTFRLTGYEV
FT                   ETEELLPGQTLRRNIGHPYPFWDHLNAGERYELFWPGAEYALWAWGTLREHWEQEIGVN
FT                   LGLPRVIIPGGACCSLTCVEEEGISISEPDDPCVEKSKRIPGTPCISVFLEGPSAISRT
FT                   EKLQIMVKITYDGLTNEDCEAVYGDAKPIIIHDYPFSRDNFRLQRCCHNYDPLKKLDDD
FT                   SPQWKSYFDDERNEGWMIVDEPDVEVNVTDSMFFRSLQPGESLIRCVSLGFTDLHPDTV
FT                   VGDTYRYQYWGGCIDWWTWGDREEHANTVVKLPCWLNDHVVEPADNDGRPVIMVPSSNF
FT                   VEFTAID"
FT   CDS_pept        join(complement(328746..328861),complement(328146..328680))
FT                   /pseudo
FT                   /gene_family="HOG000200304" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(329192..330237,330377..334313)
FT                   /pseudo
FT                   /gene_family="HOG000234789" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(334997..336361)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(336983..337998,338157..342087)
FT                   /pseudo
FT                   /gene_family="HOG000234785" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(342403..342824,342925..343309)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671071"
FT                   /orf_name="Pc15g01460"
FT                   /product="Putative uncharacterized protein Pc15g01460 "
FT                   /protein_id="CAP83032.1"
FT                   /db_xref="InterPro:IPR001370"
FT                   /db_xref="UniParc:UPI0001831952"
FT                   /db_xref="UniProtKB/TrEMBL:B6H686"
FT                   /transl_table=1
FT                   /translation="MGMTTRSQRVGLDPQLPEPPARRPSPILEAANPAISPEYPNVEDF
FT                   SLAEDDSHDEDYFLVSITYDYSTITARARSFQGIVLAGATPLQLAQNGFYYRPSGVSNV
FT                   ACCFACQSTKHLSTFQCTPFEEVQQLHEEDCIWQIISTQTTDDSSTKTQTQSTPITSTI
FT                   AKERLNTNLDCRSNPLPAIIDPEPQQPPTAHSPQPHQTIPSITFSPQNQQTTYASVLQR
FT                   PVTSIPQPTPPVQEPFLPANPILTIEDLHLRFHNKPSPFHLENKTS"
FT   CDS_pept        join(346419..346643,346692..346767,346862..346890)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076492" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945478"
FT                   /orf_name="Pc15g01470"
FT                   /product="Pc15g01470 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP83033.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI0001831953"
FT                   /db_xref="UniProtKB/TrEMBL:B6H687"
FT                   /transl_table=1
FT                   /translation="MASASTTRSNRSTSVRKSKRQKQGRRKSSLMKKAAEYSKMCDADV
FT                   CVGIRLRETGQVFILSADASGFWAFLGSQLNSYYPAPRLVTEQDLELVDKDTPEQLQVT
FT                   ERKAR"
FT   CDS_pept        join(349985..350170,351484..351585,351660..351784,
FT                   351860..351920,352012..352078,352151..352228,
FT                   352317..352469,352624..352825,352916..352955)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823833"
FT                   /orf_name="Pc15g01480"
FT                   /product="Putative uncharacterized protein Pc15g01480 "
FT                   /protein_id="CAP83034.1"
FT                   /db_xref="UniParc:UPI0001831954"
FT                   /db_xref="UniProtKB/TrEMBL:B6H688"
FT                   /transl_table=1
FT                   /translation="MVSRAAWVLDQNLRYRDRRDLPESRDLPESRDTLESSLQGAKRGS
FT                   LKSKIVTLVSSKGSVEAERVWRSWAVVGSGELDRHSREPHILFLGFMGPSPAWRCASVV
FT                   RELRPQGLGSRPRDPEQLTQGELPTAVDAGPHWTVLGLLTTVYMGHRVVSPYSPGESRY
FT                   DPRDPHGGVPLNARSISHPHTRCDRLWMLGFYHYAIWPKGTMFGIVLRGLGTDVKSVGD
FT                   PTDPPAPILLNAKVQGTHSSSWGLYSPFPGAVGPLGDYLPRISLGPYTVDEKRKPRVTY
FT                   RCAGSCLHDRLEHRPCTPTSLLESASPIHWDNNIQIGKRGTEGSSSAAEEPVETMW"
FT   CDS_pept        complement(353919..357485)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000198689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945479"
FT                   /orf_name="Pc15g01490"
FT                   /product="Pc15g01490 protein"
FT                   /function="ATP binding"
FT                   /function="copper-exporting ATPase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP83035.1"
FT                   /db_xref="GO:0004008"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001831955"
FT                   /db_xref="UniProtKB/TrEMBL:B6H689"
FT                   /transl_table=1
FT                   /translation="MAPSDKLSLPQSRLTTILVNNLHCPSCVTNVEETLSALKPPPFSI
FT                   STSILRHEIEIVHSVTLSADRIVRALEDVAFEVDSVIPDASEGDIEANAAEAQRRSSRG
FT                   ELEHDVLAQSELHLSKCDACSAQLDMLSSKTSSTVHKEAVADKKDQLGRHVGQTKEEAL
FT                   VSVMDDHLIDTRARVTLSVSGMSCSSCVSKITGVLQTRPWVQSADVNLLTNSAVVMLLD
FT                   KSHIDELLETVRETGYTTELIECEEIRLQQPSSASGLEDTWRASYVIQGMTCSSCVGKV
FT                   TDTLKQYGWITTVDVNLISASAMVEFQGKDHLDEIPGIINSLGYTATLGDVESRATSSQ
FT                   PSSKRSVTIQVEGMHCPRCPQRILDALAVYSDRLKVTAPPSKTQPKITVSYLPEAPKFT
FT                   IRHIMSTIADIDKAFTVSVYHPPSLEERSQAMHRRHQWHIARRLILAVLAAIPTFIIGV
FT                   VYMSLVNNDNPGRIYLEEPMWSGEASRSEWALFITSSPVYFFAADIFHRRMLTELKALW
FT                   RPGSKTPILRRFYRFGSMDMLMSLGTSIAYFSSIAILAINASQPHGSPKASHTGSYFDA
FT                   VVFLTMFLLIGRLLEAYSKAKAGNAVSLLGKLRPTEATLVDTAGAGSLSASANSSTVPI
FT                   DQLEFGDVVRVAKGASPPYDGTVINGESQFDESSLTGESRPVSKSIGDEVFSGTVNQAN
FT                   PVLVRVTHLSGDSMLDQIINTVRQGQVRRAPIERTADLITGFFVPVITLIAVLDWVIWL
FT                   GLGVSSRLPDSWKANTPGGWGFWSLQFAISVFVVACPCGIGLAAPTALFVGGGLAAQHG
FT                   ILVKGGGEAFQEASQLDCIVFDKTGTITKGGEPSITDHEVTHSAGVDDLWGAVMELEQN
FT                   SNHPIAKAVVIFAASKLAPVLKAIMVDEIPGKGMKGSFGARNRVSSVLEVIVGNEALMQ
FT                   DHGIVIPSASAEKLSAWKRQAKSVVLVGHRIRPEQSATEIVPWKLSIMLAVADPIRIEA
FT                   KGTIKAIQDRGIAVWMISGDNPTTAHAVGSMVGIPPENILAGILPEQKAEKIRYLQNTL
FT                   QKETGSARALVAMVGDGVNDSPALTAADVGIAIGSGSDIAISAAEFVLVSSRLSSLLTL
FT                   IDLSRVVFRRIKFNFVWALVYNCIAVPVAAGVFYPIVSNGSHVRLDPVWSSLAMALSSV
FT                   SVVSSSLLMKARLPLVGFRSDD"
FT   CDS_pept        join(complement(359180..359271),complement(358795..359122))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076568" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945480"
FT                   /orf_name="Pc15g01500"
FT                   /product="Pc15g01500 protein"
FT                   /biological_process="fruiting body development "
FT                   /biological_process="hemolysis by symbiont of host
FT                   erythrocytes"
FT                   /protein_id="CAP83036.1"
FT                   /db_xref="GO:0019836"
FT                   /db_xref="GO:0030582"
FT                   /db_xref="InterPro:IPR009413"
FT                   /db_xref="UniParc:UPI0001831956"
FT                   /db_xref="UniProtKB/TrEMBL:B6H690"
FT                   /transl_table=1
FT                   /translation="MEHHVTQRLSISVQNDLPKGNIVIKNTVIACGQPYEKSDIAKLLS
FT                   PEDVNQIMIPHDENRTISFCGSATYRVGVEGTLDLYHDIDGQIVSLYWNGPWTRTHNQF
FT                   DMANLNCEEYTVNMSPIQESGILGDVSVIVAQTSR"
FT   CDS_pept        join(359789..359906,359961..360092,360160..360212,
FT                   360271..360623,360816..361134,361200..361343,
FT                   361412..361765,361847..362016,362074..362134,3
FT                   62220..362387)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076634" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671072"
FT                   /orf_name="Pc15g01510"
FT                   /product="Pc15g01510 protein"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP83037.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI0001831957"
FT                   /db_xref="UniProtKB/TrEMBL:B6H691"
FT                   /transl_table=1
FT                   /translation="MSVCRTSYAIWLALCYFVSHSNAILRTYNLTVHNDVKAPDGVSRE
FT                   VFLINGQLPGPLIEADEGDDLEIFVKNDLPVDTSLHWHGILQRGSPDMDGVPGVTQYPI
FT                   PPGGNFTYRFSIKDQYGFFWYHSHVRAYYNDGIRGPLLIRPSPQRLRPFEKLAHSPHER
FT                   DIILQTERDATSILLSDWTHELSDTIYARYFETGAFPNCVDSILANGFGRVECLPDTSM
FT                   SAMPMSATMTMSDMSPSMTSLSPRGCMPPMMFRQGYNVSSLPPETCTNTSSSLLTIPAD
FT                   HTSGWLALNLVNSGAVSKLHVSLDAHSMFVYAADGLYVEIQEVKVLEIEIGQRYSVMIR
FT                   LDQKPGNYYLRFASYPNGDMQQVLEGQAIVSYNMSMMSSRTPMNVTVDPSTIWMLTNGS
FT                   AKPDTSVLNPQLLSPFAPVNPPSAPADQTYTFTINQTDIVTWVVNDASYSEPKIPIIQG
FT                   NVSDGWQANTTIHVPSNSTIDIIMRIANDSMDTMSHPMHLHGHTFWVLGSGTGSFPYDS
FT                   ATDAPESLINLRNPPYRDTTNLPPSGWAVIRYVTDNPGAWIFHCHIQWHMVSGMALVLV
FT                   EGPDQFPALIGQSNNGTPPATSAAPMRRISSRQTALTAAAASLMMLG"
FT   sig_peptide     359789..359857
FT                   /db_xref="UniProtKB/TrEMBL:B6H691 "
FT   mat_peptide     join(359858..359906,359961..360092,360160..360212,
FT                   360271..360623,360816..361134,361200..361343,
FT                   361412..361765,361847..362016,362074..362134,3
FT                   62220..362384)
FT                   /db_xref="UniProtKB/TrEMBL:B6H691 "
FT   CDS_pept        join(363084..363396,363775..363797,363857..363937,
FT                   363982..364248)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945481"
FT                   /orf_name="Pc15g01520"
FT                   /product="Pc15g01520 protein"
FT                   /protein_id="CAP83038.1"
FT                   /db_xref="InterPro:IPR006760"
FT                   /db_xref="UniParc:UPI0001831958"
FT                   /db_xref="UniProtKB/TrEMBL:B6H692"
FT                   /transl_table=1
FT                   /translation="MNEESDGRRKLSYKRRIASLEHDRALLMRLMESLRTHDQSEADRI
FT                   VRAIRNGASLAEMDLVLTAGSGLCEPRRTLEFKVGNLDTRESESGTSGARQTYLDLNQL
FT                   WGKEPYPEPLSESEKRHLSKYGKRPRGGLLGEKSKERTYFDSGDFAFSAAHRVTDLDAI
FT                   QTGRAHPHRDNISHPSSTIPATSNVDKKANEDMHRREPSPKRSLLHRQTNEDPTDEDNL
FT                   FSFED"
FT   CDS_pept        join(complement(368073..368190),complement(367735..368018),
FT                   complement(366356..367675))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217912" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128145"
FT                   /orf_name="Pc15g01530"
FT                   /product="Putative uncharacterized protein Pc15g01530 "
FT                   /protein_id="CAP83039.1"
FT                   /db_xref="UniParc:UPI0001831959"
FT                   /db_xref="UniProtKB/TrEMBL:B6H693"
FT                   /transl_table=1
FT                   /translation="MDKAILSLTAQKIRELFTICGIEDSEEHLNLVIAHAADHVYKARL
FT                   VIAGGATEPISQAKEATIETPPTPPHETRGSYRLMKQTGKDGPTTYSDMASTEKKKKKR
FT                   KRSDKSELIDQPPGASVADEESISPEIQTTSEVDDAESSCVPNPRDSSLPLHLDSAFEM
FT                   KVITTILMQCVKCNSDIAQYGQRDCMALATTRLERMREHVKDVSRYNYEQAIHAIRRDT
FT                   ALTTGRAIQTRYNETIFWPIILKCAALIDPATLPPAKGPADGFTMTEKAATKKFMEDTG
FT                   YSVGAENQRQYRIFWKNIFDMREAGVDKILLYRTKEFDSFCRGYSKTSETPLVDKVLRW
FT                   ENEYRSHIEQLEMRITKLKTGDSKRLSYLSNLQVLERLKVPEPSWNNASNEWAVNAEEE
FT                   IFRQRSSKSISTDILGIPHGDESVYEGGSDKSAFITLLPKDDETLFVSSIVPICEGDFL
FT                   GIFAGTIRLSEDFNVTHGISGPAENLWLDYSQVTGALNQMQVSEPGGNANVCLRWEAFH
FT                   GDNATEPCISWRVSVKAAKHIMPFDPIVRAAAQQEQYHLHSSPANAKRGFLESATN"
FT   CDS_pept        join(complement(374412..374760),complement(373912..374358),
FT                   complement(371147..373728),complement(371024..371089))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160566" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128146"
FT                   /orf_name="Pc15g01540"
FT                   /product="Pc15g01540 protein"
FT                   /function="ATP binding"
FT                   /function="copper-exporting ATPase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP83040.1"
FT                   /db_xref="GO:0004008"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000183195A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H694"
FT                   /transl_table=1
FT                   /translation="MEGDYCGLPTPAPEPNVTALAAPSEKPSSCQDSCCDSDDTEHTPA
FT                   PGQKTPAPEKLDDCCSPEKCADNKSENHTDAPDCCRGKVSPCCDTSCLDRLAMRECEMS
FT                   AMAAPGPNSQPNTCGGATDHKACNQHSLSALDRYGATLQALGCICRALIALGQETCCEI
FT                   RDRQSLDGKQCSKKSSARSFRISLNSCSNGSVTKDQAAQNRSRLRRGSRESTRSVEKAS
FT                   AHACVVALCSKDKPAKEPPVKSKCPEPCCSEDTPTTAPLVKDNSKNTISKQLPNAASSG
FT                   SCCKPPKQDIVSCADSRCTEKQPANPQGSCTDACCSSAVPDPGLEIEEASIQAITDIEN
FT                   QSTGKEHVVLSISGMTCTGCETKLSRTLDTLPAVKDLKTSLVLSRAEFNIDLRLSSVEE
FT                   VMKHLERTTEFKCKRVQNQGSSLDLIVPDEPSNFISQTWPDGVLDMAPVDKQTVRVAFD
FT                   PNIVGARELSKIWGPPIELAPPRGDPSLEAGSKHVRHVGYMTLLSAVLTIPVLVMAWAS
FT                   LPDGEVAYSSASLTLATIVQVVIAGPFYPKALKALIFSRVIEMDLLIVLSTSAAYIFSV
FT                   VSFGYLIAEQPLSTGQFFETSTLLVTLIMVGRWVAALARQRAVESISIRSLQASTAILV
FT                   DQKSGTEREIDARLLQYGDTFKVLPDTRIPTDGTVINGSSEVDESMLTGESRPVEKYPK
FT                   SVVVAGSVNGSGVMTVRLNRLPSDNTINAIAAMVDEAKLSKPKLQDLADRVASYFVPVV
FT                   LALTIITFVIWVAVGMTVRGYDGSEATIQAITYAITVLIVSCPCAIGLAVPMVIVIASG
FT                   VAAERGIIFKSSDAIEVAHKTSHVVFDKTGTLTRGKLSVVTTECANVDKLPLLLGLIEN
FT                   NRHPVSVSVAAHLKDAGVTASTVPEPKSLTGKGVETTFGGRKLRAGNSRWLNLSENEVV
FT                   QPMLAQGYTVFCFTIDNALQAVYGLEDELRPDAAGTIETLHRRGVSVHVVSGDDDGAVR
FT                   SLASKLSIPGGQVRSRSSPADKKDYIQTLLRTRIDRKEPVVVFCGDGTNDAVALAQATI
FT                   GVHMNEGTDVAQSAADVVLMRPFLAGIPTMMDASRKSVNRIKFNFIWSFVYNTFAVLLA
FT                   AGAFVNARIPPEFAGLGELAQSTIIARVTTTEVPQTLVYA"
FT   CDS_pept        join(complement(377687..377761),complement(377182..377637))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076493" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671073"
FT                   /orf_name="Pc15g01550"
FT                   /product="Pc15g01550 protein"
FT                   /protein_id="CAP83041.1"
FT                   /db_xref="UniParc:UPI000183195B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H695"
FT                   /transl_table=1
FT                   /translation="MHESTKGTEPDNGVSTRDSAPIRLHTVRILFSHDITQLMKDIKRN
FT                   GLDDVVVDAVPLQELGAQHQAQDEHGCTKNAFLVDLAVLESGILRVRRKYGIIKFIPLS
FT                   SDDPIVLQQPATDPDLKKALCYQHLHSKYLQEYEKRRDLAAILGYEIHEGLNDWYNDSL
FT                   QDIGNSLEKLGYI"
FT   gap             378565..378664
FT                   /estimated_length="unknown"
FT   CDS_pept        join(379854..380121,380172..380977)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945482"
FT                   /orf_name="Pc15g01560"
FT                   /product="Putative uncharacterized protein Pc15g01560 "
FT                   /protein_id="CAP83042.1"
FT                   /db_xref="UniParc:UPI000183195C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H696"
FT                   /transl_table=1
FT                   /translation="MDELERQRLFFPVHQFSLDRQADFGVESQTERDSQPARDLLHEAR
FT                   KRRRVGSGTNLNLDGPSLNPILSANVQLQTTSEEDPNRSIPNLSDQERASLSRNPNPEG
FT                   FPHQVTCDHRLRLVSPDPQYTVHGRQTACSLPQIHQDDSRRSSTMMNDHYRPGGQVGIV
FT                   RQTISPAILQLEPSPSFTDHQSPLHFRRAAIGSLERDLPTSSGIRGSAISEMLNVSNAA
FT                   VCDEVILPPIGRTGVANGLHGNLATSDGSQELHSQFTPSNQSFVGGYPSQYSTAGQGAQ
FT                   YAGVGEPQVVDTSLCSHNMLSSLLFEEQEGPHIDAEPQRVDTSLRSHYMLHDLLDQFEQ
FT                   SRQQPDSDITYQTQFTV"
FT   CDS_pept        join(381864..382007,382055..382648)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048390" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671074"
FT                   /orf_name="Pc15g01570"
FT                   /product="Pc15g01570 protein"
FT                   /protein_id="CAP83043.1"
FT                   /db_xref="UniParc:UPI0001831A2B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H697"
FT                   /transl_table=1
FT                   /translation="MAGFHFTEQKLGNDLVSSISSLLDSINVPNLLWGNYLLTVYGVPT
FT                   IVDEAAFVIPDDLTQVAFSSLMSAGFLPCNQSSGCPHSDTLRVPPAFKHLHINDELVVS
FT                   LYRKSDVLWEFEDLRYLPEKNPDIMIASDDRLPSASLGRGRGRFSSHPCTVKLPCAVRY
FT                   CEALILLLCRDYDSSYETYWLAILSYMLEYVDGTDILDENKLQEGYRKFYHALKQGDPE
FT                   MYSMLDELRLSLIEERRLPMIND"
FT   CDS_pept        complement(382709..383506)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204724" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945483"
FT                   /orf_name="Pc15g01580"
FT                   /product="Pc15g01580 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP83044.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI0001831A2C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H698"
FT                   /transl_table=1
FT                   /translation="MMFQIISDLHLESPAAYDVFEVNPKAPYLALLGDIGYVKDEGLFH
FT                   FLRRQLEVFRIVFLVMGNHEAYHSSWSETKSAVNKFKTRIDDTRGSSETLGKLVILDQT
FT                   RYDISPGITVLGCTLFSRVAQAQKESVNFGLNDFYYIDDWTIEAHQDAHHADLVWLNQE
FT                   IEHISRSEPDRKVVVFTHFCPSTHAMVVDPRHRNSKISSAFMTDLSSEPCWENGVVKLW
FT                   AFGHTHFNCDFQDLKTGKTVTSNQRGYYFTQSEGFDCEKTVEI"
FT   CDS_pept        join(383782..383931,383987..384145,384201..384497)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945484"
FT                   /orf_name="Pc15g01590"
FT                   /product="Pc15g01590 protein"
FT                   /protein_id="CAP83045.1"
FT                   /db_xref="UniParc:UPI0001831A2D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H699"
FT                   /transl_table=1
FT                   /translation="MSTPSFAELEVAAGAVIDILKTMPEFSNSRIAVIGGLGLWNYLRR
FT                   YRTTEDVDFLITVQGAPKAVKDRLLAMPSSQFQQQAQLFFYKGVGGKSIQIDITPDWQS
FT                   PYVPSAAVPISAARSNALPYISELDLLVFKINCCGLRPTPAKKLRDATDARTLAEDMCS
FT                   RGSINLTPAQKSAVLQGLDDVAQLSRRDKSWWMAKLAL"
FT   CDS_pept        complement(389066..390625)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(391340..393235)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        394811..397096
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234740" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945485"
FT                   /orf_name="Pc15g01620"
FT                   /product="Pc15g01620 protein"
FT                   /protein_id="CAP83048.1"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001831A2E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6A0"
FT                   /transl_table=1
FT                   /translation="MADNNSPDYKALFLQAEKRRKEAEEQQRQAEERQKQAEDEGRREK
FT                   RRREQEEERRKQAEDEGRQEKERREQLQKLSRPTTFVEFLRHSHDLLSRPLRVETPSRS
FT                   TTGKIPLPTGKYCPTRLEHWTDCSALQSELFRSVYNYLQLTPGGAPRLFSSLHELEGLG
FT                   RRLGRKPISSEQELEAYERFAVEEHINDIITELCKIPAARDELGLGDGIQFSNHTNSLN
FT                   DNGAIEADTTQPSSVYHPRPDQFCIHRVDRNTTTLLTSVEYKPPHKLSVATLRMGLRPM
FT                   DLWKDMVRSNKIPTNQEAKLRYNAERLVCSALVQEYHVMIQEGLEYSYVTNGIARVLLR
FT                   VRQNDPGTLYYFLCDPNSEVNMEMEATFANSSVARTLCLCLMAFHSPVRGQEWRNSVRS
FT                   DIPIWKTSFDHTRSHIPEDEFPQLPLNSDSTAPEFPSPDSGSTYEPSSSPPDSPESTAR
FT                   QVSTRSRVSCAPSDVRHRSQSSQSPDPDSKPATRHKRTFSQVPSSPSAQRVARQRDTYN
FT                   DKGPESQSRHREAQFCTQRCLLGLQSGGVLDDCCPNVMRHRRNKDDLHHPITSEDLVRL
FT                   LKAQLDENIDRCTPLGGCGAYGAPFKLTCVVYGYTVIGKGTTSGLWKDVSREAQVYQIL
FT                   RKAQGSAVPVFLGTIDLAKIYFLHGAGEIRHMLVMGWGGESTTSMELTPTLLQEIHKSN
FT                   REIKALGIIHEDLRRDNILWNEELGRALIIDFHRSTLKSRPTLQRPRAVKRRLCQPEIG
FT                   DPKRLRVT"
FT   CDS_pept        join(complement(399735..399928),complement(399573..399676),
FT                   complement(399402..399520),complement(398516..399353),
FT                   complement(398279..398453),complement(398152..398224),
FT                   complement(397683..398093),complement(397480..397629))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076490" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977026"
FT                   /orf_name="Pc15g01630"
FT                   /product="Pc15g01630 protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAP83049.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI0001831A2F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6A1"
FT                   /transl_table=1
FT                   /translation="MNVGQLNPPWQLSLFDLLSASNEQQENVQAIDEIDIESQICTTPD
FT                   DFKSFEKWASKSQFKTVVEVWDKEACKYRIAEPTETSNDLDDYAEYAFVVRERVDRTSK
FT                   EVVSFIDIKSEGLRDILRDVLHDIKAVSLMEDKPSIEQNVLFHFLPELDRCAENMDSSS
FT                   DHESAHAKHLLLLIEHLKHKYTSTLQRLESMLQHGHITYDLLWALFKPGCHVYTTCIGT
FT                   KEPRCVTFDAGEEITQNDETWFNLECXFLDYDGVKFGEAGIFLRVPKFRGSKPIATLAA
FT                   YPLRHHPSHEQIQKHLVERGQKFLGLAGSHIQHCKGSAFFMNKGKIFKININSRVAVDA
FT                   AFFHEMQPNYSRPSLRDIGVKDKNSIAVIDIGAMLMEDREREKEKMRGDGVDAQKLSEA
FT                   DLLVSCPTVCCFSFKEKMFFSALRDVDWSPESFDCLKISSETKTILLSLAKTRLGMIPT
FT                   VPFDDVIDGKGQGFNILLNGPPGVGKTFTVEATSEYFKLPLYSANLLXNHGDSNALEQQ
FT                   LETVFKIAKHFNAVLLLDEADAFMEQRTSYHDTHNRLVTIFLRKLEYYQGILFLTSNRG
FT                   IQFDDAILSRIHLIIEYENLTREFRRDLWSTFLSKACTMQGPAIVEEHELRRLESLALN
FT                   GREIKNVAAIAHALAEADVNRVNYKYLKLAAESNKKFSKEFGRERPADGMYV"
FT   CDS_pept        join(399967..400185,400450..400560)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671075"
FT                   /orf_name="Pc15g01640"
FT                   /product="Putative uncharacterized protein Pc15g01640 "
FT                   /protein_id="CAP83050.1"
FT                   /db_xref="UniParc:UPI0001831A30"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6A2"
FT                   /transl_table=1
FT                   /translation="MSRPGGDWSWETGVFGGSWSARSSSAXLKKLTKEKHQILQGGRRH
FT                   CRLPSLGYLVASSLGDYQGKFFSMPYCAIEWKIGWKIEWKIEWKIEWKIEWKIEWKFEW
FT                   KIEWL"
FT   CDS_pept        join(complement(401956..402349),complement(401777..401911),
FT                   complement(401453..401724))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200296" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671076"
FT                   /orf_name="Pc15g01650"
FT                   /product="Pc15g01650 protein"
FT                   /protein_id="CAP83051.1"
FT                   /db_xref="UniParc:UPI0001831A31"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6A3"
FT                   /transl_table=1
FT                   /translation="MGGKRYVRPQKPYSATDALKRLVDKAESLSLREYLTKSEKKSLGA
FT                   ALTILQTETNSWKRQKYQLFLRSLQKDCGAHAVLLCAVALGQVIVANMNQQNRDRLGGI
FT                   LKTDTRLSGTVIRELAVVECNLPDTTQXPGSEGFQQLEIPTEKAPSDNTLFDTYEQAAM
FT                   LSRPRPTGLINGRQPAFTYSEASVDLVPQLGELMYKAIETSQQWKXERAAGEETTDCFT
FT                   TIIPEDTNADISITLLVGQRAGMQFLEKLKLKPTWSSLLGHLVP"
FT   CDS_pept        join(403844..404081,404132..405084)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201437" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671077"
FT                   /orf_name="Pc16g15540"
FT                   /product="Pc15g01660 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP83052.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00018311BB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6A4"
FT                   /transl_table=1
FT                   /translation="MDIQRQFPSVHWIWGGGISFVYEVHPRIVVKVPKPGEFEREQFQK
FT                   ELEIYQVFSQNPPCPSIVQCFLFSSSGIFLEYMRDISLSSRIQKNHTRNQQTMVVTTVE
FT                   KLEPLHLRKQWMNDLAQAVAFLESVDLAHGDLRPENVLLDRNRLKLSDFDCTAKIGTNY
FT                   EACMAPYGRILNNNESDQGECGTPGFLGPRTEQFALGSLYYLMNYGFEVYGDRCLAEDP
FT                   YEHGPKVVDLLQNMEFPKLDGNPLIDNIIDKCWHNKYVTVSDLAAHTKTLLNERTDVKE
FT                   SNENRKKESSEVTTLVIPIFNERWRMIMGRIIHGICYRLGVWWRSLLQSVHGDATIIGR
FT                   ASGDNRDYVDQNCMEDEFLARKEFCQDLEKRGLLHALSSGEPEQIGFTFDWYRHSL"
FT   CDS_pept        join(complement(406872..407274),complement(406573..406761),
FT                   complement(406226..406515),complement(405270..406127))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076509" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945486"
FT                   /orf_name="Pc15g01670"
FT                   /product="Pc15g01670 protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP83053.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="UniParc:UPI0001831A32"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6A5"
FT                   /transl_table=1
FT                   /translation="MVSIDLDNIIHYHPAPMSKPPCKPPHLTTSSRGSSHPPSNQPVLM
FT                   HPLPPRPPCLSHESPQTCHPRRQSPSPAVSSVRRDRDAHLNDFDKELANLEMAEFGSQE
FT                   TPELCFGGTEETQAEDINDIQRKELHDQHGGASHSDDRFTNDSRILSEGPTTPQDTAAS
FT                   SDSPGTDLSSAASAPTCPMEADGSVSPNEPCPLQDPTPTERNETQLSAFGCETDVNIVA
FT                   AGNVSTDQAPSPNPSTPVPAEDEPEPANQRLFRWSPETGAEYRISSPLPVTEAHSIQLD
FT                   ARDLSATRDSHLEAVSRSEGKDPPRDLSRSCSVSVVVPVTRSRGLPITRSTRSRSTRYT
FT                   GKRKNRANSACTVESDDPDDSDYTDGNDSGVGDITRLPRLTKRQRRPTTTKIQPAQARR
FT                   ESPHRVFSSPAPEQEIANPRPATSLQDIQTIPVRGFLTRQTFLSRVIYSCTFQEDRQPC
FT                   PHGPTKVPAYDKNLDNTRHATQSSSKKQPARASRFLPDEDDRLIELKEERGLPWSRIVK
FT                   HFPGRTKGSLQVRYSTRLKDRGTGSPRQGRNARATYPAAVAVTPQETCGLPSRSRRTGN
FT                   HGS"
FT   CDS_pept        join(complement(407682..407812),complement(407429..407621))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823834"
FT                   /orf_name="Pc15g01680"
FT                   /product="Putative uncharacterized protein Pc15g01680 "
FT                   /protein_id="CAP83054.1"
FT                   /db_xref="UniParc:UPI0001831A33"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6A6"
FT                   /transl_table=1
FT                   /translation="MVLAAHLNGRLRPRPAILQGRSFDSGPLSTRRSKADRYMDGQAGA
FT                   VPSDPLVILALNVGVSHLSGDGQHLGQFPNRPGWEVEVERRERVTREARIKSPWIPSYA
FT                   EGR"
FT   CDS_pept        complement(407822..408337)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128147"
FT                   /orf_name="Pc15g01690"
FT                   /product="Putative uncharacterized protein Pc15g01690 "
FT                   /protein_id="CAP83055.1"
FT                   /db_xref="UniParc:UPI0001831A34"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6A7"
FT                   /transl_table=1
FT                   /translation="MIPYFRITRHWTPCFSWLPHTRSSAPSPPAEAGAPAALSTGPSPW
FT                   GGGVSATVAGPQTLLERICPLDTCVLAGSHHLACMSPSLSWTSTVPNCWPEDWIDSRLC
FT                   AQMRLRYDVIRLSLFRALSNRRTRVPLAGVLSPIPRLDAVAQNDQVSHLFAEPFASYSS
FT                   LGELRNGT"
FT   CDS_pept        complement(408559..409557)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(410143..410469)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(415551..415655,415856..416015,416096..416211,
FT                   416263..416345,416399..416496,416560..416684)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945487"
FT                   /orf_name="Pc15g01720"
FT                   /product="Pc15g01720 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP83058.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831A35"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6A8"
FT                   /transl_table=1
FT                   /translation="MEGAKSARDVEALPPYVDHAQLKSLKSGDLPSNYNEESQYEIVCE
FT                   RYPVLQMTDQDQEALGASPQDEECMTRSSGLQIGKLAIGSLLLDESFVLTTGSDVASAL
FT                   NASSSAAWLITGYNLGYILALPMYGQICDLTGPRKAIILALTVYGCGCLMTGVSQNIYW
FT                   AVAGRLISGFGGAGMNELVSVILNEIHSFDRVAMLRSYVSTVSIIGVTCGAPLGAFLTS
FT                   WIGWQW"
FT   CDS_pept        join(417575..417775,417865..417940,418012..418082)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671078"
FT                   /orf_name="Pc15g01730"
FT                   /product="Putative uncharacterized protein Pc15g01730 "
FT                   /protein_id="CAP83059.1"
FT                   /db_xref="UniParc:UPI0001831A36"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6A9"
FT                   /transl_table=1
FT                   /translation="MGMVLSSQFAALAAARPEQNAATSVTTYYFAQQLGLMTGITTVKA
FT                   LLIKEMRRGLDVTLRGQPGRAGIKGLLPPALAEPVRLVIQKCYYVSPATSLVFLLLAFF
FT                   IVLKQREIKTF"
FT   sig_peptide     417575..417619
FT                   /db_xref="UniProtKB/TrEMBL:B6H6A9 "
FT   mat_peptide     join(417620..417775,417865..417940,418012..418079)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6A9 "
FT   CDS_pept        join(418623..419105,419150..419386)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977027"
FT                   /orf_name="Pc15g01740"
FT                   /product="Pc15g01740 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAP83060.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831A37"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6B0"
FT                   /transl_table=1
FT                   /translation="MGQSGLFEPTVDQNMHMGSRARLNSPHPGVDSLMWNTDEKLCMSN
FT                   RHWQSIELRAMFALLGSALRIFFGGHGRNCPARLQTRTSWHCSDDWIIRRGLPARRSSG
FT                   NFLDILSRAEWASRAATVASIWIWRLRYPKSQLRNCRTASHLWNSDLFLDSLLGFVLAA
FT                   VQYAKVKGAEVFVALSGIKKKEFIMKIFGIPEDSVFSSRDLSFSRGTKRISPRGVDIVL
FT                   NSLSVKVLRKSWACVAP"
FT   CDS_pept        420551..421471
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195015" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128148"
FT                   /orf_name="Pc15g01750"
FT                   /product="Pc15g01750 protein"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="transcription elongation regulator activity "
FT                   /function="translation elongation factor activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription elongation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP83061.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003711"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006354"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR003618"
FT                   /db_xref="InterPro:IPR016492"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="UniParc:UPI0001831A38"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6B1"
FT                   /transl_table=1
FT                   /translation="MAMDAKEIEAKAKALGKAATSNEPPAVILGLLKDIQTGVRATEDL
FT                   LRQTRIGIIVNKFKQSKSPEVARLSSEIVSKWRTEVNKQKQGGGSAASRGSSGSPRPAQ
FT                   NGTGASTPAAATPSDKASKLSVPPDKRTWKADGAEINHTGNRVRDSCTGLMYDGLCVGS
FT                   TEPPKVVLSRAIAVEVSAYKYLGPETKEEYRTKIRSLFQNLKNKSNPKLRVRVIEGEIT
FT                   ADQFVRMSHDELRSVEQREADAKIQKENMDKAMVAQQERSISKSLQCGKCGQRKVTYTE
FT                   AQTRAADEPMTLFCTCLHCGKSWRQ"
FT   CDS_pept        join(complement(424962..425499),complement(423984..424677),
FT                   complement(422642..423840))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(425789..426013,426075..426222,426293..426658,
FT                   426715..427007)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225786" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671079"
FT                   /orf_name="Pc15g01770"
FT                   /product="Pc15g01770 protein"
FT                   /protein_id="CAP83063.1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniParc:UPI0001831A39"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6B2"
FT                   /transl_table=1
FT                   /translation="MPINLEEVDSLEAIVIIDNELDPLSPPAPDTVQVSGNLGAIAMGS
FT                   KHTLTDRGDACKELRLEDVCCAAHGLSILVTATKSGKKHTILFDAGPEEEAWERNVKRL
FT                   RPNLSSVEVIHLSHWHRDHSGGLLRAIRMISDAKRAESRSGDLVADLHPDRPVYRGISL
FT                   PSHIISLQADPTFEEIGNAGAVVDKRSEPHTVLDNFFLVSGEIPRVTPYETGLKNAVRY
FT                   DPDESDWFSDEVIVDERSLICNLKGKGLVVFTGCSHAGVVNTTKHAVELTGGTVPVHAV
FT                   VGGFHLATSDADQIQDTVADLKGLDPAVLMPGHCSGWRAKFAIEKHMPGSLVPCTVGSR
FT                   ITF"
FT   CDS_pept        join(428041..428353,428694..428860)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945488"
FT                   /orf_name="Pc15g01780"
FT                   /product="Putative uncharacterized protein Pc15g01780 "
FT                   /protein_id="CAP83064.1"
FT                   /db_xref="UniParc:UPI0001831A3A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6B3"
FT                   /transl_table=1
FT                   /translation="MCAPDSATPLTGDTSDKKHVPTYVLICMTLYPVRSTSMHTAPAKT
FT                   QTQQALLRTNTTLALVDSLSSPPRPTITEARIHDLTPTRSRKKGLVRGQMLAKAIMREE
FT                   DAIYAIRITLYTPPLWGRSYLTMHVIETPDHIGLLIYQDNENKDASRSCIPFRVS"
FT   CDS_pept        join(436159..436222,436345..436423,436476..436650)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823835"
FT                   /orf_name="Pc15g01790"
FT                   /product="Putative uncharacterized protein Pc15g01790 "
FT                   /protein_id="CAP83065.1"
FT                   /db_xref="UniParc:UPI0001831A3B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6B4"
FT                   /transl_table=1
FT                   /translation="MSLNRGAFSCKGIPVYSFCHALRIEMTPDTKIAHSQNWGISAKAW
FT                   KLMPTRQVIAGSRDLQRESGIGIRFFQCFGAKPSAVSVPLKGLCLEDDWLQPGIRLEFS
FT                   G"
FT   CDS_pept        join(437222..437621,437698..440279)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945489"
FT                   /orf_name="Pc15g01800"
FT                   /product="Pc15g01800 protein"
FT                   /EC_number="3.6.3.6"
FT                   /function="ATP binding"
FT                   /function="hydrogen-exporting ATPase activity,
FT                   phosphorylative mechanism"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP83066.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0008553"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001831A3C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6B5"
FT                   /transl_table=1
FT                   /translation="MAERRISYAVDVENGERPHREAGDEGNLDEYSALNRYISTARDNR
FT                   RGSTSSAGALSSGEEKKKPWWKFGGKAAGGIQDGFVAPDDWLETDLRTGLSTSDIEPRR
FT                   KKTGWNELVTEKTNIFIQFIGYFRGPILYVMELAVLLAAGLRDWIDLGVICGILLLNAL
FT                   VGWYQEKQAADVVASLKGDIAMRAIVVRNGQEEEILARELVAGDIVIVEEGTVIPADVR
FT                   LICDYSKPEMFEAYKEYLANATSDDLKEKHGDDDDDDVETHQGVSLIACDQSAITGESL
FT                   AVDKYMADVCYYTTGCKRGKAYGIVTATARHSFVGKTAALVQGAQDSGHFKAVMDNIGT
FT                   SLLVLVMFWILAAWIGGFFRHLKIATPEHSDNNLLHYTLILLIIGVPVGLPVVTTTTLA
FT                   VGAAYLAEQKAIVQKLTAIESLAGVDILCSDKTGTLTANQLSIREPYVMEGVDVNWMMA
FT                   VAAIASSHNIKNLDPIDKVTVLTLRRYPKAREILSRNWVTEKYTPFDPVSKRITTVCTC
FT                   DGVRYICAKGAPKAILNMSDCSPEEAVLYREKVTEFARRGFRSLGVAVQKEGEPWQLLG
FT                   MYPMFDPPREDTAHTIAEAQVLGLSVKMLTGDAISIAKETCKMLALGTKVYNSERLIHG
FT                   GLAGSAQHDLVEKADGFAEVFPEHKYQVVEMLQQRGHLTAMTGDGVNDAPSLKKADCGI
FT                   AVEGSTEAAQAAADIVFLAPGLSTIVDAIKLARQIFQRMKAYIQYRIALCLHLEIYLVT
FT                   SMIIINETVDSSLIVFIALFADLATIAVAYDNAHFEARPVEWQLPKIWVISVVLGILLA
FT                   AATWIIRGTLFLENGGIIQNFGSPQEILFLEIALTENWLIFVTRGGKTWPSWQLVIAIF
FT                   IVDVLATLFAVFGWLAPDWEQTSPPTPGGPGFSKNNDVDIVTVVVIWAYSIGVTIIIAV
FT                   VYYLLTIVPGLDNLGRKTRSKADTKIENMIAHLSKLAVEMEKDSEGKTRYTLGARAEEI
FT                   EDNE"
FT   CDS_pept        join(441025..441639,441709..442257)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194983" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128149"
FT                   /orf_name="Pc15g01810"
FT                   /product="Pc15g01810 protein"
FT                   /function="aspartyl esterase activity"
FT                   /function="pectinesterase activity"
FT                   /biological_process="cell wall modification"
FT                   /cellular_component="cell wall"
FT                   /protein_id="CAP83067.1"
FT                   /db_xref="GO:0005618"
FT                   /db_xref="GO:0030599"
FT                   /db_xref="GO:0042545"
FT                   /db_xref="GO:0045330"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI0001831B03"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6B6"
FT                   /transl_table=1
FT                   /translation="MLPSILSLLGLLLFALEANAIAIQPISRQTCQSTGTHCPPGTLVV
FT                   STTSKHASHKTIQSAINSLPDDESPQTILILEGTYTEQVNITRSGPVTLLGQTTSPKDA
FT                   SRNRVRINWAAGNRDNTGGIDNVFFSVMVVAPTLEASLTGTGPTGYPVPADTPFGNKDF
FT                   RVYNVDFDNTWAEYSDGPAHALSLSRANGGFYHCGFYSYQDTVYIGKLGNAYFYESILA
FT                   GQTDFLYGFGTAWIQSSALQLRGCGGGITAWKGTNTTIPNKYGAYIVDSSVRAANASIA
FT                   ADIKGACALGRPWNSQHRSIFARSYEDGSVDPRGYIDWVVDGVSRFEEGVTLMAEYRVH
FT                   GPGVNETARVEGGVTSVLGQEEWEMYSTPQKVFGDTEWIDWEVVKEN"
FT   sig_peptide     441025..441084
FT                   /db_xref="UniProtKB/TrEMBL:B6H6B6 "
FT   mat_peptide     join(441085..441639,441709..442254)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6B6 "
FT   CDS_pept        join(complement(443485..443521),complement(443244..443426),
FT                   complement(442805..443179),complement(442326..442735))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000276736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945490"
FT                   /orf_name="Pc15g01820"
FT                   /product="Pc15g01820 protein"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP83068.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002283"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI0001831B04"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6B7"
FT                   /transl_table=1
FT                   /translation="MNPNEPPIIDFAPFYANDSAKEDLIRQIQQACEQFGFFQLINHAI
FT                   PTELQTAVLQHSSEFFNLPLETKERYNQATGGFNRGYERLRSQNFEKRTKGDLKEGFYL
FT                   GKDLPLDDVYVVQRRFGQGPNKYPSEVPDAEGFRRVMDEYHDAMIELAVAIMQVIARTL
FT                   GLDEDVFSNFCDHPVSILRLLHYPSQEADASDLERGIGAHTDFGAITMLLQDDTGGLQV
FT                   WNNLSSEWVDVTPVPGAYVVNLGNMMMRWTNDRYLSNLHRVINTSGKERLSVPFFFSGN
FT                   PNYTIRCLPGCEDPEGARYPPITVHEWMTGRYADTYGTSDGKAIGELRREPDA"
FT   CDS_pept        join(complement(448963..449006),complement(446703..448899),
FT                   complement(445082..446449),complement(444008..445033))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977028"
FT                   /orf_name="Pc15g01830"
FT                   /product="Pc15g01830 protein"
FT                   /protein_id="CAP83069.1"
FT                   /db_xref="UniParc:UPI0001831B05"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6B8"
FT                   /transl_table=1
FT                   /translation="MADPTQSHGHGAQKLPSPPNVRSPLSAGSGSGTPISFQTNVNRSK
FT                   TKRWVEAKKYSYDGGDWGSDDDYEEEEEEEAPPAVPRPPYATHNTGSSSELSARRLSGI
FT                   GFGTGAAESAPADGKGRTVSGGDQKALPFVRPADLYKRMREEKATEQSPITGSNEPKSD
FT                   GVGVPPQTNQENPDLGLPEVKRMSSFGTDFLGGAEPNPPTDSPASQEPSLHHNPSPGFR
FT                   SVVNQAFDVPETPQSTTTSVARSNSDGTSTISPIMGGRTMTDERTPTILEEPNESSSPK
FT                   ATANAVPGFNPGHRRDLSLPSSDNSPSRKPQVTDQDTPIAGRAELSSIPPLENPSPESP
FT                   DAGISPQKPPMQSYSNNGQDMPAPLKFGSASGPDTFHPEIPTIMGAEESPQNTDNDRLR
FT                   EEIIRSLSREATPSDDPEPSHQPQSQAPAESVPQQTTVSESHPDWTSPPPLASQDPYPT
FT                   SQGAAGNSASMVVDQPKKPKLERRFSWESSDSSETEPPQMPGSYSSPPPLATSLSMQEP
FT                   EPIREESAPLVSDVSHDPLASEDEASSTQRAVERPRLSIVPPVPENITPPEQVMGPGAT
FT                   PPPQLQAPNVDSSSLDESKLLGFRDILGITSINQRIKSFEHTRDQFATIDTGLNHWLEF
FT                   TVHDHPEHADVVQQSQNLSPTVPLSDPSRIRFPKLGALSNLGSLNDGTPTNATHVRRPS
FT                   GHLGTVMNKDKVGEKGKEFLHTAGAFSGKATGAAKGLFAKGRSRFRPSGGSEKVQSTQN
FT                   ASRRSFQFSFPSGTGEVSGNSSLRNSVTFGSLPIFKSEQTGLNSDPDPPVSFCLDGPQG
FT                   EHNGGKRVKATKSGNNNQSHNHVGETTGQRDQLPSSNGVPPKAEVPGKSAFAGDLEQEM
FT                   IAALGLSPTDPHPRRAASTPMVLNAFSQVNGGKRQFTEPLPQQGESTTGNQSDAEAPAS
FT                   KDPVAEKGLPVIPDEPFHIPVPVVNSQRHQPSKSTPAIVTPSIRPVLDESPKPPSPPPK
FT                   DNGNGLAPSQGHGRQPSVSTLGPDEQTGRTSNEEIDRDPPSPLQETAGVVPEPRYESKV
FT                   EQSADDAPGSLASAQKKRRSFIPFYPSEFTSSAEVLESKRKSISGLPPSVPDVHSPLRN
FT                   EVRYSPGTRSSMLSFGSFGKQSANGKGTRPSTPANGLSQPSESGSPAGNGESTIGKLKE
FT                   FGRRRRASVGDLLSGIQLQGPQAPQGGQRRRTFSRISVLFGRQDSQDAERKSTDHKRTT
FT                   SEQLQNKYLPTRPSTTGNANTSVAAQDEPPVLSNPFEQTPLPTQPPEPRAPPPPPPSDA
FT                   KPPCDDRQRASISLPSMSIPSSSSSNSLGTGRFYSQFRSGSMNETPNGSRHASTLSQPL
FT                   PDHSRSPSPMSFQENRAVPSLSPLEELQDHQIHQLQKEEQLKQKAQQDQNGDPQLGTLN
FT                   ENQEREEHEEHKDRMVGDPLRHELYGEISEAPTSKQNNPEQVHELQGNLKQQILAPQLS
FT                   IRSRKPVVSDLTCPASENHAPRNIAVSNASAISAHPHRSEDEARVVNNPPQPVELAITA
FT                   DDSSEEIVMSPTSYPGQEWTPMHL"
FT   CDS_pept        join(449756..450014,450066..450247,450302..450874,
FT                   450932..450964)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194860" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823836"
FT                   /orf_name="Pc15g01840"
FT                   /product="Pc15g01840 protein"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP83070.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniParc:UPI0001831B06"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6B9"
FT                   /transl_table=1
FT                   /translation="MTGPSIQDRTSEFNAILGHAQKRLGTSKVGSQRQALLTDAQRRQA
FT                   NASPQGAGQEAKAARSEFARRARDIGRGITGTMAKLQRLAELAKRKTLFDDRPVEISEL
FT                   TYVIKQDLAALNQSIASLQALTHAQHPKSNRSKTDQEGEHNDNVVVMLQGKLADVGASF
FT                   KEVLEVRTKNIQASRSRTENFVSSVSSKSHSALDAQRSDSPLYNTSGRRTPQPGYQGNS
FT                   SDLLTLEPSNPSPLGRPSFQSDQQLMVMEEGESSNTYVQARGEAIEAIERTISELGGIF
FT                   GQLAQMVSEQSEMIQRIDANTEDVVDNVQGAQRELMKYWTRVSGNRWLIAKMFGILMIF
FT                   FLLWVLIS"
FT   CDS_pept        join(complement(454795..455090),complement(454290..454743),
FT                   complement(453834..454041),complement(453560..453614),
FT                   complement(452635..453506),complement(452155..452522),
FT                   complement(451850..452103),complement(451299..451791))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945491"
FT                   /orf_name="Pc15g01850"
FT                   /product="Pc15g01850 protein"
FT                   /protein_id="CAP83071.1"
FT                   /db_xref="UniParc:UPI0001831B07"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6C0"
FT                   /transl_table=1
FT                   /translation="MSPGDDIAFVSELFPPSPPEYSTGMAHDNAGYSLGYLGDLKRCWN
FT                   TCIRLSYHLADHVVEHHLETDIIARPLWSSSKTEREVIYSKAVASLQAKLLHPIAYAVF
FT                   FLESAASSGSDCGHPAHQYKNKAYSIERQQSILRNAPFDDTLVFLSTHHCMQLLFSTVQ
FT                   RLMGPEIPRSSAKSWLSILLTTSTMERIVDFFVSIAKDNQRKEKGEHESTWSHRKEFLW
FT                   AMRKDLNEYMASFNGQGEHTLLVPELNHSTILNADRKQDHMDITKLRTKPLPLGSRQFG
FT                   RRTPQSRTSTRFLSLPLKCLGYHLNPKFRWEFRRKHVCCAECLRNRQARVHRPRVSRLE
FT                   TLTQRLAKLEEASNKEAINFPTTHHAASSTSSSPSAKLTSITGVLNDKQKRYRAYDPND
FT                   MGPLQPPPSKHRKSQAVAQQNVHQAHSPGSTHHASEAREYIEHELQCNPALSKDRRTAL
FT                   ESARKFVSQLSNPTLNWEGTAAIHDMEIQESLESPSLTPELLYMMLPGRLPRLEQMSAM
FT                   LIITGPDKKTNSQGTINWPDHISDSLLEQMGLGIIEGAECEQVLQHYRLNVWVKAMSFI
FT                   SKMGPLVSSEPLRDHFRSLKKRYEAAAIELLNQIPLAAEPSLLLLQSVLSAVSLASRMI
FT                   VSLNYHNITDVSPRTQTEENIHACVFLCYYFDKTLSLLLLRPPSLPDLKVKPTQLIHID
FT                   PDLPTSTMITGVVEYSELKNTLLTILLDTKPIGDTEKANMLSDLVARAHIIHSNMQMFR
FT                   RRQEQQFTQSWSHLRREWLSMDFNYYSVLTTIIQARSSVLKSRLVCENCLYTAREALTT
FT                   LRALQEAFSNRINSIDSYPYFLTWTMLLFPLAPFFVLFCNVIATSNERDFDMIKNITDD
FT                   LHQFAEANASIGKLYKLFSKFLDLCAPLVKGNTEPSRSEQPAAAPSDPNTAENTEAQMT
FT                   SYTDIFGRATGTDQPLARLGGADSTGGGPTAPPSVEGWNDSLVWELFDNQPSLGWAESE
FT                   LWNAMAQFDA"
FT   CDS_pept        join(455836..456215,456271..456298,456357..456818,
FT                   456874..458082)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194872" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671080"
FT                   /orf_name="Pc15g01860"
FT                   /product="Pc15g01860 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP83072.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831B08"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6C1"
FT                   /transl_table=1
FT                   /translation="MASPYNSLHGATDSPSKQPASYACVVCHNRKVKCDKQDHRTPCSN
FT                   CAKANVECIYRAPPPRRKRNRETNGSVSQERAKHLRRSTGFDQNPPARQHHHHAAGDQR
FT                   TEPEKSGSGRMIVKDGNSIYLDNNLWTSVSNELPNAGDVLDDGSDNGTENFDQDVSDDY
FT                   AILSTSATKKVLTELHPSPLNIFKLWQAFLENVNPLTKIIHAPTVQQQILDAMSDLLEI
FT                   SREIEALMFAIYCIALVSLQAEDVEKSFGESKKALLSKFRRGAQLAFKNASLLRTSSSV
FT                   VLQAFMLYLLCMRSFSDPHTVWTLCGIAVRIAQRIGVHRDGSAHGLPVFETEMRRRIWF
FT                   QLMIIDATSAQFCGVAPTPLPTTIDVQPPMNANDSDLDPRMTEPACEKPGPTEMIFVLA
FT                   RRAFGKWLLRLSNQIESSNTGPWAFLSSSSMSLKDKDKTIDELEAHMEDTFLRHCDKSI
FT                   PLHMATTMMVRSAIYYTRMIAHHPRQYQDPDMRISQAERDIIFENSRKMIEYADYAQKN
FT                   PVVRKYSWHTINFMPWDAMIFMLSGMRHRTDPDEKSEVWQLIGNVYSGHIKTMSENGPT
FT                   PLHMAIQHLIVKAWRTYIEECNLNHRTPTPCPTIVASLLANAAGISSPQQEDENFPAGK
FT                   RDAKPQDQPRYDHPSSQFGLDEKFGFLPGDSPQDWNDWDNLLSNFQGSFTDDATYLP"
FT   CDS_pept        458597..460174
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000244262" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945492"
FT                   /orf_name="Pc15g01870"
FT                   /product="Pc15g01870 protein"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP83073.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI0001831B09"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6C2"
FT                   /transl_table=1
FT                   /translation="MKPKTDVLIVGAGPTGLVLALWLHHQGVNVHIFDQAEAPAKDSRA
FT                   IIVHARIIELYRQLGLAEDLLALGYKLPATNLWVHTQHKAHISLQDFGRKLTPYPFMLS
FT                   APQDDHERMLEKRLNDVGIHVERGSKLQGFVDHGSSITATLFREADGSSTTHEASYIVG
FT                   CDGAHSAVRHAIGAKFEGETYKPLFYIADIEGKSDKHFNGEGNVVFTDDTFNLIVPYNK
FT                   AGHARLVGIMAPDNDGHDRESPECEHEITFEDVRPRIMQVMDIDITKVNWFSTYRSHHR
FT                   VADRFRSNRAFLVGDAAHIHSPVGGQGMNTGIMDSINLAWKLATVLRQTKMTEEAKHQL
FT                   LESYESERRSFAMMIVKSTDTGFMTLTSEGFFPHILRNWLIPYLVPLLLRFDFTRTRIF
FT                   RGASQLICNYRGSSLCETVHGTVQPGDRLPWVEINEVDNFSTLRDVCWQLHIYGESLSQ
FT                   VVKWAQEMSVRVFTFHWDDQYAKAGLIKDAVYLLRPDQYIAGIFEGPSVEARLDEYFAT
FT                   RGFYLDRD"
FT   CDS_pept        join(460911..461492,461543..462346)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945493"
FT                   /orf_name="Pc15g01880"
FT                   /product="Pc15g01880 protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /protein_id="CAP83074.1"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="UniParc:UPI0001831B0A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6C3"
FT                   /transl_table=1
FT                   /translation="MKTTALISLLGLSGSALGAAVETGKGNAPFGYKSGSKESIANMKD
FT                   KIENVVWVLLENRGFDNILGGVKKKGLDNVVNNGPFYNLEDISNPDSKKWPSQFKNYDS
FT                   VLNDPDHTLTGTNFELYGTYNPDNEAIANGSLKADLSGFVNRHMLRHPKISAQRAADEV
FT                   LGYYSEGQIPTIVEMVDEFTTFNNWHSCVPGPTNPNRLCAVSGVTDGHGKNDESFDVSS
FT                   IESTSIFEAASEKGISWLNYDGTNGAFNPDALFFDWTTKNAKSNVVPLENFYQDAYLGL
FT                   LPQLSYINPSCCGLNTNSMHPAGNVSFGEVFLKQIYDAVRTGPQWEKTLLLVTFDETGG
FT                   FYDHVAPPLAVRPDNKTYTEKAYDGSEYTFSFDRLGGRIPTWLLSPYTPKGHVEGYGTD
FT                   PVTGESSSYSATSVLKTLGYLWDLKDLSPRVEHSPAFDHLIGPMVRSSPETLKNPHTFP
FT                   NAI"
FT   sig_peptide     460911..460964
FT                   /db_xref="UniProtKB/TrEMBL:B6H6C3 "
FT   mat_peptide     join(460965..461492,461543..462343)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6C3 "
FT   CDS_pept        join(463368..463841,463936..464260,464325..464446)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000258140" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977029"
FT                   /orf_name="Pc15g01890"
FT                   /product="Pc15g01890 protein"
FT                   /function="copper ion binding"
FT                   /biological_process="cellular copper ion homeostasis "
FT                   /biological_process="copper ion transport"
FT                   /biological_process="respiratory chain complex IV assembly "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP83075.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006825"
FT                   /db_xref="GO:0006878"
FT                   /db_xref="GO:0008535"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017276"
FT                   /db_xref="UniParc:UPI0001831B0B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6C4"
FT                   /transl_table=1
FT                   /translation="MPSPMRLASGLFTRATRNIAIESTPTQRILPLLRNNTASQCRAYT
FT                   QAQRPRCNQNMRTMTSAHTNFSTSAFRAGPKTMGQMRQRNSTGPFSWKAALLFVLTGAG
FT                   MMLYFRVEKARLERKRMTEMSKGVGKPKVGGPFVLKDLDGKEFTAEDLKGKYSFVYFGF
FT                   THCPDICPDELDKMAEIIEKVKAATGDEKLFMPVFITCDPVRDTPEVLREYLKEFHPGI
FT                   VGLTGTYEQIKHVCKQYRVYFSTPKDVKPGEDYLVDHSIYFYLMDPDNDFVECIGRQDT
FT                   PESASKVIMEHINDWKREGKPLKTE"
FT   CDS_pept        join(complement(466976..467447),complement(466165..466924),
FT                   complement(465640..466106),complement(464747..465336))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000220641" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128150"
FT                   /orf_name="Pc15g01900"
FT                   /product="Pc15g01900 protein"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="Mo-molybdopterin cofactor biosynthetic
FT                   process"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP83076.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0006777"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001831B0C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6C5"
FT                   /transl_table=1
FT                   /translation="MATPGNSNHRAWWKESSVYQIWPASFKDSNDDGIGDIPGIISKLD
FT                   YIKNLAVDIVWLCPSYKSPQVDMGYDISDYYSIADEYGTVEDVEKLIAGCHQRGMKLLM
FT                   DLVVNHTSDQHEWFKQSRSSKDNEYRNWYVWRPAKYDEQGNRQPPNNWVSHFQGSAWQW
FT                   DELTQEYYLHLYAVEQPDLNWEHPPVRKAVHDIVRFWLDKGCDGFRMDVINFISKEQSF
FT                   PDAPIKDPRTPWQWGDKWYANGPRLHEYLQGVGKILKEYDAFSVGEMPFVTDEKEVLRA
FT                   VQFDRNEINMIFNFEHVDIDHGKYDKFEPGSWKLTDLKDFFERWQTFMYANDGWNALYW
FT                   ENHDQPRSIDRYTNASEEYRLVASKMLATALALQAGTPFVYQGQELGTRNVPKSWGIEE
FT                   YKDIDCLNHWKRLPKDDTAAQAIALQEYQKKSRDNGRTPVQWSAAENAGFTGPGVKPWM
FT                   SVNTDYVRVNAEAEVKDPNSTYHYWATVLKLRKKYLDVFVYGNFTLLDKPNQEVFAYTR
FT                   QYGDQKALVVCHWTEKTLEWDAASNGITGVKQVLLDTYEGVDEASQRFSEHNPIPSTPL
FT                   IPQSNNKMSSSEQAQLPAHLDPKTYPRTHHDATQNIHITLTYGTLDANTYLSQTSSPAA
FT                   GANILFLGTTRDTFEGRPVSQLSYTTYPPLALKTLTGIAEAAVKTHRLEGVSIAHRLGT
FT                   VPIGEASIVIAVSAGHRGAAWKAGEEVLEACKEKAEIWKREEFVDGGMEWRANADRDAE
FT                   GRVLGTGAV"
FT   CDS_pept        join(467591..467674,467719..467797,468253..468419)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945494"
FT                   /orf_name="Pc15g01910"
FT                   /product="Putative uncharacterized protein Pc15g01910 "
FT                   /protein_id="CAP83077.1"
FT                   /db_xref="UniParc:UPI0001831B0D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6C6"
FT                   /transl_table=1
FT                   /translation="MANRSYLSHRGADADNHRGPQGLICRPEKPHDVDGLHLDDYRYDD
FT                   TTRLEGFLAVSQVSSDAVEQSAYNIPETLKGPTSVGAEIPYAGIGLEISLSELPRSPRF
FT                   QFSSI"
FT   CDS_pept        join(468468..468582,468705..469000,469094..469169,
FT                   469235..469428,469538..469598,469654..470000,4
FT                   70059..471534)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194939" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945495"
FT                   /orf_name="Pc15g01920"
FT                   /product="Pc15g01920 protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP83078.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001831BDD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6C7"
FT                   /transl_table=1
FT                   /translation="MAPPYRNDNFSSSSSRRPFPSRNDHGRMYDDRSRSRSPDRARSPR
FT                   RLAADGRPEYPRDRESGQGYRNHDRDDYRRRTSRSSPHRGRNTYKDRDREGYRSASGNR
FT                   SRTRSPRRGQSRMGQVSREVMMDGLPVDMEEEHIATELRNAYHIDGLENIRVIRDRQTR
FT                   LSRQLGFLRFPTIDASRDFVERNHPFIFFYGPTNDRVTQVRIAYSREREDRARARGASD
FT                   WNCRTCLVLNFSTRSHCFKCGIPRPDMDSTGPPGASAPKIANEGDNDVAPEGQPSQFLL
FT                   IRGLAASVTEELLAKGVSKLYRPSGNNDSAPDNQKKGSKVASTTGDSNLGAREGSLRRV
FT                   LLVRDRRTNESWGYGFAEFAGITDAQAAMARLNSFEKFTISSKPVLVSYIHGGVFVPVM
FT                   NAPSGASYFTFSPSNNPSLKLMYWDDAAFVTELVVSTEEDDAAQEQRANKTTSNQGDAQ
FT                   AKGMKDSDKGKKRKVDGPASASTKKLAMPSQLQFWSDRHAELHGINRDAAGNPAESSSS
FT                   VTPATESAPPAIEPAAPAIEPAAPAIEPAAPPAPSFADFDKNRCLLCMQDLVNAGHLRY
FT                   HERESDIHRENLKDINLRIRGICWMIIYHVIPMPTPNYKDSKDEYREALEREYSVPPTA
FT                   RSFADLKRNCCLLCFTEFDTPEDVLVHDRVSKRHLEQLQDEEAVKEGLDRLKQAGIAQD
FT                   IKPAAPTAPDAPTAPTAAAAPAAPTAPTVPAAPDAPAAPEYRDRAKERRAAFGRDDANA
FT                   RQRPAEPEEEDEAPVQTTSIGASLLSKMGWTEGTGLGAQGTGVTEPIPTEIYAQGVGLG
FT                   AQGGRLGEATEEAGRNTRGRYDEFLEKTRDTARQRYEEMDRS"
FT   CDS_pept        complement(471841..472443)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194927" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671081"
FT                   /orf_name="Pc15g01930"
FT                   /product="Pc15g01930 protein"
FT                   /protein_id="CAP83079.1"
FT                   /db_xref="UniParc:UPI0001831BDE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6C8"
FT                   /transl_table=1
FT                   /translation="MVSLFGWGSSPKPESSQPTPPQEKPTPDESATPASTQSQIAQPPS
FT                   PQTNTNLKLLFGGMTFFALSVLVTRRAFHKKRISCIPPFYTSSVYHQPHSNSAGDAFEA
FT                   LNLATLNVLSFGLMAGGAVGYALNINGLEDMRRFVRNGLQGGSDTPVKSDEELEEEVTE
FT                   WVSKILGDKFEKQLEKEKMKRAFQKDKVDQDTEETRS"
FT   CDS_pept        join(complement(475808..475850),complement(473319..475714))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194916" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945496"
FT                   /orf_name="Pc15g01940"
FT                   /product="Pc15g01940 protein"
FT                   /protein_id="CAP83080.1"
FT                   /db_xref="InterPro:IPR021840"
FT                   /db_xref="UniParc:UPI0001831BDF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6C9"
FT                   /transl_table=1
FT                   /translation="MSNPTRNFSLRNVNTSKPQLARTESQQSVAASDDYYSFSDRAPSS
FT                   PESVATIMRFRTADSHAPSPAMSQIHLAQEDPESQRPPTSSTVRFAEDRPDHVSPISDT
FT                   TRSDETALRSPADYPGPAPTPGMDDSPYVRFAIDQLTQDRARGVQRTDSISTTTTSDYP
FT                   TDRMVWDEGLGYFTRTRTPIRHDAPPARPSYTSPSPQALPQRPVSVDPESFMAVDAPEQ
FT                   SLLYPALDYLPLVLRPWALALTIFCCLLMMAGIVFCNVWSRGEEGLWNYLRQGDSRYFV
FT                   LQFLPQIVAAPLIIWLFVIQAAVYRIAPFSIMSAERQEGLVINRLPILSKNFIFPDFSH
FT                   FRHGEALFGFSLFTIWLSNFFAIPLLSCLFQAKYYIIDGQGVWRWASVQSVGWTLVGLY
FT                   GVLTLGLIMLFVRFLRGRSGLMWDPVSLADLVSIIQRSNILHDFEHSETVPSVRESLDP
FT                   RVLRLGYWKLSSKTEVFYGIGEVDAPVRTPSLHQTSKSRETQPHGLAKVCFDIEHNGAF
FT                   ANDPNDHHLYSPSTRYRWTPWFLRKLPVFIWILIVFALFTAFVAVSFINSAIEGGFPPK
FT                   LPSLPSAGAFSSSNFLYSFIPALIGNVLFLAWQPVDVYFRALQPYAELSCPSGASAERS
FT                   ILLSYPSCFPLQVTIQAIINRHFKVAWISLMSLLSLAIPILAGGVFVALWFPSHDDIRI
FT                   AAFLPAFYALIGFCGLYAVSFLAIWPGRRRYLPHDITTLADLMSYLYQSPLLSDKILRE
FT                   PRSKTDLVTRLIVAPPSERQLPSYGFGIYVGRDGKEHLGIDRFHRPGRSDMLITTGNMK
FT                   "
FT   CDS_pept        join(complement(477542..477704),complement(477206..477299),
FT                   complement(476992..477109))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671082"
FT                   /orf_name="Pc15g01950"
FT                   /product="Putative uncharacterized protein Pc15g01950 "
FT                   /protein_id="CAP83081.1"
FT                   /db_xref="UniParc:UPI0001831BE0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6D0"
FT                   /transl_table=1
FT                   /translation="MPRSSKVGLVLYALGLRPTPDHQMDARAIWVWGRPRPSQLIQNRH
FT                   RDTEKFISCEKDASQREDRQSLTISRSNLCLEPQHTSDLIMDSLTSFSKTMAYAWKMAK
FT                   TRPITSGGRHEQCEVSLCTD"
FT   mat_peptide     join(complement(477542..477650),complement(477206..477299),
FT                   complement(476995..477109))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6D0 "
FT   sig_peptide     complement(477651..477704)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6D0 "
FT   CDS_pept        join(478539..478972,479038..479265,479436..479964)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(482765..482954,483007..484252,484312..484555)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194905" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823837"
FT                   /orf_name="Pc15g01970"
FT                   /product="Pc15g01970 protein"
FT                   /protein_id="CAP83083.1"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI0001831BE1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6D1"
FT                   /transl_table=1
FT                   /translation="MLLKPATPLSILLLIAFVLLLLSCLSTPIVKGIPLATFKDVDYGV
FT                   FGYCKGGTCTNIHVGYTSNDISNTGDDFNLPAGPRKSLSSILIVHPVAALLTLICLCLA
FT                   IAAHFHAPSHSPRFLLTLLILLLPTLLVTLLAFLVDILLFVPHLGWGGWIVLVATIILT
FT                   SCGVVTCAMRRTLVSRKARKRRIAENSEMSGENYYNRQNAAAAAIAPPVPAPVEPKEAF
FT                   MSDSLNSDSAPTFATFHTETRDSDDDRTPLNSRTPMSDIPAPPDHRGGPYRAPDQFGNA
FT                   PPQGSGPYGAGPMSRNPSDPRVRPQYSDGSMGSRRGGAPPGFNGRGRGGYPPRGGRGGP
FT                   YMGPPRGPSPGTRGGYMGPTPGRGGRGGMMPYRGPDGYGHGPDGPNRGFDAYGRSVSPP
FT                   MDDPYGYGPPGQMRQPSPGPIGMAVSPETVGQAIEMTPQSRPQYDMHESAQPMTSVPQA
FT                   LSAESNGAVPESPTSMYSRPGSYIPPRSGWGAADPRTVSPRPPGQSPQHPNNNGPTYYE
FT                   DVDPRFARRPSPPTDSTIPSSLTPGAARCAYCHIPHVLTEPC"
FT   sig_peptide     482765..482842
FT                   /db_xref="UniProtKB/TrEMBL:B6H6D1 "
FT   mat_peptide     join(482843..482954,483007..484252,484312..484552)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6D1 "
FT   CDS_pept        join(complement(485063..485161),complement(484693..484908))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945497"
FT                   /orf_name="Pc15g01980"
FT                   /product="Putative uncharacterized protein Pc15g01980 "
FT                   /protein_id="CAP83084.1"
FT                   /db_xref="UniParc:UPI0001831BE2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6D2"
FT                   /transl_table=1
FT                   /translation="MAIRGRYNITIAVMARVLQCSGRSLKLMGSAKKIKPEILKIGFCT
FT                   SYSPVAIHQSSGRAQPSSEKETFVLNAYASWRMFEHKMKDRILAPREALCGGMGRKKTP
FT                   "
FT   CDS_pept        join(486650..486953,487074..487144,487234..487518)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945498"
FT                   /orf_name="Pc15g01990"
FT                   /product="Putative uncharacterized protein Pc15g01990 "
FT                   /protein_id="CAP83085.1"
FT                   /db_xref="UniParc:UPI0001831BE3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6D3"
FT                   /transl_table=1
FT                   /translation="MYKVGDTRPIPSPNDAQLERLTSLTERAHRRSRQRNKIAKEETRI
FT                   LDAKEQIMAVNQFDYATQRQLNQMVGQLERLNDVLIDVLNEEEMDAIEEERIWSQMVRL
FT                   SLSSTSRALKSVSYITRCRSQAWTGVKQASTIWQGMSARSTVGLKIKSLSVGREVFILV
FT                   ARSQRGVVDGDDNVVSFSFGIERNRKGATVARVDHCDGVREIQQEAFGAHDVGAVG"
FT   CDS_pept        join(488475..488544,488744..488818,489149..489540,
FT                   489675..489704)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945499"
FT                   /orf_name="Pc15g02000"
FT                   /product="Putative uncharacterized protein Pc15g02000 "
FT                   /protein_id="CAP83086.1"
FT                   /db_xref="UniParc:UPI0001831BE4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6D4"
FT                   /transl_table=1
FT                   /translation="MLFEIQEEEAIDAIEEERIWSQIVQNRWGVLMGLLVGYRCLSTWN
FT                   DCLLGDTRPIPSPSDEQLKELEKLNERARRRVRDTKTIHQEIARLLDEKAAMTASGLHF
FT                   HWFYREQLQGIEQDLVWLYQDLRDIEKEQETDVAKEKEIWNQSVEHGESRDLSSLPTLG
FT                   SSALLHPFSIFLRLPMVWATLGSHH"
FT   CDS_pept        join(complement(493870..493989),complement(493724..493809),
FT                   complement(493392..493535),complement(492944..493271),
FT                   complement(492076..492738))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945500"
FT                   /orf_name="Pc15g02010"
FT                   /product="Putative uncharacterized protein Pc15g02010 "
FT                   /protein_id="CAP83087.1"
FT                   /db_xref="UniParc:UPI0001831BE5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6D5"
FT                   /transl_table=1
FT                   /translation="MTSLARGEHLERDNKLMLVILQVEHNSHSFINRIPSHRCHNSRRV
FT                   AYRHWLLRRAPIPDDLMSNGTPERCALRSLGMGDYVWELMLGRSDLYALSTLLSLFASL
FT                   SRNVAVLPFFFIGCRIESQIHPIPRALSKAKLTNECKVAEPRPIPVPSSLQLGELTHLR
FT                   YRALQREAERRRVHAFVDRAIADLEAAMVGIPDSVITRWRGRWERLGARRLHRIDEEQE
FT                   EDAETARKVLADAAYWVQMIKREINRLNQEIGRAEEVVLTHVRHYQQKVGTKEHKEAPE
FT                   NRNRKRRGMPALGAPTDLGGMTGSGREARRQRIDVGPMGGDKPGFHGAMQGARSPEYAP
FT                   ISPPMGFDPMDMAMGDPIQGSPVSPDWWDPLIIRLSTLGALHQGVLTAEMEPKSASKVR
FT                   VRFGSNECTEGSLWILCSSTSLQYLFTCCFLCALPGQWSFKISLLDA"
FT   CDS_pept        join(complement(495882..496059),complement(495502..495785),
FT                   complement(495212..495405),complement(494448..495138))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945501"
FT                   /orf_name="Pc15g02020"
FT                   /product="Pc15g02020 protein"
FT                   /protein_id="CAP83088.1"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="UniParc:UPI0001831BE6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6D6"
FT                   /transl_table=1
FT                   /translation="MPPNPNPMHFYFGSLFIGGREIQELSWRLRPEFVEKDPKHESYVD
FT                   YSQYMRRYPPPEQFVADTRSIPSPSDEQLKELEKMNERARRRVRDIEIIHREIERLVDE
FT                   KAAMTALLALGIQWICMGIPSTWMERPLNPVLSTSYSSPSDRVTRGDSRQTLFPTLLPN
FT                   QANRHQVADLRSIPVITNDRLEELADLQSRAIQREVARVRIEETIACAIADLDAAIYGA
FT                   SRKKRRETKSMSVGCGAGLAKCEINACLPPRKPLVPFNYVEHFYESLLARPDPLLLNID
FT                   GKAGTGKSHLIMLLSATLTRIAREAGVRTPILCAALTGVAAFNVMGRTLHSLFRLPLKL
FT                   TGEHVSPRTDTLKAIQEVFHDIRYLIINEKSMVGLDMLLWIEQRCREIFPRSRDRYFGG
FT                   LNVLLVGDFFQLPPVRQKPLFSDLATPKPRDLHAKAFYTALTGLSSLIL"
FT   CDS_pept        join(496742..496843,497379..497444,497508..497768,
FT                   497898..497978,498073..498114)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977030"
FT                   /orf_name="Pc15g02030"
FT                   /product="Pc15g02030 protein"
FT                   /protein_id="CAP83089.1"
FT                   /db_xref="InterPro:IPR008010"
FT                   /db_xref="UniParc:UPI0001831BE7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6D7"
FT                   /transl_table=1
FT                   /translation="MSPVADTSEAPPERKTAEHSVENGSNGSLKAEKQSSPHYLEGTHS
FT                   RLDNPVAQFNGGADERPINGRDNTNGQWRHGTPSERHHTNGVHKASDSVSEQGLGIIVE
FT                   HSPNDPDHIGRLSVVDVYDGPKVKAALAELAGDLSHLSEDKEKVMKLSPEKIQALTSSP
FT                   ESIPYRPVGPETNDGRRVVSDNVHGSVSASQPEVPELTLQSLGEKPPPADILPKLRPAK
FT                   EVLLGDASAPASPAFPRNTQNPPFRNRPQPARTVSTPGSTRRQLPFTPSNDRLTQTWAS
FT                   RSKQDRPALDREFKSHLIASPQLVESAMPSPLPSSIPLPPVSLPTYLQLELASGRPSPL
FT                   YIHRDAASDFPYESSRVKIERLMNFIMLAPMLEQVLCFGSLACLDAWLYSFTIMPLRFI
FT                   KAVYILGESWVMNVGAEIRFIWKFSMPSALLPDDKADILTGLLMIATCCVLMYFDASRM
FT                   YHWIRGQAAIKLYVIYNVLEVSDRLLAAIGQDVLECLFSREALERRPDGRSKIIRPFWL
FT                   FLVALVYTVSHALSLFYQVMTLNVAVNSYSNALITLLLSNQFVEIKSTVFRKFEKENLF
FT                   QLTCADVVERFQLWLMLTIIASRNIVETGAFNSVNSFIPTLAQVLGPFLVVLGSEMLVD
FT                   WLKHAYINKFNNNRPAIYSRFLDVLAKDYYTNAFGEQNLTRRIGLPVIPLSCLFFRVSV
FT                   QTYQMFLAALLPQHPSSTANGATSLTSIHNNYGPSPIPSAPPLTFATLLPASAAHVSAF
FT                   FRTLLENAIPSPAQSVHIFTGILLLTGFIVLLILKLLLGMVLLAFSRSRYRKMKGRENE
FT                   RRQANNQSGTESGAPRSRDFDVEGSQRVGGWGVVEVGDEKRRLIYADDPDGLRRLKEKE
FT                   EKDKSKDGEFNVDHVQRYEMIAKKIW"
FT   CDS_pept        join(complement(499045..499119),complement(498478..498787),
FT                   complement(498189..498310))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823838"
FT                   /orf_name="Pc15g02040"
FT                   /product="Putative uncharacterized protein Pc15g02040 "
FT                   /protein_id="CAP83090.1"
FT                   /db_xref="UniParc:UPI0001831BE8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6D8"
FT                   /transl_table=1
FT                   /translation="MPRWKSFPDFPQFNYGTHYIDYMDQTCLRSLQLPPFEQSLFSELA
FT                   PREQVQFPYMNSFSAVCCNDGQTYSTCRSYTQSTKMVKSCDSIQWRYTATSLRSMQNPA
FT                   RDAKPLNTDKALVLAHHWLYWCASGICQICGLLSDRHGLRPQYAVVPRHTPGDIRSGAT
FT                   FSTKL"
FT   CDS_pept        join(500066..500176,500351..500368,500734..500806,
FT                   500843..500910,500962..501084,501199..501235,
FT                   501271..501398,501552..501755)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823839"
FT                   /orf_name="Pc15g02050"
FT                   /product="Putative uncharacterized protein Pc15g02050 "
FT                   /protein_id="CAP83091.1"
FT                   /db_xref="UniParc:UPI0001831BE9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6D9"
FT                   /transl_table=1
FT                   /translation="MKNLDSVIIEWVSLFICVCISRLSWRFGDRRGDHEVANCRVEKEL
FT                   LEVTNMVKPYSMDSKDGKDSKDILVVGSYLIIDGICIDLKTRKSLLLPGVRRVGPARGL
FT                   GYRAERIDPLTLKIQWLYIREVRSGSHGERLNIPHLQVIGSSSSTVISLVLVDRHAVFL
FT                   EVRPWHDVDFAIDFVGFICTFHVRTTRLGISTDDLRVKIAPNVRLVASGCESDAAMLVG
FT                   VSLSDSWEDVEGSWVTARPNQVPCRIPHTFP"
FT   CDS_pept        join(complement(505083..505170),complement(505005..505023),
FT                   complement(504689..504950))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945502"
FT                   /orf_name="Pc15g02060"
FT                   /product="Putative uncharacterized protein Pc15g02060 "
FT                   /protein_id="CAP83092.1"
FT                   /db_xref="UniParc:UPI0001831BEA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6E0"
FT                   /transl_table=1
FT                   /translation="MISANFSSLLLLLSFPISQPILQPLSLLQIRHAKSKEVANNRNIP
FT                   TVGEWELDLLTRLRVQREEREQARGQILSEFRLLVGMTQAIIATAHPQDVAAQNMLWEL
FT                   HGRAEILRMEWIVIRSTA"
FT   mat_peptide     join(complement(505083..505110),complement(505005..505023),
FT                   complement(504692..504950))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6E0 "
FT   sig_peptide     complement(505111..505170)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6E0 "
FT   CDS_pept        join(506262..506266,506378..506397,506587..506636,
FT                   506768..506793,506878..506984,507236..507292,
FT                   507365..507458,507709..507758,508014..508432)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671083"
FT                   /orf_name="Pc15g02070"
FT                   /product="Putative uncharacterized protein Pc15g02070 "
FT                   /protein_id="CAP83093.1"
FT                   /db_xref="UniParc:UPI0001831BEB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6E1"
FT                   /transl_table=1
FT                   /translation="MMYNECKHLRPGAYRVKPTLRSLRNTWKETNAGGSDSILLRTTYA
FT                   RLPYKLCIRQGAGTTRGYGYSYYPIILPSHTKAQSTIDGHSKTTNRTCQLYGRSNCSCS
FT                   RTSVIEHEDMCVYEKFFEFVNMLATILDFRYANSVAFNYEPLLSKPPTTEVSRPPAFNA
FT                   AFATICNCKTNKNEVAEHAIPTLREDQLELLSQHRGLREARARVRAKLLREPNYIMDIV
FT                   LMIIENSYYDNFPLHNLLWVLETRMQVLIEQVMALQSGDEEESRIACEIWGAC"
FT   CDS_pept        join(complement(512917..513999),complement(512545..512862))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214518" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823840"
FT                   /orf_name="Pc15g02080"
FT                   /product="Pc15g02080 protein"
FT                   /protein_id="CAP83094.1"
FT                   /db_xref="UniParc:UPI0001831BEC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6E2"
FT                   /transl_table=1
FT                   /translation="MHQFKEGTASMIHIYAMCALAARFSDDPVFHGIARGSRGSIYISE
FT                   AVRLFQQSIITPSLESMQGLILIGYYYGGEGDGKAKHIYTGLARLHAETLSLWEIPKDG
FT                   SLLSQEEHRRTWLSVNIASDWSAIDISVEPISLNHGLDVDLLKFDDIAFQSLDPYLVQG
FT                   TYSSPQSPYNMWAYMARSLGIFNQTSVLLRRMSQGSISFHDYCQEGVVLEGRLDEWEKS
FT                   LPPNLRYTTENITSSVNQRLGRTFLAMHIGYHHFRQILFFPFLDARRNHDNMKLTKNAW
FT                   QCKRSADIISDILRHSTDTENCDLNCFIYGHIAVISSCVHLHTLLFSGNTGALSMARQW
FT                   LLLNFKYLMGIKSYWPVVEHSVARLRKFQNCCQDSVSDPFVLDNWMARFVTEHTSYPSE
FT                   RQDSAANTIDPALQSTTARSICAERHVPDHDNNAKTGCSIDDLSHLLYDQQVTSEALVN
FT                   HALDWLLE"
FT   CDS_pept        join(complement(516320..516368),complement(515808..516257),
FT                   complement(514774..515717))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977031"
FT                   /orf_name="Pc15g02090"
FT                   /product="Pc15g02090 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP83095.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831CC4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6E3"
FT                   /transl_table=1
FT                   /translation="MAKFKTLLTAVFLATGGFLFGYDSGIITSTIGQTEFIKYFSDPND
FT                   TVTGGIVSAFQGGGILGAIINIFTGDRLGRKWSVFTGAAVSCFGCALQAGAINLVMLIV
FT                   GRFIAGVAVGMLTSVIPMYAGEIAEASSRGMMSGLLQWMLSWGYLVAQWLGYGCSFNAT
FT                   SFQWRFPLAFQCVPGLALVSGILFLNESPRWLMEKDRHEEALASLQNLHGDGTPETAQY
FT                   IELEFQEIRDTIQAERMQTKASLTTILRKPSWRRRLILGCGVQAFGVLSGINVINYYGT
FT                   RIYATLGFDTQMSLMIIGISGALSIVYCTGGLWALDRVGRIKPLIFSAVGMAGALVCNA
FT                   AMSQHWDEGNQNQLRAMVAMNFVFSFFYTFVGIISWVYPAEIFPVDIRNQGNSITTFTN
FT                   WTINLVLAQISPSALSGIGFRYFYVFFVFNLIAMLSYIFFFPETQGKTLEQMDSLFGDE
FT                   APLAVEDEKKTSDVVMVEDTSK"
FT   mat_peptide     join(complement(515808..516243),complement(514777..515717))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6E3 "
FT   sig_peptide     join(complement(516320..516368),complement(516244..516257))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6E3 "
FT   CDS_pept        complement(516831..517640)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945503"
FT                   /orf_name="Pc15g02100"
FT                   /product="Pc15g02100 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP83096.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI0001831CC5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6E4"
FT                   /transl_table=1
FT                   /translation="MLYGWYEPIPATPLAKPIAVVCISDTHNTRPDVHDGDILIHAGDL
FT                   TQSGSFQELQDSITWLRSLPHPTKIVIAGNHDLLLDSARDDVSHQTASERTQIDWGDII
FT                   YLENEEVTIYCPNGRQLRVYGSPYSCRHGNWAFQYPRNQDVWAGSIPDGIDVLITHGPP
FT                   LAHLDLLKYGCPYLLQSLWRIRPRLHVFGHIHEGSGTELMLFNRLQEAYEGTVAAGGGL
FT                   KNLLFTAWEFAKEVLRRAVEAKCLLVNPAIVGGLRDNERRQSIKVFI"
FT   CDS_pept        complement(518180..520933)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234722" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823841"
FT                   /orf_name="Pc15g02110"
FT                   /product="Pc15g02110 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP83097.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="UniParc:UPI0001831CC6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6E5"
FT                   /transl_table=1
FT                   /translation="MQISRCGIHGFHEVLGIDTDEIRFYWAIESEDKNATQVFYRIVVT
FT                   TDAAELESDRPDISKLVWDSGRVESNEQRNILCKPSTGFQSTTSHFWRITVWDQTNNAH
FT                   HTAANHFFTAYPRSHLLTPYSMNQTYMPHSSLIFKSWFEDEANRWKAVWIGDGGDKPIY
FT                   LRKAFELAQKPVRAILFASGLGHFNMSVNGQPASDHRLDPGWTNYHRRVQFTSYDVTGH
FT                   LDSGHNALGVHLGNGFYAGDKGGDDRFFWPMYEDNTYVRYGNELCFFGELHLFYGNGEH
FT                   TVLISDGSWKVSKSATTLANIYASENHDRRRYPSGWDSASFDDTEWAPAKPLTGPRGHI
FT                   YYQTQPPVVLHETFQPRKVHSPRKGVVCYDLGQNASTMVKIAVEGAAGSEIIVRYSETV
FT                   REDGTVLMPDPLFKEFETGVFSRIILSGTGQPEIWEPDFSFTSARYIQVEGVSLDAGSG
FT                   LPVIHSAVGRHISSAARKLGHMTTDKADVNSLLSALYWSFSSNLFSYHTDCPQIEKFGW
FT                   LEVTHLLAPATQYIRDMESLYTKILDDILDSQEPSGLVPTMAPEIRYMCGPLHDTITWG
FT                   CALCLLPDILRQYYGSTHVIPKVYPAAVQYMEYMKTKERKGGLIEHGLGDWGRGIAFGN
FT                   NQANIETAVYYRCLQCVEMMAHELGKLQEAEKFKQWSARIYDVYNQHLLVTDDQSRPYA
FT                   YYTSLDNYPERDCDAIAQAMALQFGLVPTKFHSDVMAAFLDDVADGKIRAGEIGLRFLF
FT                   NTLADAKRPDLVLQMVRQEEHPSYMRFLRRGETTLLEFWQDECRSKCHDMLGTIYEWFY
FT                   AAVLGLKPVSEAYRTFEINPPYESEFDHVKGSVDSPYGLILIEFMRTDKTSVKLDLQVP
FT                   FGTTAIVKLPADMRQAEIGSAKEAIKSVHGRELELSHGSYTVFVQL"
FT   CDS_pept        complement(521883..524648)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000244024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945504"
FT                   /orf_name="Pc15g02120"
FT                   /product="Pc15g02120 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP83098.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="UniParc:UPI0001831CC7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6E6"
FT                   /transl_table=1
FT                   /translation="MTHPTITPPSVEQHSSGFGIGVPSPRLSWRFSTTSDDNVKGWKQT
FT                   AYEIQTSRPSRSIETHQVIGNASVLVPWPSEPLKSRESARVRVRSYGTSDGQAQSGPTS
FT                   WSSWTTVECGLLARDDWIAVPIASAIRQPQDSPLRPLRFRKSFCLGNGAIDRARLYITS
FT                   LGVYRAFINGQKVGDQCMAPGWTSYQHRLNYQVYDVAPLLNLNGPNVIAVEVGEGWYAT
FT                   RLGFLGGRRQLYGDRLAVLAQLEVRPQNNVPDISVVTDSTWACCPSAVIKSEIYDGEVY
FT                   DAREEDLSWNSPAAETNQAASWIPAQELPFTTATLVAPDAPPVRVTEERKPIKILKTPS
FT                   GKTVIDFGQNLVGRVRISSMNKPLGSEVTLTHAEVLEHGEIGTRPLRHAKCTDKIISAG
FT                   IELNDWSPQYTFHGFRYVQVDGWTDQDPPLMTNMTALVLHTDMARTGWFTCSHPMVNQL
FT                   HENAWWSMRGNFLSIPTDCPQRDERLGWTGDIQIFCQSANFLYDTAGMLGDWLKDVAAE
FT                   QLLDGDGCVPPFVVPNVISEKLWPHLPQAIWDDVVVLTPWDLYCSYGDIGILRRQYPSM
FT                   LAWIDRGIRRGPDGLWDPELWQLGDWLDPTAPPIEPGDARTNGTLVADAYLVHVTSTMA
FT                   QISSALGETADATRFQSDACQLKSTFQAKYIAQSGLVVGDTQTALSLAIMFDLHSTSTE
FT                   AATAAARLVHLVRLAKFRVATGFAGTPLITHALTKSGHHQVAYRMLLEKGCPSWMYPIT
FT                   MGATTMWERWDSMLPDGSINPGEMTSFNHYALGSIINWLHSSVGGVTPVSPGWKEIRVE
FT                   PIPGGTIDSAEVAYETPYGRLECRWRIYPEDNQFRLELLVPPNSSALVILPSEQHRQTR
FT                   RELDISRDGTWIGSGRYHFSCQWDASSYRYGWPPNPIIPIMRSPEPESIA"
FT   CDS_pept        join(complement(527544..527568),complement(526892..527120),
FT                   complement(526491..526635))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945505"
FT                   /orf_name="Pc15g02130"
FT                   /product="Putative uncharacterized protein Pc15g02130 "
FT                   /protein_id="CAP83099.1"
FT                   /db_xref="UniParc:UPI0001831CC8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6E7"
FT                   /transl_table=1
FT                   /translation="MNTSSHSLSQASNPEPAAFNPSGNPSSYRANSYRAYHTESPPATP
FT                   RSSKGQSPNVTPIWNGGDRANQTGVGEKRFVEPTSRYLLCPEQRAARAADPAAPKLGLA
FT                   QQCAQGDHPKDADDHTPGHQYPNRIRDK"
FT   CDS_pept        join(530430..530682,530738..531033)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128151"
FT                   /orf_name="Pc15g02140"
FT                   /product="Putative uncharacterized protein Pc15g02140 "
FT                   /protein_id="CAP83100.1"
FT                   /db_xref="UniParc:UPI0001831CC9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6E8"
FT                   /transl_table=1
FT                   /translation="MSADCIMIQGSTFALVVYSTLLDMDGSEHQAAVFPARPLITSRTG
FT                   RTEVSIVATWMGWCWAIRGLESRVGEPCTCVSSNLLLIKDSLFNLTHGLFLYSQDFHIP
FT                   HKGLKQLAELPKQPRVGTSAGYDKFVWNNPGLAPDRPSSANDGSASMNPPGSTDAYLRE
FT                   DLKLLVAGGRNWASITHLF"
FT   CDS_pept        join(531598..531789,532152..532348,532890..532950,
FT                   533008..533319)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945506"
FT                   /orf_name="Pc15g02150"
FT                   /product="Putative uncharacterized protein Pc15g02150 "
FT                   /protein_id="CAP83101.1"
FT                   /db_xref="UniParc:UPI0001831CCA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6E9"
FT                   /transl_table=1
FT                   /translation="MALASRKERSNNLVNPTTQTNELIIFFRSKQGISMECVLYNYRVS
FT                   HDTRESNGRQRMNWKVNTVTPRALSRADGGFELRGALETGRAAQAAHHLALELECRALY
FT                   FLSGYIGVLFNESMTYSRPGLRYASWLRISKATIIPSTGSPSPPRKEQVPGARQIPAPG
FT                   NEQVELLTQLRLARTWRDNERRAIIRDARMIRRRAVNIQVEYATNGQPPRARMLRGLRQ
FT                   WLEVLMSIMQSLRAEEEAAREMKAEIWRNVE"
FT   CDS_pept        join(complement(535443..>535560),
FT                   complement(535148..535236),complement(534702..535040))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
XX
SQ   Sequence 535560 BP; 136750 A; 130681 C; 131267 G; 136749 T; 113 other;
     agtgactctc ttaagagcag ggaactgttt gacgctttat aagaaggcgt gcacgtcact        60
     attatcggcc agcacatcct tttgctggcc caacaagtgc tggtaatact tccagcgctc       120
     gctcagcgca ggttgtgcga aaacttgctc tcggcgcgcg atatgatcgg gacggtccac       180
     gtctcgaccc ctacgctgtc tcaggacgtc gaggttttcc tcgcatgcat gtttgaacca       240
     ctttggactt ccatcctcga attcgtgtcg ctcaaggatc tgctcctggg agtacgagcc       300
     gtattcctgg gcccattctc tagtgtttcc tgcttcatct tcgtccgaga aattttcatt       360
     tccctcggca gattcgttga atccgtgagg ccccctagct aagcgcacct catcccaaat       420
     gatctcagtt acaccatggc ggaatttgtc gtggcctgct atacagcgaa agacttcgac       480
     atttagtggg tgggcggata agaacacgcg gtcgatgcgt agaatcgacg cattcttaaa       540
     ttgtacacat gataggcaga gattcttgat gtcggagttg ggtagacacg atgatatgca       600
     tccccatagc tcgaaagggg ggaagggaga gtggcgtgag ccatgaagtg atagacctcg       660
     ggagatgaag tgatgaagat gaaattgtgg aatggtcaag atcgcgggag taagccactc       720
     ctccgcccac agccacaaca gttttccttg cttcttctcg cccaactcac gtcttcttac       780
     ctacgtcaaa ttttgttgac atcaatattg caagcaaaaa tactaagagc gcacaagata       840
     acattcaaag aagatttgca acggagatgt tcaggaatcc cagagaggtc gcacctaacg       900
     ccgtatcttc agcattcagt caaatactca atcctctacc tgttatatcg tggggacagc       960
     ttacaatgta tcatttgggt gtcctaactg gagtaggggt gagtatttcc tgtcttacta      1020
     tttggtctta ttcttactgg ctatcatagt agtattatat gtttgttatc cgagaagaac      1080
     attatcagac ggcgatacaa aagctcaaag actctggatt cattcaggcc ccccctaatc      1140
     gtaggcccgc ccctgaaatt atagagtctc tcccagatcc acaagccgtc cttaatgaga      1200
     ttaaccaagg ctacgaacgc ctagaccggt attacacgtc attccagtcc accttccgtt      1260
     tagcggggat caaatcttct taatccctaa ctccttcgcg catttactac tagataaggt      1320
     cgatataact ttagattagt caaactagga cgtttaacct aagcaatata aagtgtacgg      1380
     taacttattc tatccgctta aagtagtatt ggttgagagc tttattaaag gattcattca      1440
     taacatcgag gaggttagat attcgtcgtg gcagttgcta ctaaacgcct ggataacaat      1500
     gatacggggc tatctcgaag tcaataatga tatccttaat aactatacgg ataagcaggt      1560
     agtaaaatag tatatatagc acgcacttta gtcggattcg cgaagaccag tatagtgagt      1620
     gggacctcca ggtctcaaaa cgccttggtt ctggaaaaga aatgctagta gacataaggg      1680
     gaaatcctat tccctgatac ttctattgtt tgaggccagc gataaggtat aaaattcaga      1740
     taattgaatg acctcgggag gatagagcgt tacctaatta tcgagtgcgt tataatggat      1800
     gcaaccttag aatttatgca atgtatgcag gtaagatcgg tagcgtgtac aaacaatttg      1860
     gtggtgggca taaacattga ggcctcctgt ttccttcccc ccatccttcc cctttctact      1920
     tctctttgga aatcttctta tcctattcct taacctaata gacgcagacg gaaagaaata      1980
     agcacactca aggattaaca acagcaaaac atcaagcaga agtaacagag ctcactaacc      2040
     tttagacacg gtagtttaaa gagtgggtca tatggaacga ggaagtgtct taaataagtc      2100
     atgccgcaaa caacctccat attatctaca tatgtatata acccccaatt agtacttcat      2160
     tctgacaaga acgagaatgg ggcgtactag ttgccgaaga tcgctgggca tttgatcttt      2220
     tgctttcggg cctttcgcat tcctggccaa tttttcagta gacctgccaa tgcagctctc      2280
     aactcttcaa tattctgaag tcgagttccg ggttacaagg cgcagtgaga atgatcaagt      2340
     gttctatatc acgaatatca ctctatgctt ttggaccctt ccgttgatat tgtgacaaaa      2400
     tcttctcacg cagaatccat ccaggattga atgtcttgac aggatataca ttgatagtca      2460
     atgtccttca atgaagaata gggaaagcca atgactacaa catatagatc cgaataatga      2520
     cttattttac atacaagagt tcttataaga gtagccaatg aatcaaacta taacatagcc      2580
     ttaagccatt attttctatc gggttatatt tgaaaaacat aatctgtaga agaaaaacag      2640
     cttgaacaaa taattgaata ttaaattcat acggaagaaa acgacaggca acatgaacgt      2700
     tcatatacag taaatctata ctatacaact catgccatct caatctgctc gtcctcggtg      2760
     ccctgcttct tcataactgc cacatcatcg gaaggaataa cataggtggc ccactgacga      2820
     acgggaacct tgtcctggaa gagcctctcg atctctgcat tgctgcgacc cgcggtttca      2880
     ccaacacaga accacgaata cgctagcaaa aatagggttg ttccaccata gacgaagcca      2940
     atcatcgggc ccaaattacc cgtgtagtac atgtaggggc tggtgaagac catgagccag      3000
     actgtgagga agaagacgcc catggcgcac gcggtgatct tgtttctgtt gcggccgacg      3060
     gacatttccg acgcgatgga gtacgacagg gtaccgatgg agaagttgta gaaaataata      3120
     ttgatatagg cgaggacaac aatgccgatg ccgatacctc ggccgaaggt gccctctgga      3180
     gatcgggtgg tgccgagacc gccgacggcg atgagggaga caaagatacc cgttgagcag      3240
     agaagaaggt tggtgcggcg cttgatcttg tttccgagaa cgactgctac gccgacggta      3300
     atgatttgca ggacgtagat gatggtgtta atagtaaaag gatccgcgac gccgatcgac      3360
     tgggcgaaca ccacgccata ggtgtaccag aactggatac cgttgatctg ctggacgaac      3420
     atggcgccgc aggcgtagaa gagcttgcgg cgctcaatgg gatccgtgac gagcgagagc      3480
     caggtagcat ccttggccat ttcacgctcc atttgcactt ggtcatcgat ggcttggatg      3540
     tccgcagagg ggtcgtagtc gcgggagctg cggttgatct tgcggagggc cttgatcgct      3600
     tgctcacgct tgcctttgta catgtaccaa accgggcttt ccggtgtgaa aggaagacac      3660
     agaagcatga cgccgggaag aacgacgagc aggcacatgg gaatgcggta ggattgagca      3720
     ctggcaatac tctgcgtgcc ttggttgaca caggctccga ctaattgcga gatggattgc      3780
     atgaactgga agcacatgag agctggacct cggatggcag agggtgccac ctctccaatg      3840
     tacatcagac aagtggcggt gaactgcccg acgcctagac caatcaagac acggctgaca      3900
     tagaagactg gatcagatcc gaatgagcac acttgcacaa tggctccgac gacaatacaa      3960
     agagaggcgg acaggaacac cgcacgtcgg ccgaaaaagt cattgatggg agcagcggca      4020
     atggctccga ccaactcccc cacatagatg atactcgcag acagcgacag gaaggatgtt      4080
     cccaacgagt aagaaccatc tgcgtttttc tctccgtagt ctttggcaaa ccatggcata      4140
     ccctgaattc cagtatagta gatcgtatcg taaccgtagc aaagggcacc gatggcagcc      4200
     accagacagt aggcgatggc ccggcgattc gacttccagt cgatgttgag ttgaagacct      4260
     gccatgctcg gtagagtagt tcgtagtaag gaataagacc aatatatcac gaacacacaa      4320
     gaaaacaaaa atccaaagga atcggatcaa tttgcggggg agacgaatat tttatacctg      4380
     aaggaaattt attgaacaac ctggaggccc gcatatgggg gtaaaatctc catggggtac      4440
     tccgtactgg gccacggtcg tgcaccgagt ctccacttaa tagagccact tggtgccctt      4500
     tttgtccaat cagcgtgtat accaggacaa atttgactat aatgtggggt tccttccatt      4560
     attcgcgcac ttccaaggtt ggacggagca gaggcttcca aggttttcac aggggtttac      4620
     ttccaaggtc acctaagtac cgacatgtag gtagacttca ctatttctag ttagcacatc      4680
     ctcaaaatgt tatactaaag caccattgcc gatatataca acatagacga taaaagcaaa      4740
     taggagaggg atcggaccac aacccgacat attcgcagca aaacgtcggc aaatgtgatc      4800
     gggccgccgc caagcacaat cccgaaacga aatgtcgccg atattttgtc aaagtttccc      4860
     cgggccagtc cagtcaagct tgcacggatt cccgatcctg gagggaaact ggggtaatcg      4920
     gggtaatggg gttttatgac ccacgtcttc ccatcagttt ttgtttcttt tcgtacatat      4980
     attcacttgc aacatgaggt cacttctacc gcattgtatc atgtgaaagc aagcgcggtc      5040
     ttacccttac tttgattcta ccacgcccgg cgcgtctctg ggatttcttt taaccaaggc      5100
     tatgtccgcg cagaatgtgc gcaggtgtat cccgtacgtg gagccgaaat actaggacgg      5160
     gagccttctc cacaattctc ccgaaacttg accgaacaac aaattggggc agaggaacag      5220
     agcaaccccg agatcgggat tggtgagaag gccttggaac caattcggca aatcgggtta      5280
     ctgtcacggc ccggtcgaga tcccgttctg ttctcttcct gaaattcaaa ggcctctctg      5340
     ctcgacggtt accgttttga gctggaaaat attctcttct cattcaattt atgtctacag      5400
     tacaggtgca ctactcggcg tagttgggcg aattgaaatt gttgaggcta ggcagaaaca      5460
     gatgattgga catcaccatg atctcaacat ttttcagcga cttcgccata gagaaaagat      5520
     atcttacatt attagtccaa tcctccataa ctgtctttat ataaggagta cactatatga      5580
     gcaatgatag gactatcctt tcacaaaacg agtgaagttt aatgcacatt actctgttcg      5640
     tcaacgtgtc accactcagt acatcttata actgatactt cccataatta ttccctatca      5700
     tcccaacaaa actattctag ccttgcacga cactaataat tacctccgcg cccacaccag      5760
     ttgcccgtct tcattgtctg caattgtgtg tcaggttgcc ctaacaatgt ttctgaaaca      5820
     gatgacgcgg gaaagacttt cctatggaag atcacatgtg gcttgaaggt tcttccacat      5880
     ataccagaag tcaatattga tttgcaatcc aaagaatacc aggctaggcc aaaacacaag      5940
     gccaccattc catgccatag gccccgtatg atgtatgtgg accccgcttc cgagagcaaa      6000
     gacaatcgga gtgaccaagt tgactacacc catgcttcta ggaagtacag ggttggagct      6060
     cttatcgctg aagatcgccc acgcaactgt ccacatctgc accaagaaga ttggccacga      6120
     taaaagcgta gccatccaga aaatatcatt cagcagctgt gtcaactccg ggccgtagtc      6180
     gcggaatgtc aataggccca tcgcaatggc agctatcatg aaaccacaga acgatgctgc      6240
     tgcactcgca agttgaaggt cggcaattat ggggttggtt tcggggattt tacgaatttg      6300
     acgtgcgagg actgcggaat agacaacgta aagagccccc gaaaccatga caaatatgct      6360
     gctggcctcg gtacccttca cgtgggccca gtaatgatcg tgaacacgct tcgcatccca      6420
     ccatggtgcg gtgggtggga tattgcccga tattgccaac gcgatcagga agaagagggc      6480
     gcagaggata ccacaaataa cagcaagata ttcccaccgt ctagtggtaa gggcatttgc      6540
     cagtctctga ggataggtcc tggatcccat gttggtgaag ttagatacag aaatgaaggt      6600
     gggaggaatg gccgggttga tagcgggatg gctgcttatt tgacgacgaa tgtttgatgg      6660
     gctggtttat attacaatct aggtggttta tataagtata attctctttt cccaaaagca      6720
     cctcgaagaa ttcggggatt caaactgtcc ttccctacgc aaagtatcct cgtacaaatc      6780
     tagcgagatg catagatacg tttcacggct ggaggtaaac actgcgatga tgatgctaca      6840
     atatcaaagt gaatgcagat cccgcccaat ttgatatttc atacagtcaa gcctatggta      6900
     tgtctctgtc ccatctaggg gaaaataaaa ttacaataac ctaaaggggg tacactagat      6960
     aggaacaacc caacccgttc aagtcaacaa gataggtttg tgctttttcc tggatctcaa      7020
     atacgtcaaa ttcttgcgaa ggcagtattt tggattgaag catatgcacc atgaacaacc      7080
     cattcactcg ttatctattc cgaccaatag caacccatgc cctccgtgtc tcggatttcc      7140
     ttaagtcgaa gtgctctgcc tccgttcgcc agatgattat cgggttgtgg gacctagttt      7200
     cgttcgaagc acacacacac agcacgacta gcacacacgc ccaacatccc ttgggctccg      7260
     gtcgctcagg gttactggtg tatacagcag acaaccatgt ctccgtcatg aaatttggat      7320
     gcccgccctt caacgccttc tatttctcag catctgacac agtaattacc gaggcgggga      7380
     ggctttttct ggcttacgcg ggaacgtaca ccctgcatat aatcgatggc aaaagtttgg      7440
     ttaatcacct tgttaccctt tcgaactttc taattttcta ggccagaagg tggtgcgggc      7500
     attggagatt cgtgttgatc gtttgatact aagacccgaa gatgcatcag actgggtttc      7560
     aatattttaa attctctggt agatggccaa ccttcaatct cttcaactcc tgtgagcgga      7620
     tgctctgggt ccgtggagat gaccgatcag atccgaatgc tgctcttatc acaggtctca      7680
     tccggactgt gcggtgggag caggacttcc gtcaacagaa tctcgtcaca ttggagatag      7740
     gccatagaca caatgcccag gaaactatta cacgtatctc gagaatctat cgatatgaat      7800
     ttgcaacaag aatcaagtcc agtgccaaaa cgaacagtgg cagcgccgag tatagggctt      7860
     cggtgatcag gcccctccaa accaaccgct tggttttaca caaaccctgg accgtttcat      7920
     ggccaacagc ttttccactt tctctcccaa aagcacaggt gtaggtgatt cgccgaatcg      7980
     ggtgttgtct ttgacaacag acagccctgg ccttttggat cggttgcatt ttaaggactg      8040
     ctttgtctac ccgattccgc taaaagacga cgaagtcgaa tatagagtgc acgcgaccgg      8100
     actgaacttc ttcgatgcca tgcctgctat gggtgaagtg ccaatagcca agtttggagg      8160
     tgaggcgtcc ggagtcgtca cgcaagccgg tcccaatgta aagagggtac gtacgccccg      8220
     gacaacgtat agtcgcactc tcagtctgca ctggtacttt ccaaacagtc gctcgtaccg      8280
     tggggaatgc agctattgcg ataccccaga caatgagctt ttaacatgct gcagggttcc      8340
     caattatcta tgccacagta ttccactgtc tggtcgaggt cacccgtttg aagacagggg      8400
     agtcgattct aatacatgcg gcagcagggg tagatgtcgc cttgaactcc ttggcaggcg      8460
     aggctcttcg tgctacgttt gaatgcatgg ccccaatgtg gtcgctctat cgagattggt      8520
     aaacgtgact tcataaccga acggccgatt tgatatggca ccctttctcc acagtgtgac      8580
     ctttgctgcc tgcgacccca acatcatcct acgacatgat cccgctcggt catataaact      8640
     ctttcaaggg agcgatggag ctctggcaac ttggtgtctt ccgaccaacg tctccgttca      8700
     cgacgtttag gtactcccaa ttgaaaatga cgttccgtca actccagtcc ggtaggcaca      8760
     gcggcaagct ggtcttcacc attgatggtg atgatcttgt cgagactctt ccatggacac      8820
     tcccgccatg tcaattccaa gaggatgcga tatatctgct cagcggtggt cttggtcgtc      8880
     tcggtcggag tgcagcgcgg tggatggcat ctcgtggggc aaaacacttc ttgtccctct      8940
     cagatccggt ggttgcaatg cagatgcgca gcttctactc aatgaattga gtgagacagg      9000
     gtgcgatgcg caagtccttc gggttgatgt tggtgactcg gttgccttgg atcaagccat      9060
     caggccttat gtaggaagaa tgccccctat ccggggttgc attcaaggcg cgatgacatt      9120
     gctggtatgt ttccgtctgg ggatgctcta aacctcccat tggggtttcc aatgatattc      9180
     gcaggattct gactttgaac cgatgacatc gaccgccttt gaagttagcg taagggccaa      9240
     aacacgccga tcgtggaacc tccacgaggt gcttccaact gatctcgact ttttcaacct      9300
     cctggcttca accagaggta tcattgggaa acctggccag ggcaactaca acataggtaa      9360
     cacgttccaa gacgccctag cttacagtcg atctcggggc ctcggtggaa cctcatttga      9420
     tctaggccat acgcttgatg ttggtgtcat tgcggaacga acagacaatc tattcgcagg      9480
     atcccttcga gccgcgttcg agaaccaagc tgtttcgcag gacgagttcc atgctttgcc      9540
     cgatcatttc aatactcaaa cctcgagtgt ctgcccgcag actgtgatgg ggcttggtac      9600
     ttgcgaacag ttccttgtag acaacttacc agaacctgcc ttcttatctt atccccaatt      9660
     cacccatctc tggcgccttg gtgggtctgg aggacacaag agtaacaacc ccaactctgc      9720
     aaagttgtcg atcaaaaagg ccctgatgag gcctcggaaa acagactcca gatagtgatt      9780
     gaaggcgcca tcgagaaact gtcgagcttg ctaagcatat ctgccagtga ggtcgatagc      9840
     aagatggccg cttcggacta tgggatggac tcccttgtag atattgaggt tcgcaattgg      9900
     ctgtcaaagg aggtagacgt ggaagtgggg gtcttggata ttgtggacgg tcagtcaatt      9960
     gtcgatctgg gggagcgggt gctcaaattc aggggttaag agtgacggtt ttatttcgcg     10020
     gacgtctcta caagagtata ggattgttct gtctcgtgag aaacgtttcg ggcagcacca     10080
     gaagacgctg agaatcgtta gtgttactga acaccgattt tccattctat atatatacac     10140
     acctcagtca attacatttt tcttatcagc ccaactaggc tgaatagatc gacaaacagc     10200
     ctcataatcc tggaagcgct gagtatcctc caccagcccg ggtgtcgtcc agaacatagc     10260
     ccagttacta ccagccagct tccaggtacc tgaagaccgc tcaaagtacc atttattaac     10320
     cgggttgtcc atgcgactac gccagcagac cccattgggg aaacatgtgc gcaccatcgc     10380
     gttgaataca acgtccgcga caccgccggc gccttggctg cgcttgagaa cggcgaattt     10440
     atccagatat ggcaccatgc gggcggcgct cgcttcgctc ccatcgtctg gcacgcccgg     10500
     cggcgtctcc caggtcagga ttgcgccgcc ttcgtactca ccggcaacaa tgacaccggc     10560
     gatacggctg ttcactcgct cgaggtagtt ttggacgtcg agcttgcggt caaaggagtc     10620
     ttcgattagc gtgactaggc gggggagatc gatggtaggg tcattaagtc ccagtcgtgg     10680
     ttgcatctgg gctctccagg gttttgtata tgggtttggg aggattgtga gaggcattcc     10740
     acgtttgacg aaggtcgtgt gggaggtaac ggggttgaat tggtttgacc cgctgccgtt     10800
     gaaagcaccg cgtcggcctg ggggtagaga ggatgatagt agaggcttgt cggtgaggag     10860
     gtggtggatc agtgggttgc gctgtcgacg ggttccaaca gccgacaggt ctgaagcagc     10920
     ctgttgtggt gaacgggctg agtaagaaac ttcttgcggg gaggtgatga tgcccgaaga     10980
     ggctgatggc agcatggcta aggcttgttg ggctaatcgg agattctcca agtggccgtc     11040
     tagcacctcc tccatcacct cggcacctgg tgatggaggt gcggtaggtt tctcgggcaa     11100
     tacaagctca cgattgacaa actttgagaa cgggttgctt tccaaggttg agtaagtggc     11160
     ttcggaagtt ccctgttttg aagaaacaga gtttcgtacc tgggaaagct catctttaat     11220
     ttgatcaaat tcttgctcca tgttgatgaa aacgtgcgat gactgagggc ccttgaaagc     11280
     cgggatgcct ccaagcgcat cgagaacaat gacacggtcc agtgagacct ccctttgcag     11340
     attcctgatt ctctcggcag tgactgctgg gtcttcgtct gggtctggat tgaaggacaa     11400
     tcccgcgaat tcttttgtta gtgcaagagc agcgtcgttg gctgaaaccg tgacagctcg     11460
     tgggttttct tccgtatagg caatgggcgg aaccagtacc acatgaccgt cttgaagggc     11520
     gctcaagagc acttttcgcg acaggaccgt gggtaaacca gacccacgct cggatataga     11580
     taacgccgag tctagtcgaa aagaccgtga gtcgggctgc tcatccactg ccgccgatat     11640
     ccgatttgcc tgctcaatag ctgtttgtcg cccggcatgg ccgtccgtct ttccgggatc     11700
     gacaaccacg cagcatgcca tccccaggcg aacgagctgt gacagagtct tggccactcc     11760
     attaattaca gagttatcga gcaattgtgg cgtggtgatc ttgatcaggg ccaagtgcag     11820
     cctttcaggt atatcctgcg cgcgcggagt gggggttgta tcttgccgga agacaggact     11880
     gtcgtacact gccctggagg caccgtagaa cgagccgaga ttgacaccgg agggcagaga     11940
     ggctgatatg gactccttcg gggactcggt gggttcttgg cccgatttgg cggggctggc     12000
     cttcaaccga gcaaggtacg acttggcttc acgcttagtc gatgcggagc ttaggaggct     12060
     gagaaagaat tcctaagcca aacatggaac cgttagcata gaaaggaaga agaaggaagt     12120
     gatctgccac ctacccgatc aagcaatttc tcctttgcgc ggtggccgag ccgatcttgg     12180
     ctttcgctgc tgcccgagaa ctcggcgatt tgctgggctc ggacattcag cacctgtgtc     12240
     gggcgcactg caatggggtc attagggcga acgagatatt gcttcagaac ttctagtcaa     12300
     tgaatgctca gctttggcgt atagtggatt caattaccgc ggtcagtgag gatttggccg     12360
     ttcgagacca gtttaacgtt cgggaggtca tggttgagtg attgcctaga gatcaattgc     12420
     tccccccagc agttgacgcc aatgcaagag cagcaatctc acgaattaag aataacatac     12480
     aatataggag ggaagattcc aaggtaggga aaaagaaaaa taatatgacg catccatgga     12540
     tcctcggtta tagctcaccg cctgcggata ccaagattga taagaggcat ttaatctgac     12600
     gcctacgtag ttaactatgg atgtactagt tacctacata tgtgtacatt cttcatctct     12660
     cttctgcgat accccgtata aggatattaa tggatcaact gcatgtagtg tgtcacagca     12720
     gggccaagat ataggaaaat ccacgggtac ctccattgat aaatatataa tcgtctgcat     12780
     ttggttataa atagcaagac agatatacgg ccctaacctt tttaagtctc aagcataaga     12840
     tgcgaggtga tatggcatat tttatatatt gatattctca tgtcatgctc atatacattg     12900
     cattgtcgtc aactatggta cacaagcctt tgtgaccgat ccgggaatcc caagccgttt     12960
     ctgcccagat ttataaaagt gatcccaccg aagaaactcc tatcctttcc tcttgaaagc     13020
     ccgtctagga taaacccttg agatgagaca aaaagttgtg cgtaataagc atgttaaaac     13080
     cgtccgtggt ttaacatgct tcaagccgaa aagatgcagg aagaaaaaaa aaatcaaaaa     13140
     acaaaaaaca aaaaacctta caacttcagt tctcactcct caagaggctc ggggccaaat     13200
     tccaggatct agttggggtc agcatatacc taggaattgg tcaaaaaaga gaacatacca     13260
     tatcaaccca accgccacca ccgaactgac acttactagg gccatgagac tcaaagccaa     13320
     atgactcgta gaatggaatc aggtgatcgt gtacaatgat cgcgatgcgg tcagcaatct     13380
     gggcctctct aatacggtgg atatatgact tcatcaatgt gcttccgact tgcttgccct     13440
     ggtgcgctgg atcaacggca agcgaatgaa tggcaatagt gctgccacct tcttcgtgac     13500
     caacggcctg cccgtcctcg acagaccaac gctcgtttct ccagttggcc ggaagtcgca     13560
     tcgaccggtc cgtcacgagg ggctctgagg tgcgggtagc aatgatgtgt ccaacgagtg     13620
     tcgggcgggg ttttgtttct ccttctgcga gcaaaggaag agtgaagagg cccagactga     13680
     gctcggggca tctggtgaga cggtaaacga actatgaaag tgttaatgaa gtctccacct     13740
     tcgcatcttt aacagaatcc ggccatacct tatcgtgaga gcaacgctcc tgctcgggga     13800
     aagcttcctc tactttcaca caatcttcca cattcgatgc ggagagcaat tggacgaaag     13860
     ggtgcagctc atccagcttt gtgcggttgt gggcgggcgg gcgacgaaac cagtatggga     13920
     aatcgtttgc gtcgtcatcc tgatcaaccg cagcatagtc ctcgtccacc tcgtcctcgt     13980
     cgtcgtcctc atcatcgacc gggaacccat tggctagttg gatgccagca cggctcatga     14040
     tacgagccaa atcgctgttg ttagggtttc cgagagacaa gtcgtccgca ttggacagcg     14100
     gcctcagccc gttatcctgg cctgacatgg actcggaaag gtattcactt tgatcggaca     14160
     tggtgaggga ttgaggaatg gactagggta tcgaggtcag agcggttggg atcggaattt     14220
     ccaattctaa ggggctagtg tgccacgatc aattggagtg caggggggta cccggcttgg     14280
     tggcgtagac gagggatgtg aatctagaac ggtggggatt agtctcatgc aagtgattgg     14340
     gactaataat cgaacaagac gcctagctct aactgtaatt tgatgtctgt tcctggttaa     14400
     aggaaatcga aaatgttcct agcaatcttt tggggaaatg ttggcaattc atggaaattt     14460
     gcgatggctg tgggcaagga ggggggttgt tgcgaccggg atcggattga aggagcaggc     14520
     gcacttactt ggatttaccc agataatatt tgagaacact tgataggttt ccaatccagg     14580
     gatgttgttt catacaatct tgaaaatatt cccaagacgt ggaggaggaa cttttgcagt     14640
     ggcgggggag ttcagccgat aaagtatagg aacctaccag tactgcgttc tacccggcct     14700
     ttgccgtaga taaccatgta tctgtaggta ctactacatt tagccccaag gcggtctacg     14760
     ttcttttatc aaagggctac tggcttctag aacccttgaa agatactgct tgtacttgga     14820
     tgttctgcag ctcttccctt tcgacttgtt tattcaagtt tagtatgata ttaatctaac     14880
     aacagggtgg atgaataatc cctagacaca tatagcagag ctacttaggt atacatcccc     14940
     aaaaaatcag tgagggtcta gtcacgaaaa tgacgctgat tcctgttata tttcttttcc     15000
     cttgatcgtt cttgttgttc tagttagagg cctcttctcg tcataagata ttatagaata     15060
     tcggtattta cctaggtatt ttgcggacga tatcacgtgg ctcgcctata tcatgattca     15120
     tccaatcctg gtccccgcat ttgccctccg cccggcagaa aaaaaggcct gccaacaatt     15180
     ttttcgtgga gaaaaaccca cccagtcaac actcattcac tcacggcatt acttcaagag     15240
     tcattactta tttgactcct gactcgtgcc catcatgaag acgacgtgga aggatgtgag     15300
     ttaatttccc aacagtcctt ttgcaccgac ggaggagatt gctaaatgtg tttttcaccg     15360
     cttggtagat tgcgcctgtg ccgacacacc aggaattcct ggatattgtc ctgagtcgca     15420
     ctcagagaca gcttcccaca cagattcgtg ctggtttcaa gatcagccgt attagaggta     15480
     tccttccccc agaagcaaaa aaaaaaaaga agaagaagtt atcgataagg acaatcacta     15540
     atcaaaaatt tccccctcag gattctacac cagaaaagtc aagtatacgc aggagacttt     15600
     cggtgagaag ttccagcata tcctcgatgg gttccctcgc ctacaggata tccacccttt     15660
     ccgtaagttc tacttctatg acgatcactc cgaagaaggg tctaatatcc gccagacaag     15720
     gatttgatga acacccttta tgatgccgac cacttccgta tcgcccttgg tcaagtatca     15780
     accgccaagc acctgatcga aaccgtttcc cgcgattatg tccgtctcat caagtatgcg     15840
     cagtctctgt tccagtgcaa gcagctcaag cgcgctgcgc tcggtcgcat ggcaaccatc     15900
     acccgccgcc tgaaggaccc tctcgtctac ctggagcagg tccgccaaca cttgggccgt     15960
     ctgccctcga ttgatcccaa cactcgtact ctcctgatct gtggatatcc caacgtcgga     16020
     aagtcgagct tcctgcgcaa tatcacccgt gccgatgtcg atgttcagcc ttatgctttc     16080
     accacgaaga gtctgttcgt cggccatttc gattacaaat atctccgttt ccaggctatc     16140
     gatacccccg gaatcctgga ccaccccctt gaggagatga acaccattga aatgcaatcg     16200
     atcactgctg ttgctcactt gcggtccgct atcctctact tcatggatct ttccgagcag     16260
     tgtgggtact ccgtcggcga ccagatcaag cttttccata gcatcaagcc cttgttcgcc     16320
     aacaagatcg tgttcattgt cgtgaacaag atcgatgtgc gccgccctga ggacctggag     16380
     cctgagtacc aggagcaact gcaggagatc ctcaaggcag aggatgtcga gttgctgcag     16440
     gcttcctgca ccaccaccga aggtgtgagc gctgtcaaga acgccgcctg cgacaagctc     16500
     ctcgccgagc gagtctccca gaagctcaag tccggctcca gcgctgccac ccccggcagc     16560
     cgtcttggcg acgttttgtc ccgtatccac gtggctcagc ctatgggcgg tgtgcgcgag     16620
     accttcattc ccgaaggtgt caaggacctc aagaagtacg acaagaacga ccccaaccgc     16680
     cggagactgg agcgcgacat cgaagaggag aacggtggtg ccggtgtcta caacttcgac     16740
     atgcagcgcg attacaccct cggcaacgag gagtggaacc acgacaagat ccccgaggtg     16800
     tggaagggca agaacatcta cgactttgtg gatccggata tcgagagcaa gcttgccgcc     16860
     ctcgaggagg aggaagagaa gctcgaggca gatgggtatt acgagtcgga cgaaagcgtg     16920
     gaggatgtcg aggacgccga caaccgcttg aaggccgacc tcatccgcga gaagcgtgta     16980
     ctgttgcgca acgaagccaa gatgcgaaag tcgctcaaga accgtgccgc catcccccgc     17040
     agcgccaagg ccaagaagct gtccgagatg accaggggtc tggattccgc tggctacgac     17100
     aatggtgcag ctggttctcg tgcccgcgcc gccaacccgc ctcgcggccg tactactatc     17160
     cgtgaaccta ctgccgaccc cgacgctatg gacgtcgatg acaacccaca caaggccctt     17220
     gctcgtgcca agagccgcgc ccgcagcaca ccggccactg atcgtcgtca cgacggtgtt     17280
     accaccttca gcaaccgtga taaggccgag cgtatggcta agctgggcca gaagaagatg     17340
     aaccgtatgg ctcgtgctgg tgaggctgat cgtcacacaa ccgcctctct tgcaaagcat     17400
     ttggtatgtt tctctccttt tttttttttt tttttttttt tttttttttt ggtcagtgct     17460
     aactattttc tcttcagttc tccggaaagc gtggtatggg caagacggat cgtcgttaga     17520
     agccccgatg ccgatgcggc tgaaacgaga cccattctta atcattgtcc attggttacg     17580
     attaccgggt gcaaaatggt gttgggcgtt ttatgtttcg agaatttttg tttcccctcc     17640
     gagtttcgtt caaatgttca tttgacgcgc atttttggtt tccacaactg ttttactgtg     17700
     gatgatttct atgtttattt gacacagtaa tgatttgtgg gagtttgtcc tcctggtcaa     17760
     taggacggaa aagttcttga cttgatgatc ttgcatatac cgccaataca gatgatcttt     17820
     ggttttatta cgcttgtgtt gtggacctac ctacatacct acctaggtat gtatgtagct     17880
     tcattattaa tccctctttg tacgtagacg tatgccccca gattaaaacc ttaagaacac     17940
     ccggagacag gtggacccct cgtgccagtc tccccggtgc ttatctggtt acgtccacgc     18000
     ataccaaggt cccttcttgt ttgcagatgc actgatagtc aataatgttt gccaatcata     18060
     tgattcttct atgtttttag ttatttggta ggattcatgt agcataactt gaatgtcaaa     18120
     ataaatacat acaacataaa agcattggcg gataggcgga taggcggata gaccgagaaa     18180
     agtaaggtgg cacagatgaa tcagacccat acaaatgttt gcgaacattc attgaatggc     18240
     acttatcaaa tcaaggtatt catgggctca cactctggca acatctgtgg aatagggaag     18300
     atccttgtaa taatgcgtgt tatacaggtg gaagagcttg cctcacagat gttggctact     18360
     catcgaaact gagttacaaa ggaacgatgg catcagatat gtgctaaata aaagcaaatc     18420
     ctaatttcct cgctagatcc ttgaagaaaa gttagattag agacaagcat ttcccgtgta     18480
     atagagtagc tttgctttat tagagggagg cggggttgct tagtcgggtt gtatggcgcc     18540
     atgtacataa atacatacga catatgtgct aatgcaacat agacgataca cgtcattata     18600
     ctggttgtcc gtactccgta cggagtggtc tgcttttaga agaaaagatt aggtgtgtac     18660
     atatgtgtgg agtacgagta gacttctcgg gatataatat tgatttaccc aatttgtttc     18720
     tatctcgagt cattattata gttcaccaga ttctcagtat ggagagacaa gatctattcc     18780
     catgtgaact ggattttgcc tgaatcctta aatcaatagg atcatgtaac aaactcataa     18840
     agatgacttg ctgctttgta cagacgcaaa gacatcagaa tggttacact gcattcattg     18900
     tacaacgtac aacgtacata aagcctgccg aacttgcccg agaccagtcc aatctagggt     18960
     tgcatgaaag aaggcagctc acacgggcat tgacgctgat aaggcgaaat tagcgggatt     19020
     gggtcgactt cctagtcgga ggctaaccag aggaagttta gggtctctac agagttttca     19080
     ctattttcac tctcttagtg gtcagatacc tcagttatta ataatggtag cacttgttga     19140
     atgtcagggg ggtttttgcc ttctttcttt ttttttcctt agtggatatt tattatgggt     19200
     ctaggtcgaa caagggatgc cgagaaagac atccaggcat gccgaacatg caagccaaat     19260
     aaaatataga ggaaatggta ccatgctaga gttcaggtta agtattcatg agtatatatc     19320
     catgaacatt tataaagtat tcaaccagtc ccaattcata tataatattc tatattgtac     19380
     atgattttat tgcacaaagt ccattcagcc agggtcggct atcccgactc gggatgccaa     19440
     tcggctcggg atagaaagca cattcggtgt gccgattgag aaaaagtgga gacgaaaagt     19500
     caaccgatcg gaaatctctg cgcgggagtc gaccgaatcc tcaccggtgg tgggtctctg     19560
     ctctttctta tgtccagctt ggatttctta tcagcacgtt tcaactgaaa tatgttcaaa     19620
     gatataaatg ggactttctc cctctttgtt cagagcttct tctttttctt tcatgttcct     19680
     gatttagcta taaactgcaa tcatacattc ttcagctctt cattttaact atgatcagcg     19740
     cccctatgac cgggtagaga gcagagtcca cgcataatga cccactcgtt tcttggtatt     19800
     ggtctttttt ttttttttct ctttctttcc tttggttttt ctggtttgca ctttctttct     19860
     tgggaaatcc actcggtttc agttgccttt gcttcccggc tatattgtat attttgtact     19920
     ccgtagggta aattgccatg cctgcacagt tttcaatcta ttcatactcc ggtacctccg     19980
     tacaccctat acctatgtag gtaaacacgg caccaccgga agggaatcgc ctgggcatat     20040
     acgtcacttt aagagacatg agcgatttat tcttttcctc catactccgt acattgcagg     20100
     aaccccagcc cgaagtgtca tggtcactgt tacgtatctg agccaggaac cagattctca     20160
     ttcgtgcatt ggcactgagg acccagatac ctgactgaat cccgtatgtt tctagaaggt     20220
     ggtaagaagg tcgggtgatc agttggcttt tatgctggcg tgttattgat tttgattctt     20280
     tactccgtat actgtgtaca gttcacattg tgtagtccca ttggatacct ataaatcatc     20340
     aatggatcta ccaaatgtac aatgtacaat cttatacatc aatgccgtac atattcaact     20400
     cacgtgcatc cctaacattc ccccatcctc caccttctcc accatagaga aaagaggaac     20460
     ccaaacacgg agtacatggc gctagagatt gaaaaagacc aaaacagact tttttttgcc     20520
     cgtggagtga aatttacaac cctcgaaccc cgaattcacc ccgaattcac cccatcctct     20580
     aattaaaaaa aacgtgggac agtaacaaaa gatccgggcc cccgtttttt tttttttttt     20640
     tttgctaact ctacgcggag tatccacggt accccaaggg aaagagccac tcgacacttc     20700
     ccaacctatt tagttcgccc tctccctttc ttcctcccct tcttttcttt tcttttcttt     20760
     ttccaactcg tttctattta tttatttctg ttcggatctg ttcaatatgg gtgtctctac     20820
     ctttatggat aagatcaagc ctgggaaggc tgaatcccaa ttctcctccc aggccgcaac     20880
     tcctgctcgt gccgactcga ctactgctga gaaggataac ctcacgctcg atgatagccc     20940
     cgtcaagtac ctcacctggc ggtctttcat ccttggtctg tgtgtctcca tgggtggttt     21000
     catcttcgga tactctactg gttagtgtca cacagccatt gccactgtag atgcaacgtt     21060
     gataataacc gaccttcagg tcaaatctcg ggtttcacta ccatgatcga tttcaagcag     21120
     cgcttcgctg agtacaatgc cgccaccgga gaatatgctt tcagtaacgt tcgcaacggt     21180
     ctgattgtcg gcctggtatg ttggaaaagt ggaaaagttt gttgcgttcc cgtcatatac     21240
     taaactctat attagctctc catcggaact atgattggtg ccctggtggc tgcccccatt     21300
     gcggaccgca ttggccgcaa gttctccatc tccttctggg ccctcctcca catcgtcggt     21360
     atcattgtgc agattgccac caccgacaaa tggtaccaga ttgccctcgg tcgttgggtt     21420
     gctggtctgg gtgtcggtgc gctttccagc gttgtcccca tgtaccagtc tgagtctgcc     21480
     cctcgccagg tccgtggtgc tatggtcagt gcgttccagc tcttcgttgc cttcggtatc     21540
     ttcatctcgt acattgtcaa cttcggcacc gagaccctcg ggaacgccgc ctcgtggcgc     21600
     atcaccatgg gcattggctt cgcctggccc ctgatccttg gtgtcggcac cctcttcttg     21660
     cccgagtccc ctcgttacgc ctaccgccac ggtcgtaccg aagaggcccg taatgtcatg     21720
     tgcaagctct acggtgtccc ccacaaccac cgtgtcgttg cccaggagat ggccgatatg     21780
     aagcagaagc ttgaggagga gctcgccaac ggcgatgctc cctggcaaga agtcttcacc     21840
     ggtccccgca tgctgcaccg tatcttgctc ggtatcgctc tgcagtctct gcagcagttg     21900
     accggtgcca acttcatctt ctactacgga accagtatct tccagggtat cggtctgagc     21960
     aactcttacg tcacctccat tattctcggt gctgtcaact tcggtatgac cctgcccggt     22020
     ctgtacatcg tcgagcacta tggtcgccgc aagtgtctga tgtacggtgg cgcttggatg     22080
     ttcgtctgct tcatgatctg ggcctccgtc ggccacgaga tcctgaacac caacccctcc     22140
     tctcaccccg ccggtgttgc catgattgtc ttcacttgtt tcttcattgt cggcttcgcc     22200
     accacctggg gtcctatcgt ctgggccatc tgtggtgaga tgtacccctt taagtaccgc     22260
     gctgtctgca tgggtgttgc taccgctgcc aactggacct ggaacttcct gatctccttc     22320
     ttcaccccct ttatctccaa caccatcgac ttccgctacg gttacgtctt cgctgcctgc     22380
     tgcttcctcg ccattctcgt tgtcttcttc ttcgtcaacg agacccaggg ccggaccctc     22440
     gaggaggtcg acaccatgta cgtcctccac gtcaagccct ggaagtcctc cagctgggtt     22500
     ccaccagagg gcatcattga cgacctgcac cgtccttcca ccgggggtcg caaggagggt     22560
     gaggccggca ctggtgagca tcagcaccac gatgagtctc aggaaattcg cgagtaatgc     22620
     gataatgact gaaaggaaag cgccagtcgc gtgtcgcttg tgctttttct taaaaagaat     22680
     tctgtgttca taattaactc tactctttga tcagttgagt ctccaccata tccctatgga     22740
     gaccatgatt taatagctac aagcaaggct tgtcttagca atattatttt tttatcaagt     22800
     cgatccaaat caggccccta ccacaaaata agatctaatc ccgtcctccc aataacctca     22860
     ttggttcccg aactccatcc cagcgccctt tctaaccgcc ccataaacag cagcaacatc     22920
     tcccttgacc cccttgacct ccttaacatg ctccagaagc ccatccataa cctcaacgtt     22980
     cttcatccgc agtcctccct ctttcgcaat tccataagca tgtccgagat ccttccgggc     23040
     aagatcaact gcaaaaagcg gctcctcccg ggtacaataa tccccgccca ccattctctg     23100
     cgcataattg gcaaatggac ctggcgcaaa aagacccagc cattcttgca acggctcaac     23160
     cccaaggcca gacgcatcag cggcaacaag cgcctcagca agaacaccga cagtattgag     23220
     aatgaacgtg ttacccagta ctttcagtgt ggacgcccgt ccaacgtcta catcagctcc     23280
     agttccagat gagaggtcaa tcgttttctt ggacacgaca ccgtcaaaga acggtcgcac     23340
     tttctcgatt gatgcacgct tcccagccgg aacgacgata agttgtcccg cgtctgccat     23400
     attcggtgcc ccgaaaacgg gacaggcgac gaagcctgct cctcgttcgt ggaaggctgc     23460
     ttcggttcgt cgggatgtat ccgggtgcac agttgagcaa tcgatgaagg tcttgtcaga     23520
     caggtcttgc gagattctgt tatccgacag gattgcggtg acaattgagt cgagagcggt     23580
     gtcgtcgcca acgcaggtga agatcaaatc ggattcattt actgcttcgg cgagggttgt     23640
     tacggcttta gcgtttgtga gttcggacgc gtgggctgtt gcacgtgcgg ttgtgcggtt     23700
     gtagagaagg agggggccag tttggggacc tttctgggcg atgttttggc tcatgccctg     23760
     ggatagcttg ttagtccttg gtttttggtg ggggggggca atgttaacgt acacggccga     23820
     tgttgccgag acctatccat gaaactcgtc ctgccatggt tagtagagga ggatagagtg     23880
     aagaccgtaa gactccaaag aatcgggact ttgtaagtgt ggggagcggg gtaaaacggt     23940
     tcagatctta gccggttgcg gtcgtcctat gtagttctgt atagatcttc atagttttat     24000
     gttctacacg tatatccatc ccattttagc ttcgtcaact tctttcccca tagggccaag     24060
     gattaattat gttgtacacg acgaatggac aggactcatt ccctgtatat catgctccat     24120
     attcgaatgc tcttttcaag cgttcagtgt ttacttggga aattagtctt ggcgtccgca     24180
     tatcaccacg agtatactcc gtatcttgta gaccattgac atttccaaag agcacatgga     24240
     atcagattga aagtcgacac ggtctaaagc atcgacttct caacaatcgc aacatcctga     24300
     aatggcaacc cgagatacat ccacataaat gcaaacctat aacaaaatca gcattcattc     24360
     actgcacgga gatcatacaa aacataccga tcactaccga aaaacggctg ctctttgccc     24420
     tcggcattcc gcacccaaaa ccacggcgca ccataggctc ccttatcaag agcaatctgc     24480
     gtattggccg tcaaagcctg cttgaattcc gggctggatg ccgcggccag gatttgcctg     24540
     acttccgagt cggagtaccc gttgctctgg aatagttcag ctaacttctc tggcttgctg     24600
     atgtcgatgt ttttatagaa catccactcc cacagcgaca ggaaggtggt ttcgtactgc     24660
     tcgcgcggga agtggctttt gatgtaggtc atgcatcgtt ggggctggtt ggttagtgag     24720
     ggagaaatat tccgagatag agagaggatg ataccatgat tgagaggatt gggaagaact     24780
     ctggtgtctg gatctgcggg actccaaagt atttacatgc tcgctccgag tcgaatttgg     24840
     agtacgctgc tttagcgggc agtgtccaag gcggtttatt ccctgtccaa aacgtcagta     24900
     atcttcatgt tagtgttgat aagagaaccg gaatgacgtt tggatacctg agccaacatt     24960
     aatcccgcct aagaagaccg ggtggaatct gtctggttag ctcacatacc atccaacaac     25020
     cggagacgcg catactcaac ctcaacccca tgtgactcta gagccttgcg attccttcgt     25080
     agataaagcg tcgcatagta tgagtatggc gatactgtcg aagcggcaat cagtaaatgc     25140
     gaattcaacg acaccagggg tggaactgag ggctcccata ccgcagtcaa cgtaagcatc     25200
     aatcttgcca ggcatgacga agaattctcg ataagattct ggtttatttc ctccgtatta     25260
     ccagtcaggt cagttgagcc agcgaagata aatcaattat agcggaggtt gccgaggtgg     25320
     agatggaccg aggcccgccg acaatgatga ggtgatcatt ttaattccaa cctcgcgagg     25380
     ttctccaaat tgtctccaaa tcggttggtt tcatattgga aatatttagt agatacatta     25440
     aattggggta tgtagcacta tttattcggt atctcatcaa ctcgcttgcg gctgatagcc     25500
     gactgtcgag tattgaccag atccaagtca taagggttct cctcgtacag tgtcacagtt     25560
     gcaacacgat gcaaagaccg gccagattga caagatgcgc gggacgcata aggcgcgatc     25620
     gtacgagacg gaacagtgga caaagtatcc gtatcgctcg agtcggcatc gtcagatacc     25680
     cgagtgaccg aatttgtctt ctcacccttc tccgaaccag gctcctcgcg gtgggccgcc     25740
     tggttcctct cggcaaggcg gcgcataaag ttgtccgcct cagaagcgta tgtacagcgc     25800
     tgcctgatgc gtgcgccata cttatagaat atgaatggga atggcacgca tgcaagcgcc     25860
     aaaaaggctg gaaccgacga cgcccagtga atgcctaggt tatggtacat gtaggttgtg     25920
     aaaagcggga aagccatgcc gaacagcgag cgaagggcgg agtttgcggc tagcacggag     25980
     gcagagaata tcgtgtatga gtcgataagg tagttgaaca cgctgaggaa gaccaggacc     26040
     atgccgaaac caaagggcgc tccagcagcg actgaggcca tccaatggat gttaggcgag     26100
     ttcgtccagg cgaaccagaa taagccgact ggtagtgcta tacctccgac catgcttggg     26160
     ggtagtctca actccggggc gagccgatcg gtggtctggc tgcatttttt ggcgtagcgg     26220
     aaattctcgg ggaatgtgta catcacggcc atcaccatac cgacaaggat gccgaggaag     26280
     gcgaggccgc cgacaccttc gctccagccg cggacttctt ggaagacgat tgggtaggcg     26340
     gcaaagagca tatagagcgt gccatagatg attgccatat agatggagaa aagtagcaca     26400
     atcggctcac ggaagagcag aacccacggg cgggaaagcg cagttttcag cgtcttgccc     26460
     atgggggcgg ggccacggtc gatgtcaagc tgactgcggt acaccttgcc agtcagggca     26520
     gacatcttct cggcacgacg gcgcaatagg acaggtgcat atgtctctgg taacaagaat     26580
     atgatacata gccagagcac acccgagaat gcggcaagta gtccctccac ccacctccag     26640
     ccagcagcag tagctaggaa tcctccaata acagggccta gtgtcggtcc taggaagggt     26700
     gcagcagcaa aaaggctaat agcgatacca cgctgagaag ctggaaacat atctgcaata     26760
     gtgccgcctc catttccaaa tggcgatgat ccaaaggaac ccgccaggaa acgcaggacg     26820
     atgagcgtct caatattctt tgcgcccgcc gcgccggcat tgaacacggt gagaaacata     26880
     aacgagatgg taaagatatg tctccggccg aacatctcac taaggggtgc ccagatcaag     26940
     ggtccaatag cgaatccgag cacgaagagc gatacaccga gaatgacgat ttcctgagcc     27000
     gcaccaaagt cctccataat ctgtctcatt ccacctgaaa aggcggacga gaccaacgac     27060
     actgcgagag taacgaatga cacaagcagt gtaatagacc acttcctgat tgggggaaag     27120
     ttcatggggt tgcgcgggtc ggcagggatc cagaccacgg cgtatggatg gtcttcagtg     27180
     ccggagcctt tgtatgggaa ttgcatgact tcctcggtga ccaccttttg gtcgaagatc     27240
     aggcgccaga aagggatttt tgaaggctgc atggcctcgc ccttggggac tatcatgcta     27300
     ggctcaggcc aggagctata taatgacgtg gactggtata tgtgtgtata tatattgaat     27360
     atattggagg atagcaaata atgtaagaga gaaagaaaaa aatactaata ttgaatcggt     27420
     ccaaacggcc tcaaatataa caaccgagag cagcctcggt ctaaaccatt gaaacccata     27480
     tatattaggt atagaggtac ctaatagata tatttatgta atgtcggcaa ttatccgatg     27540
     gatgcacaaa ttttcagtgg agttcaatat aagggagcaa cttgactggc tcaaaggtcg     27600
     gcccgaacgc cattcttacg gcttcccgga ggcttggatg cattggcaga gatttctttt     27660
     ctttcctttt ttcgactata ttatagggac cttgttgagt ctatgtgctt aatttatctg     27720
     actgtaccat tcatataaat tccaagttct ccataatata atctcttccc ccgttttgat     27780
     ttgccaaaaa acactaccta gtagtagaat agtagccttg aggaccaatc aaatatagtg     27840
     acagatgagt cttcttgggc tccccgtatt gtatatgcat tcggatatat tctattatat     27900
     gccatggact agacatatcc accgattctc aagatactgg aattggggcc ccaatcacca     27960
     ttgcgttggt ttgatggatc ttctgctctt cctttgactg ctctacagcc atcagcaaac     28020
     gcgtggagcg aatgtgaagt tctatcaagt caacacggga tgatctccac agtagtagtg     28080
     actcaccttc cagaataacc tcatacccga cccaagcgtc atcattccga tcatcctgat     28140
     gaatgagcac tggaagagac ggatcccacg ccttcggccg cacgtgcatt ttcaacccaa     28200
     cggtcttgct catatccacc catagtatat catcatccga aaacatcctt tcagagtcct     28260
     cttcccagtc aatctcggca gtcttctcct tcctcccgct ctggtcacgc aaccactccc     28320
     tccataaccg aacaaaccca tcctcaatag tcgatgcact caacagcaac gacgttcccg     28380
     gcttgacttg cacgagattg gccaccacac ataactgtga gaaatcctca tatccatcta     28440
     aagtaacctc acgtatcaca gcatcctctc cttggccttc tcgaccccca ttgatgtcag     28500
     cccgtatgaa ccccaccacc tccgacaaca gaagcatcct acctggcgag aaagcgaact     28560
     tggatctaat tgtgcctcgt tcatcttctt cgtcgctgct tacctctggg cggaagcgcg     28620
     aatatagccc tgccacccta cctaggtggt gggcggcatc gatattctcg tataacagac     28680
     ccgtttcatc atgacgctca ttcagtccat ctgtaccgag gtatttgcag aagacgtgtg     28740
     gctcagtgag ctttgagctg ggatggaagc attccagcag tagtttatat tccttaagtg     28800
     gcatgctaag gagcaggcgg tagtggagga ttcttaggac cagggcgcgg aaccggtggt     28860
     tgactgacat gagtggaaga agtgcccggg ttgggaagtc ggatagaatt tgaatgaata     28920
     tctagagata tgtttagatc cattgcccag ggtataccct gtatacatac ttcgttaggt     28980
     agcgagttca aggtcattgc ggggttggcg gtgttcatag ttgatgatta ctgtgtatta     29040
     attggggtat aacctgggaa tagaggtcat tgatgctagt tagtatactc caaaaggtca     29100
     atatttaacg caacaatgga caacaaggtg tgagttacac tgttgatctc tgtgtatcga     29160
     gacacaacag attgtgtgac gataagtgat gagtgatgtc atagcacgtg aggcgggcat     29220
     aaatttcctt ttggggtttt ttagtgcgcc agtccactgc cagtccactg ccagtccacc     29280
     tcaccaccca tgtgggacac caactggaga agtgtggttt ctaccggtta gttgcggcat     29340
     tcaattgcct ctttcagctg aactcaggtc aaacggtccc ccgaacgtgc ctgtttcccc     29400
     ggaaaaccgc gggatcccga ttcctggaca gctcaccgag agaaagacgg agatgccaag     29460
     acgttgtatg taaagatata ttgcttctac agcttcgcca tgctatatta gttaggcaag     29520
     atccaccgta gcctcctata cataatactt tggcctcgct taacagctgt aacctgacac     29580
     attcctttac tccggagacc ccgcattccc accagaagtc caaccctgac cctttccaac     29640
     tattttcggg gatttctctt ttctcttcct tacttcttct ctctcctcca atatatcatt     29700
     acggcctata gccatggaaa acgtactaga cgacatttcc cacaggagat acaaccctct     29760
     ccgtggctcc tccatcttgg tctctcccca ccgaaccaag cgcccctggc agtgagtatt     29820
     gttgtcatag gaagaacacc gcgcaacaga ccagctaacc atacaacacc ctagaggagc     29880
     acaggagagc ccctccaaga caaccctgcc caactacgac cccaaatgct acctgtgtcc     29940
     cgggaacgag cgcgcccagg gcgataccaa ccctaattat gagagcacct tcgtattcgt     30000
     gaacgattac agtgccgtga aggaagaaca agcggcctat gagccctcaa accaggatgg     30060
     tacgtccaag ccccgcccag cgcatccaca ccacaccaca catataccaa gctcacacac     30120
     ccacagaact cgaatcgcgg ttcctgaaag ccgagcctgt aacgggcaag tgctacgtgc     30180
     tcaccttctc atccgcgcac aacctcaccc tcgccgacct ggcacctcgc gagatcgtgc     30240
     ccgtgatcga tgcctggaca gaaatctaca cagcacacct gtccccgacc tcgccgctag     30300
     cgaaaaaggc atctccaaca acgctgcagc ccacatccac attaacaagc gccaccaagc     30360
     caaaggagca gtaccggtac atgcagatct tcgagaacaa gggcgcggcc atggggtgct     30420
     cgaacccgca cccgcacggg caggtgtgga cgaccagctc aatgccggaa gagcccgctg     30480
     ccgaaatgga ccagctgacc aagtatcgcc ggcaacacgg cggtagccac ctgctggagg     30540
     actatgcggc gctggagagc cgcaagcagg agcgtgttgt gtttgagaac gatgccttcc     30600
     tggttgtctg tccgtggtgg gctacctggc cgtttgagac gatgattgtg agccgcacgc     30660
     acaagcgcgc gctggtggat ttgtctgagg ccgataagat gctgcttgct gaggcaatcg     30720
     ccgagatcac ccgtcgctac gataatctct tcgagacgca cttcccttac agtatgggta     30780
     ttcaccaggc tccgctcgat ggcaccgagg aagagattga ggcgtcatac ctgcacttgc     30840
     acttttatcc gcctctgctc cgaagcgcta ccgtgcgcaa gttcttggtt ggctatgagc     30900
     ttatggcgga gcctcaacgt gatatcaccc ctgagcaagc tgctgctaag ctgcgggctt     30960
     gcggtggtga gttgtacagg aagaagattg actcgtgaag tgtctcagaa ttaataaagg     31020
     aaatagaaaa gaaaagcaat tgatgaagtc ctgggcgggg ttatcccaga attaaagata     31080
     ttccatctta tgtgcaatat atattatttc ccccgcaaag gctgttgtac atagttgtga     31140
     tccaacatgc aatgctcggt tccatagcta tttgttgaac cacccccctc tccaaatcac     31200
     ttaacccagg taggcctcgc gctgggtcaa catccaagcc agcgagcccg acgcaacaat     31260
     caaaggattc aagaaccggc ccttgagcga ggcattgccg aagacgagct cgccgataaa     31320
     gtgcgagagc gcaatgccgt acgtccacat tccaaggtca tacgcgacag agtttgtgat     31380
     gttgtaagca gcggtcatgc gaatgactgc agagaggaag gtccaggttc cgaagacgcg     31440
     gccggagagc ggcgttgcgg ggaccgtgcc attactgtag agtagggacg tgtatttcgg     31500
     agaggtgtag gcttgcaggc tgttaagagc ggagacgacc gaaacctata tagagaggtt     31560
     gctggttagc ttggagaata gagcagtggt aatgggatgg caacaggcag aacctacgaa     31620
     gaaaagccat ttaggcagaa atccctcgga ctgggggaga taggcaaggt actggtccat     31680
     ttttgagcga gtgtcccttt tgttttgatc tgaaggggaa gttgtttttc ttgcgacttg     31740
     gaggccgagg gagcatgttt ggacagtctt ggcgtttgtt cttcccccaa caagcctaac     31800
     gtcggttttg ctcaaccttt tctccccttc tgtctacttt ttcttattca cgttcctttg     31860
     cccgttatgg atctctcaaa gcatattgag tgtctctcgc aatggccagc ccatattgcc     31920
     ccgggtttgc ctacttatgg agcgctgttc ctcctggcga ccggagggtt ggttattgcc     31980
     cgcaaggtct ggacgttcat gcgggtgctt ctcagtctgt tcgtgcttcc gggtaaaccg     32040
     gtatgtaacc tcggtatcca ggtccacaaa tgaaaaagat gaagctgatt agaatcattg     32100
     agtagcttcg ctctttcggt ccccccggta gctgggccgt ggtaacaggc gcctcagacg     32160
     gcctgggtaa ggaattcgcg ctgcaattgg cgaagtcgaa gttcaacatc gtgctcgtat     32220
     cgcgaacagc ctcgaagctg gcaaccctgt cggaggatat caccaagcag ttcccgcagg     32280
     tgcagaccaa gacactcgca atggatttct cacggaacgc cgacgccgac taccaggcgc     32340
     tgggcgaact ggtctccgat attgacgtgt ccgtgctcgt caacaacgtc ggtctgagcc     32400
     actcgatccc cgttccgttc gcgcagactc cctccgcaga gatggccgat atcgtgacta     32460
     tcaactgcac cggcacgctc cgcgtcactc agcttgtcgt gccgggcatg atgcagcgcc     32520
     gccgcggtct gattctgacc atgggttctt tcggtggtct cctgcctacc ccgttcctcg     32580
     ccacttactc cggcagcaag gctttccttc aacactggtc tactgctctt ggcggcgaat     32640
     tggcccctta cggcatcgat gttgaactcg tccaagccta cctgattacc tctgccatgt     32700
     ccaagatccg tcgtgcctcg gcttctatcc ctaccccgcg cgctttcgtt cactccgttc     32760
     tggcgaagat tggtcgcagt ggtggctcgc ctacctacgc ctacagttcg tcgccctact     32820
     ggagtcatgg catcatggct tggttcttga cttctgtgtc cgggactatg ggcaagtttg     32880
     ttcttgggca aaacaagtct atgcacgaga gcattcggaa gcgcgctctc cggaaggctg     32940
     agcgtgagaa tgcgaagaag agcacttgat ctgctcggtt ttctcggttt tctgctgtaa     33000
     agcagaggga gatgcgattc ttgagccaga tttatatgtt attcgaaacg catgataggc     33060
     ttgagtaaat gtataaacag aaaaacgata gggagataat gggaacatca ttgataccta     33120
     aaggtctata ccaagaaaaa caaataagag attcttcaca ccctttgcta tcgatctcgt     33180
     atgcctccat ggctgacctc ggtagaattg tagaattctt atcgataagc cattatcacc     33240
     ccacttctct cacctgggat ctcgtgtatc atcgataatg accaagttaa accctgcatg     33300
     ctgcagagta aactgacaaa gcatgtctca atcggccctt cccgtcactg ggaccgatga     33360
     tgcctcatac ataaattcca cggacaaccg cattcatctc ctccttgccg caactggctc     33420
     agtcgcgact atcaaaatag ccaatattat cagcgccctc tcccctcatg tccacaagct     33480
     ctcgataaga gtaatcctca ccaccaaagc caaacaattc ctaagcggcc agtccgctga     33540
     gcagcccacc gtgtcgtccc tcggttccct ccctggcgta gaagctgtct atgacgatga     33600
     cgcggagtgg ggtccggagc cctggcgccg cggtgttgat atcttgcaca tatctcttcg     33660
     acgctgggcg gatatccttg tcattgctcc tctttccgca aacaccctag cgaagctcgc     33720
     caacggactt agcgataatc tattgacgtc cgtatgtcga gcgtgggata cagatggcca     33780
     ggtcgacggg aaacgaaaac ggattgtagt tgcaccggcc atgaatacag ctatgtggcg     33840
     acacccagtg acgggccagc atatccgggt gctagaggtg gaatggggtg ttggaaaaga     33900
     caacaaggga ggtgagacag gctggttcga ggttctgcaa ccgcagtcgt cgaaggtgtt     33960
     ggcttgcgga gacgtgggga gtggagctat gttggaatgg accgagatag tgaaggtcat     34020
     tgaggatagg ttggggttga gtgattagac ttcttggggt ggtcagggat ctgtccttgc     34080
     cattcctgcc ttctttacca catccgtgga tctgatttgg gtcctttgtg atataccatg     34140
     atgtattctc ttccccgttt ccgtattttc tttgattctc tgacaaaggg ctgcggggga     34200
     ggatgaattc cctacgggga tggagatgat ttgttaagga atgatgagga tgaggaaaat     34260
     acaagccaag taaaagcaca ttctataaac tcgggccctc ggttgcaaca cagaagatat     34320
     caatcatgag ttggccaggt cctttcgtcc agtcacttta cccagtgcaa acacatagaa     34380
     atgtatcacc caatccgaga gagatacctg aaccaaaacc tccaagtaat agacattccg     34440
     tccggcgatg gtttggtgag gaaacagggg agtctgaagt gacatcgaat ataatctatg     34500
     cagtgaaaaa taacgaagaa acatgtgtgg ccattgtttt cgccaaataa gacataaaat     34560
     ggagcatggc catgctggct ttagaaacct atccctcctc tttctcatat atcacccgga     34620
     ctacatttct tcttcttctt cttcttcttc ttctactact actactacta ccaccatgag     34680
     tactaccaga tcgagaaaca gagacctcag gtaagaaact tccccctttg ctgctaactt     34740
     ttggtctgac atgggtgctg cactgatggg taatatacga ggccacgttg atttttttga     34800
     attcgagggg ctggcagagc tgcctgagac attcacctcg gttgacagtt taaatagaag     34860
     ggtggttcca catgagtaca gcttgctata cgacgatcac accaaattgg atggtggtcg     34920
     gatctcgatg gctgtttacc cagggattgt tcgcagatat atttgtgcgt gtcaagacca     34980
     gatcaccgag tactacggag caaatgtcgg ggtctcccca agggagaaat atagaaatga     35040
     tctaatatga tctgaacgaa ttggcttgtt ttgtcttgac ttttgttcat cggcatttgt     35100
     atatcgtttc gtatacctct aggttgatag atagaatata tataccaaaa aaaaaaagaa     35160
     atggcgccac ccggaatcga accggggcta acacagaatt gtgtaacacc acaatgtgtc     35220
     gtcataccac tagaccatgg caccaattgg atattaacct actctttctt accccttacc     35280
     taggcaacac caatactttt tatagggaaa cccttcccct cggtgatcgg taggctatac     35340
     aggggttggg tagaatccgg gaattcgcga gattgcagac cgacatcatt ggtacggagt     35400
     ggaaacgaaa aggacaggca aataaatcgt tgaaaataat ataatctact cttgctatag     35460
     acataccaaa gtagcccggc tgtgcgcaat cggcagcgca catgacttct aatttttctt     35520
     cctttcaaaa aaaggaaaag tgggaatgga tatcataggt tctcgtctat cccggggtct     35580
     ggttcgtgga ttagaatctt actacctacc taggtaccta tgtaggtagg taggttagtg     35640
     ctcgtaggtt agagggagta atagtggaag gcgcgtgcat tgctttcgtg cctactccgt     35700
     acgtctgtag gcatgggttg ttagccgcta tagaaaaagt acgtttcaca tattgggggg     35760
     ccaggccatc tgagaagttc aattttccca acgcctgtct agtagactat ataaagcacg     35820
     gcttaaggac cattatatag tgattcgaca agagctactc atgacggtca gacttatggt     35880
     tgcctgtttg tgtagaaacg atccgcttaa attcaatgtg agttttcgcg atgctgtaag     35940
     caaattcact ggccagggga cacagtaaga gtcgtaatta cccatggatg tacgtcctca     36000
     cagtctgatg ttcccagttt atctacccga caacctggaa cccacaccgc agggttcttt     36060
     gaaaaattct gcttcgagcc acgccagcca tccaaagacc tgcgttcata tctcaatatc     36120
     cttgtacgcc ccacgatatt ctcaatggat ggccaaaaac gacgcggcgg gctcggacgc     36180
     gggggatcgc gcccctccca cccacgcgtg cccccctcaa tagctatcaa cccgggcaca     36240
     tccgtcaata tcatcctcaa agccgaccag cccacagggc gtacagtacc aggaagagtg     36300
     agcgaattac tcacgcgtgg cgatcaccca cgaggcgtca aagtgcgtct taccgacggg     36360
     cgcgtcggaa gggtgcagag cctccggagc ggtgagccga cgcgggaaat agatggagga     36420
     gcagagggcg cacaagagag cgcgcccggt attcaattaa gagtagaggg aggtcattta     36480
     aacgggagac gcaatcgttt tacctcgcgt gatatgcgtc ttgatgggcc ggaggagcct     36540
     tcagctgagc cccttgggct ggacatgtac atacgccctg cgaagggaaa gaagaagagc     36600
     aaaaagacac aggccggacg gaatgagcaa ctggaggaga ggcttgagga tataggcggt     36660
     gccactcagc taccgggctc tctcaaatgt cccgtgtgcg cagacttcga gggcgacgaa     36720
     gccgctgtgg cgcaccacgt tgctggtcat ttcggagagt gactggtcaa gagtaccgag     36780
     caaaccatac aagagttgca gcatagttca gctatccttg caagatcatg caaagccatt     36840
     gaaccttgga agtgcttttg ttaagccttg gagtttagag cggaaagatc gtgacaggga     36900
     ctgccttttt ttctcgctac ttcattcact gagactggaa taaggtgatc gacatcctct     36960
     gtgtccacta tctggcgtgt gatcgatccc atccagacgc atcaggccga tcatgtctcc     37020
     catggcaggg agtcgctcct gcttcatgac tttgaggcat gtcggtatca ccatggagaa     37080
     tttttccaaa atgtgatccc atactgccgg tcaaattctc gacacccttc tccccaaaaa     37140
     tttacttcaa aaatatccat cctaacccga caaccggagc tcccgacgct agagccttta     37200
     gtggataaag atggagaatt tttctagcct tcagatagtg aaacggagtc atgaccgtag     37260
     aactataaaa tgaaactttt ggactttgac tttcatgtat tgcttgctac tttagagagt     37320
     ggtgacatga gaaattcaac ggctatacac cctacctacc tacctagtca tggtaggtaa     37380
     cagtcagcaa ctcgcggatt tccctcagga tcatatcaat ggcgttaaca tcatctttga     37440
     tggaaaaagc caacccttcc gatttgagac cttagtaagc tttctgcttt gggggcataa     37500
     caagaaagcg cactagatgc ccaatacaca gaaggccgtg aattggtcag gagaggtttc     37560
     tctgttcccg gagctgtatg tattgctcta attggtgatt ggccgctccc actccccatc     37620
     tcgaatcaaa ccctacgttc cctgccgtga cctgcagtca taccaggtgt tcgattgcgc     37680
     tgcggcttcc gtccaccacc tcgattttcc ctccgctgat cggggcagtt cggactttca     37740
     ttctgtcgat cagatacgct ggaatcaggt ttgacagacc aacaatatga ccatttcccc     37800
     aacaacatcc ggggaaacac tattgtcact ctctgccggc aaagattcag gcaccgaggc     37860
     acagtatata cgaaaattac tagctcttat actcatccat ggatcttaac cttccgtcga     37920
     aattctgaat acaacagcac agttcgtatt tattccagta ctagcgtggg accaaattct     37980
     tccttaacga tacatacata tgtattttcc aaggttgctt cattcgtaat aatcagccgg     38040
     ctttttgtat cgattagatc gacggtaaac aaatccacac tccaagcggt cctgcatgat     38100
     aagtccaact gccccttctt cgtcctgtat tgccttcgct tcactccaat caacgttatc     38160
     tgcataatcc ttgcgaaaat tgcagagcgc aaagtcaatc atgaccacct tgtatccact     38220
     ttccgcccgc gtgtccttct tcacgataaa gcttctcgtc ttgacatcct cgtttaatat     38280
     cccatgatca cccatccgat gaagtatttg tatagcttct tcgcagatgc tttgccagca     38340
     ctctcttggt gtgtggtcgg cgatatcggt caaaggaaac ccttcaatat actctaaaag     38400
     gattccagaa acatcgatat actggctggc tggctgcatt tccgccaaac tacagcctgg     38460
     aattgtgacg taggcaagta gttgagggat atcatttcct tgcatatccc tcaaggtgtc     38520
     atatacccga acctctgttt catacagatc cgataaatga tcataaagat aggcttcgtc     38580
     ctgggagcta ttccatgttt cgccttgctg tgctatgtcg ccgttgttgt tgagctcagt     38640
     gatgaattga gatgcaccac catcaagaac gaattgatga taatcgctct caatatctga     38700
     agtccaggga cgaagttttt catctttccg gagctgtgtt gcaaagcgtc gatcaaaaag     38760
     cttcaatacc atatcgcctt ctaatgccaa atcagaacag gctattcgaa cgaccatcac     38820
     agaggaaagg gtgaacggtt cgaataactt gatgattctg gcatcggtca agacctcatt     38880
     atctttcatt ttgagatgta gtttgatcgt attgccaacc acataaggac atctagaata     38940
     atcagtatat ctctaagact ccgtaggcag gccacccact ggttttcttg ccgatccatt     39000
     atgattgggg aatgacctga acgcaaatcc gacctttagc cttcacccta ccgcataagt     39060
     tctgatatgg acctccataa tagaaaaaaa ggttagagcg agtcaaagta ggaaaaattg     39120
     gctaaggggt atgtaagcta gtcagtcgta ccgaaaataa cgtagggggc ggagctcgga     39180
     atccggatga attgaaaaaa taccttacta gatcaacctt agaaggacag atgagggtta     39240
     aataggacct cgcactaacg cagagggtgc gaaaaaggtg gtcaaggcta aatcagacac     39300
     agtctacatc caatatccga tatggtgtag tggctaacat cgccgtctct cacacggcag     39360
     ccgggggttc gattccccct atcggagttt atttttccac agcctttttc gtctttggct     39420
     ctaatataag taagataact acctaggtat gtacaactgc atatgcagtt tatgcttttt     39480
     actgccttag tatatttggt ctactgagta tagcaatcca gggtccaacc tgcaagtctg     39540
     gaaacgctgt atttcatgat tctgcatgat ataacagaac cctcatgctt tcttcacata     39600
     gtcaatcttc ctagccagcc aacaaccaat cgtgcacccc tggattgcat cacgatcatt     39660
     ccgggaaaag gcaatggtcc aatcccccgg agctggagca tccagaccac gtggacaagt     39720
     caaaacccag acatcatctc ctagatattt catgggggtt gcatttcctt gacccaaata     39780
     tccgtcaaac gcaccgtata gcatcccatc ctggccaagg caatggaagg tagattcaat     39840
     ctcggcacag tggtagatac cttggaatga agtcccctta aggattgatt ctttcgggac     39900
     aatacgccga gcactaagca tccggttatc tctcacgcga tgaatactca acaaatcttc     39960
     atcgatcgta gcaaccatcg aatcggactt tccatgattc ggtacactaa gcttaatagg     40020
     ctcggcagac ccatcgtagc tgatggccac ctctccatcc cgtgcgccct tggtgatgac     40080
     gatcgacagc tgggtatcct gatcaaggaa cgcgccaacc caagattctg ccgcctggat     40140
     agatgcagat acaggctttg gtagtcccaa cagatctttg aagatatcaa tgttggggcc     40200
     gaatgtgccc gaatcactgt taagcataat gacgacggac aaacgctggc gtggcgcgtg     40260
     tcgccggtgt agccgatacc ctcgcaacgc tccaccatgt ccaatcgtgt caacaccacc     40320
     gatgtcagtg tgacttagcc cataacggta cgttgcagga gttccgtctt tgaacttcgg     40380
     ggcagctata gcggcgtggt accagctttg tggatcagcg tagcagcgat cgagatactt     40440
     ctcgtacgcg atcatatcag cgagtgaagc caccagcccc gcatcaccag accactccat     40500
     tctgttggta gccgctgtga aaccatgctg ctcgtcgccc tcatacccga cacagggcga     40560
     tgggtgatgt gcggtgttgg ggcaaagaaa tgccgtgctc ataccagccg gtcggagtat     40620
     tcgctcttcg agcaatttgt ccagggactc ctcggtagct cgctcaatca cccgggcaag     40680
     tatgtggaag ttgacattgc agtaggaata ttccgtcccc ggctggaact ggaatgactt     40740
     ggttcgggca agcagtggac cacagtctct ctcaatgagg aactcgtcgt cgggcttaga     40800
     cccccacagt gtggtcatag cccagtagtc gcgcataccg gattgcatgt cgcatagccg     40860
     gtcaattgtc agttcaccgt cagaagtgag ctccgggctt agtatttccg tgagatgatc     40920
     tgagagctgc ttccggacat cgccctttgc agctaatgtc ggggttgggt tgcgttccaa     40980
     gtcaatcaac aacgcacaca caaactgttt agtaattgag cagatgggca tctgcgtttg     41040
     agcggtcatg ggaatccgtt ggtccaggtc ggcgaatccc cagacgcgct ggccgattat     41100
     ctcgccatct tggacgacgg cgatggcacc tcctgggcct cgacagcgga gggcagtttt     41160
     attcaagacc tcttgaactt tttccttggt gatttccata ttttcagact gacgtagagg     41220
     aagggaactt ctgacatctt tgttgttgcg ggacaattac cccacttcga gatcgcagat     41280
     aggtgacaag ttgctaaata tagaacagta agaaatccat agagcccaat tgtgtataac     41340
     caatatgaac tacattttgg tattgaacta cggagtaccc cgtactagac tggcaattcg     41400
     atgcgaggct ataatttgtg acttcgggaa gagatcgtag ggaaaaagcc taaaaggcca     41460
     gtgttgggta aaggcggacc accttgggat cccttttatc tcccatccat ttcaacagat     41520
     gatatacgga atagacagaa aatatatcta aaatagacga accagagagg gaaactgagt     41580
     gcatctgctt tgtaaataat ggcgccatcc catggatgct actttccaat cctgagcatt     41640
     actatcggca ctactaccaa ggatccccca agaagcctcc agtccatgta gttcagcgaa     41700
     caatagccgc aaaaagataa tagccactcc ctacgaatta ttgtccttag cagcacacct     41760
     cccacatcga aaatatcctt gcattcaagc ttcaacaaga tcggcaagcc cgaagtcgcc     41820
     gagtaagaca ttattaatct acgtcttcat tatgaaagtg agtaaaatta cctatgttgt     41880
     aactattttg tttatctgga gagaagatgt gatccgtcaa tattgccttg agcgaaacgt     41940
     atttcgaact acgatgtatt ttaatcgtga ttggatcaaa agatgatata ttaaggggtc     42000
     agtagaaaca ttggaaggca atattgaatg ccattgtctg acatctagac tcgacaacgg     42060
     cggagtacaa catacagagt agactagagc gtcatgatgc ccccctcccc cctacgggcc     42120
     gatcattaaa ccattaaggg ttgacctcgg gagcttaaaa ggggttagtt aataatagat     42180
     caatgtacgt atattgtata actaggtgac attaataaac ccctaatgga acccttccaa     42240
     tgggctcgat catgcaatga caccgattct ccactagggt gtctctgtca tattcccctt     42300
     gtgcacagac aaggtctatg tactacctat agaacactgt aaggtgcctt gggcccacct     42360
     accaatgtaa gtacatacta aatgcaacaa attaaagagg accccattgt gaaataacaa     42420
     gaaactccag ggctctttcc aaagccggat gggaatatcc ggggagatcg ggcgaaatca     42480
     tcgaatgcag cgggatccat ggaatcgtca ggacccactt ctgtatattt ttggaatcaa     42540
     ccaatcggtt caaccaatcg gagggcctag aacagggtta aagtggacaa gcaaacgtgt     42600
     tgcgacccac caaatccaca gaactacgct gtggcggaat ctagacttga atttttcatt     42660
     gtctagagcc tttgctttcg gtctttagag ggtcttgaga gggtctttag gaggcttact     42720
     tctttccgtt tgcatttctc tcgacttcca cttttcactt ttattctcat ctctcatctt     42780
     tttgtctttt caacaatttc cttacacatt cttttactcc ttcccttttt catccttctc     42840
     atttttcaat atcaaacact cgttaaacat ccaaaatgcg ttccgctcaa ttccttgccc     42900
     tcgcgatggc cgtcgctacc tccgacgcca tctctcaggg tttcaactac ggtgctctca     42960
     aggttgacgg cagcctcaaa acccaagccg acttcgagac cgagtttgca actgccaaga     43020
     atctcgttgg aaccgacaat gccttcacca gtgcccgtct gtacaccatg attcagggtg     43080
     gtacaaccaa cggccccatt gaggccattc ctgctgctat caaggagaag accacccttc     43140
     tcctgggtct ctgggcttcc ggtggcgaca tgagcaatga gatcgctgcc ctcacatccg     43200
     ccatcaacac ctacggtgag gacttcacaa acctggtcgt cggtatctcc gtcggtagtg     43260
     aggatcttta ccgtgtctcc gaaactggtg tcaaggccaa cgctggtctt ggtgtcggac     43320
     ccaccgagct tgttgactac atcaaccagg tccgctccgc catctccggc acttctctga     43380
     gcggtgcccc cattggccac gttgacacct ggaactcgtg gaccaacggg tctaactcgg     43440
     cagtcattga ggccgtcgat tggctcggtt tcgatggata cccgtactac gagaacaccg     43500
     accctaactc cattgacgac gccaaggccc tcttcgacaa gggcgttgaa aagaccaagg     43560
     ctgtcgccgg tggtaaggag gtctggatca ctgagactgg ctggcccgtt actggcccca     43620
     ctgagaacct cgctgtcgcc aacaccgcca acgccaagca gtactgggac gaggttgcct     43680
     gccccctgct gggcaacacc aacacctggt ggtacatcct cgaggacgcc ggtaccaccg     43740
     cccccagctt cggtgtcact ggttcctcca ccgacaccac ccctctgtac gacctaagct     43800
     gcaaggcctc cacatcttcc agctctgccg ccgcttcctc cagcacctcg gcctcgggcg     43860
     ccggtgtcgc cgagaagtcc ggcttcgtct cttccgctac ttctgcctcc cccactgggt     43920
     ccgccggctc tgatgcctct agctccgact ctggtgcctc tagctccgga tctggttctg     43980
     gctccacctc tggctccggc tctggttctg gttctggttc cgccagctcc cccgctggct     44040
     cctcctctgt ccgtcctacc tctgcagccg tgaccagcgg tgtccgcccc tctaccaagc     44100
     ccaagtccaa gagtgcttct gcctccgcct ctgcttccgg agccgcctct agctctgcct     44160
     ctggttcttc cgctaccgcc actggtggca gcaactccgg ctcagggtcc tctgcctctg     44220
     gttccgggtc cgggtccggc tcttcttctt ccgactccgc ttccgcctcc cccagccttc     44280
     ccgtcagctc tgctacccgt gtcgctggct ctgccgccgg tgccctggtt gctgctctcg     44340
     ctcttgcttt cactttctaa gcatttcact ttccctgggc gattcggagt gattggttgg     44400
     atgatactca ccttatagtc tgtcatttga tagtcggtga ccgcctggtt ttatgtaata     44460
     tttctgacaa ctgttaaaaa ctacgttact tgctagcatc gcatgatttc cttgtatgtt     44520
     atatcaaaaa atatcaaaca taacaatctg aaatccatct atctcctagc gtgtcaggtc     44580
     tgagtgtgta gtcttttgat ttattcgctt tacgatttga gttctgctca tctatagatg     44640
     tatgacatgc tatacgcgta accctaatct taagagtcga agatggatcg agctactaat     44700
     ggaatatgac cctatagccc tagagagaca cgaaagttat atatggatgt tatatttcaa     44760
     ctagcggtcc tctacatcta cacgacttaa accaccggca accctgttca ctaaccggat     44820
     acatggggtc tacgccatgt ttctgtattt atagggggtg ttgcggtttc catgttaaaa     44880
     cttccttctt cttcaacaac tctcaatcta gcttacaatg caactataca aaatggttca     44940
     tattgtaagt ttctccttat cgtataccag ggcgtggaaa catgctacat gagaacagca     45000
     actcacaata tgattgacat ggaagaaagg gaaaaagaaa gagaagaaca cggtagtttt     45060
     tggacttagg atcacacgtc aagtcaggtt gtgctgtatc taccattcct tcttcaggcc     45120
     catgaaatcc ttatccttgg tcacagcatc gcccgctgcc tcaaacaccc tgagaatctg     45180
     agagttcctc tccttgacgt gacttgacat aatgtcaatt gccttcgcag cctgctctgc     45240
     aagaagcttc tcatctgctt ttgatgcttc atcggcaatc tgatgtaatc gcttaagcca     45300
     gtataaccat ctccagggac taaatccacc aggtgctcgt tgacctagct ccgactggac     45360
     aaaggtgaag ccacctcttc caatggtact gttagagtaa tcattccatg agacatcgga     45420
     taagagtttg atgttatgcc cggcttctcg gatccaggca catgccgatg ggagtaacga     45480
     agcaatagta agtacatgca tcgttcggcg acggtcttcg tcatccggct cattagagcc     45540
     gccaagggga cgctcggact cgaatgtatt acgaaaaagg accagagcga tctggcaaag     45600
     ccgatcgttc acaatgcgcg tggacgccag cttcgcaagg aaggacgccg aattaaggcg     45660
     ctgctttgag tccatttccg cacagtcgtt gatccagcac tctgccatgt ctgtcgcgag     45720
     gaacggcagg tcgttccaga ctgtcccatc gggagttcta gcaatatcaa tgccaccgcc     45780
     tggtgccggc ctggttagag gcccgcgtcc ccgcgtccgg aggatgtcga ggacccatct     45840
     gtcttgctca aagctttcgt gggagacatg tttggcacat tggtaataga cgtaccagag     45900
     agaatgcaga tacggctcgc aggaatcaat ggactcgcgg ctccggcaat agctttgacc     45960
     catgatccat gctctgttat atgtcacaga tcggaggagg tcgaaattcc ctgctcgagc     46020
     agcctcctcc aggtccaccc gatccgctgg gccgcatgca gcgaagccgc aagggctatc     46080
     tcgcggtgct gaactcagtg aatctcttag taagtcgtgc atcctgagta caggagcgta     46140
     aagagctggc agtaccgatg atgagtgtca cgagggtaaa tctctagaaa taaggtgatg     46200
     gagagataga gatgagatta gagggatata ttatttataa aataagaaaa ggctgagggg     46260
     tagatctctg cggcaggcag caaccaatct tttccaatca gaccggtata ccattggtga     46320
     cacgtcactg ttcagggtag gagacccggg atcagcaaaa gatcagcaga aggcgtgtcc     46380
     atgactcgat atttggggct agatacgctg actatctagg gggaatcctg cccaggtggt     46440
     ctgactagac tctagtgctg tagcgctcca cagcagactt gaaaatagta caatgaggcg     46500
     aattatagac gtcgagatag cagttcatac tcaatgactc aatgctggta tagtgtagaa     46560
     aacaggacat atactgaaat ggagcaacct tgtgtgtgtt cctctacagt gctccacaat     46620
     caacccagta gcagcacaga agtatccgcc ttaggaagcg gtcatctcct gacaaacaca     46680
     ctttctactg taagaatcaa aatagcatcc cttgttctca atcgcgtcgg tacactgtac     46740
     gtagaagtta ccatactcct ggagtaatgg gatccagggc aaattacctt tttgaactcg     46800
     caataacaga tagcgttcag cccactttgt gaatcataat ggcattgatt ggtttctgga     46860
     aagcatttct agtttgaaaa tatcaggccc tttgtctcgt acctcaatga accttaaaga     46920
     gacttactct gggtacctga tctggcgatt gttttcattt ctgacatcca agtcatttga     46980
     agtaggagaa ccagggctcg ctgggctagc taatgctccc agggcagcag agagggcaag     47040
     tccaaaagac gtaaaggtaa aggctttcat gacgacggcg tgcacctttg gttacttggg     47100
     aagcaggact ggtgttttgg aaaagggatt tgctgttttc atctaacctc cagcatgttg     47160
     ggtttgtagc catcttatat agactcgatt tcgatccatg gtgggggctc tcagacagga     47220
     caacagtcgg aggcttacgg gtcgttggag gctgggtacc tgggcaaact cgcaacaaca     47280
     gtaaggtaca tgggaacatt tatgccgttt caacatgcca agcgtccatc caaagaagga     47340
     atatgctgca tcgaccaatt gttcgaggct atattgttag cttattgttg gtatacggcc     47400
     acgggccgac tccgcagttg actagccgct ggctcctttc cccgaaccgc acaacggaga     47460
     agggtaccaa tacagaaaat gcgtgacgtt agtggatatc ccctattggc atcttactgg     47520
     cggacaacta agcgataaat acacgcccgt gcattagcgt tgtctcaaga ttgcggcccg     47580
     gccttgaccg acgccaagct tatatataca gtaaaacccc tttataacga attaattgag     47640
     acacgggaaa aaattcgtta tatccaggtt ttcgttaaat cgaggtacca tatattaaat     47700
     atatatttct ggtttacata caaatttaag ctccaaaaaa gctcctaatg tccctctgct     47760
     tctgccctcc tatttttctc gcttcaatta acctctcatg tctatgaaga gcaccaatta     47820
     gctgggtttc accccgctcc tgctgctctt catataaccg aagggttttt aaagcctcaa     47880
     tagcctcact atgtgaaacc taggggggtt caactactat cttatcctta tcaacctctc     47940
     tgagaaatcc actaagtaca atatcatcaa cagcttcaat actatcctac acaagcttat     48000
     caactgggtt taaaaagtgc tcaatatcca ttggatttaa cacccaattc tatataataa     48060
     gcatatcaga agatatctta ttaatcagag attcaatact aatagtagta ttactactac     48120
     tagtatcaaa tgacattaag agcccttttt aaaagcagtt cttgatagta gaagctgata     48180
     tatcaagctc ttaggcttaa ataccctatt aaacagcttt tagcacattt attgaaagta     48240
     taggatctcg gcccgtatcg aactcagata atatgaattt aacctattag cgcttctaat     48300
     aagctttcca cgtattaata ataccctgat taagaggttg gaaataggag gttgaattcg     48360
     gtgggagcta gataatcagg gtgttttaaa gcggtaaaaa gctattatta atagctttta     48420
     tagctacttc gtgcgctaag aaattatcta taagaagcac caccttccta tgaatcatag     48480
     aagcgttaaa ccaccgaagc taatcttcaa aaatctcact tattatctag gccttgctat     48540
     tcgacttcca ccggatatta agattttcaa tattaatacc ggtgaaagcc cgagggtttt     48600
     tagtagtgct aataaactaa ggttttagct ttttagagct atcggaatta gagtaaaata     48660
     aggctatgat tctagccttt tcctttttcc ttctaggtag agaccgggtt aacagacctc     48720
     gatcaggaat acgcttccaa aaaaggccag tttcatcaca attaaatata tcccgagggc     48780
     tatatgattt aagagcttaa cgaattagaa ttatagcttt agaagcaagc tccggggtac     48840
     ttctatcgtc actatattat aaacgattgc gtacagattc acagtattaa aacctagtaa     48900
     gccagctatt gctaaatacc ggcatttcaa cacctttata actaggaatt taggcctaaa     48960
     aaaagcgcgc tttctcacgt ataacctcct aggttatagg gatataatat ttagccagtt     49020
     ttatccaatt gataagtgct ttttcgagat ctggccaccg tgctatacga acgcgcttcg     49080
     cattgaatta gtgatttaag agatcggtag cggtatcaag gtgaacgtat cgggaggaaa     49140
     ggatctcaga gattgtagag tgagcgagac gatgattata ggctttataa aaccaatctg     49200
     caagctgctt ctgcgaatat aaggggtggt ttcggcgcta cgttcggaga gcgatttttt     49260
     gggaggttgg aatagatcgg cgaggcattt tgattggtta aaaaagggat gaaaagacct     49320
     agatataacg aattttgtat gggagagatg aaaaattaac gacattcgta gtaaagaggt     49380
     tttaacgaat tttgtatggc ggattaattc agacaccggt ttccggtcgt tatatccggg     49440
     tattcgttat atccgggttc gttataaagg ggttttactg taataacaat agtgtctcaa     49500
     gaaaagtgga gtagttcaca gctttatgat attactatct atgactaatg ctcgatccat     49560
     acggtacttc tgtcactcga cccttagcat tgagccttcg taagggctgt gtttcctgtc     49620
     caatttctat tctgggccaa tttggagagg gcgccgaagg caacattgtc catgaaagta     49680
     ttccggcttc gcttctgaac gcgatgtaac atcaactaac gtaggaggat cattacctgc     49740
     gctagaagcc cggcggcaac gagacctatt caaatccctc aagcactatg gtcattgatt     49800
     gccgttcaac agggatcctg atccatatga acggggtagg gcaacaacaa gaacccgcag     49860
     atcaatcatg ggatatagcg taaaagtacc taggactatc caccttcacg gtgtcaatta     49920
     ataaaaattc ctaggcgagt cggcggcgta tcttcgggtt acagtcttga gctagtaata     49980
     cagtggccag agggtgctta ggaatactag atagaagcta actatacatt ttctatagtt     50040
     gttggcgcta tagaactact tcgactgaga ccgaaggatc atggcttttt tgatatcttt     50100
     gtgtttatca ggtgcattga catggacctt gggcttcaca gaacgtagta acatcgaatc     50160
     tacaatgtat ggccatcctt gattaagata tggtattgaa tacttgcttg taaagtatgc     50220
     tggatgatac atgtgtcact gctctgcctg gtgttaggta agaactcgcc cttgctgagc     50280
     ctgctccgaa ccctgccatc gtagtcgctt atcaagtaaa cattattacc agggtctgat     50340
     accaatccat ttaatgttat gcaaaggtga ccacgacttc cgtcccgtgt ctcggtatgg     50400
     ccagcgcggt gtcgtggggc atctcctggc aaggcagatt tgtgctacga tcagtacttg     50460
     attgagataa aggactcaac tctcgagccc aagggcggcg atccacgagc ggagtccata     50520
     ggaaactaga cgcttgtcgg gaagttgaac tccaggaccg gtcgagtggg caacatggcc     50580
     ggaatccccg taaccagaag gatataaaag ggtcgatgct cgctgcctct ggacgacttc     50640
     tctactacca acgcacttag gcactctacc tactaccatc cagaatctat acaatctttc     50700
     tgtctttctc tgaccaatag ccctttatca aaaccaccac aatgcagctt atcaatcacg     50760
     ccgtttatgc cgtcactgtc ctggccacca ttgcggcagc agtccccggc ccaatcgttg     50820
     ctagaggtga aaagttcccc gtttccaatg gtgacaaatc cgtcatggtt gaaactgaac     50880
     cctctgcgga gaccggcaac gttttgatgg ccttgggcga aggggacgtc gactgcaagg     50940
     gctctgcctt ttgcgaaaaa ctaggttcta gctgtgatga tgcttatcgc aaggttattc     51000
     ccagcaacac ctacagcact tacctgaggt atgtctacgc tttaatgaga atggatgatt     51060
     tggcttttca ttaactcgac aaagcgcttc cgatactgga tcttgcagtg gaacctgcgg     51120
     tctttttgtc agcggcgacc actgtgaagt catggggcag gatttgatgg acgcttacaa     51180
     tgacattcgc aaccgaggcc attgcaacca ttgcggacgc aagcaaatcg ccaacggctg     51240
     tatgatcaag attgaccggg tgacgggttg ctagacaagg ctgcgccgtg ttgattgaga     51300
     agtgcatacc atatacatgt atttagggcc acagagtcgc agcttttggc tttcagtttc     51360
     caggatttag ttgagatgcc cgactgttcc ttaaggactg gaacaaagta gttaaggctt     51420
     tctcaaatgt accggaccgt actagaattc tcatggtgaa cattagctgc ttatagggag     51480
     gattttctag ggttagttac atcgtattta ggctgtctta gctagtgtaa tagttcttaa     51540
     ctcactccac cgacactcgg gaggggatac gggatctcca tgggctaact tacggctagt     51600
     catatatttc ggaatccggt tggttgagag gtcaaaggcg acgatattgt gggtcatttt     51660
     gttaggtcta aatgtggact gggtgacccg ttcagggatc tcatcattac ctgtttgggt     51720
     gaaaaggccc cgttgtctct agtccccatg taggctgaga gacaatccct gagccgctag     51780
     ctcagtcttc tgcctggggg agattcggtg ccccccaggt atcccactta ccattctcgc     51840
     cattttcagc attctcacca tgcaccgatc atggaacagt tggtgttccc ttcggcggat     51900
     gatattcgca gtcgctattg gggcttgcgg tgttttcgtc tacctaatat ggtttgggat     51960
     gaactcagac cgtgataatg tccccctgct cctcacacaa cttatcccag caggccactg     52020
     cacctgccaa tcatccactt catttcaatg tgccgactgc ctcacctgtc tcgcctcgcc     52080
     accgccattg gaaccagaac accttgcaac ttggagtttc cagtacgggc gggacgacca     52140
     gaacctaggc ctgacccaga atcagtgcca ggcagcattc cccggtctct cccaggacat     52200
     ccagcgaggg gtcgagtact ggaagtcgcg aggacgcata tcaagagagg atctgagaac     52260
     gatcccattc aaagatggca tggcccgcgc catcatctct aacggagact tgtacgtcgt     52320
     ggcgacaaga gcaaaagggg atgaccatcg gcgcaagata cttggtactc taggatctat     52380
     ccatcgggcg ctatccgcgt cctcgaatcg tacctcccac cccacaatcg agtttatctt     52440
     ctcgatcgaa gatcgcgtgg atgacgttga cgcagtcagc cacccggtct gggtgttatc     52500
     gaggaaagca tccgaggagt cggtcattct gatgcccgat ttcgggtact ggtcctggga     52560
     caagagtaac atcggcccat acggacaagt cgtacagagc atcatggccg ctgaatccaa     52620
     tctgaaattc gcggataaag aacagaagct ggtctggcgg ggtaagttga gctttgcacc     52680
     aaagctgcgt cgggcgctct tggacattgc acggggtaag ccttggagcg atgtgaagga     52740
     gctggattgg agcaagaggg ccaacttctt gtcgatggag gatcactgtc ggtacatgtt     52800
     tatcgggcat gtcgaaggta cgtttctttc acccacctga ctttgcccag gtgctgtaca     52860
     aggctgacaa agacatcgtc aatatccagg tcgtgcatac tcggcatccc ttaaataccg     52920
     acaagcctgt cggtccgtcg tcgtggcgca tcagctgcag tatatccaac atcaccacta     52980
     tctcctcgta tcgtccggtc cggaacagaa ctacgtggaa gtcgagagag acttctccga     53040
     tctcccgaaa cgcatggacg aactcttgaa gaacccggac aaggcagagc gtatagccaa     53100
     taacagtgta aaaaccttcc gagaacgata cctaactcca gctgctgagg catgttactg     53160
     gagagctctg tgggagggat gggctgaagt ctcagcgaat gtcacacgcg acgttgaacg     53220
     gccgccggtt gacaggggac ttcgatatga atcttttgtg ttgctggaca gtaacgatat     53280
     gttcaagtac tcatttggat cggagtaaga gggatgtgtt tttgtatata ataatataat     53340
     agccgatatg atatataaat gaatctatac atgacaaata tcatgatatg aatgcctttg     53400
     caggttacat atgtaccatc aggtctccct tgctggattg gtctttacag cgatgcaaag     53460
     taaattgtta ttagcctaag tccaaattcc aacccgaatg cggaagttgg agaatatgga     53520
     tgtgatggga tgtgatggat gtgataggac gagataaagc agtcactcaa gcatttcagg     53580
     actagactcg aaatatagtc cagtttatcg tgatcgacac tttcatttct ttctttttcc     53640
     cttcccatct tttatctccc tcagtcatgg atcgagatca gcagaaatac gatgtccact     53700
     ccactatgga ggtggatggc ccctcaaaca agaacaagcc gactgcacca gatgaattcg     53760
     acgagagtta ccgcaccacc cgcatggaaa tctgggccta ttatgcgtgc gtggattgct     53820
     gaattgacca ctgcgcggaa acctaacacc accatttgca gctattacat tggaaataat     53880
     ggcttgtcgc tcttcagtgg gtctactcgc atttctcaat caggaaattc gcgaaagcag     53940
     aagctgacct cattctagac ttcgcgccaa ctgctttcca aaacttgctc taccaggcag     54000
     cgccttccga tggactgctc gactttatag gcagaccacg cacgatcaac agcatcgtac     54060
     ttctctcgaa tggaatttcc tttgcgatcc aggtcgtgat attcctggta attggcagtt     54120
     ttgccgattt cggccactgg cgacccaaca tcttgatcgt gctgtcaatt attgcctacg     54180
     ccatcggctt tggctggtta ggtgtccata cctcggacaa atggcatgtc gcgattggtc     54240
     tgtatatggt cggtttgatc gcctatcaga ccacgctcac tttctggacc gctgctttcc     54300
     cgggcttggc gcgcaattcc ctcgaattga aggaaaaggc ggacgcatat gtcgcgggga     54360
     cgattactcg cgatgaatac gactatgcgg acagcatgat gcgcagcaaa cttgccaatg     54420
     tcgctttcta tgttcagtct gtcgcggaaa tctttatttt ggcgatcatc gtgggtatca     54480
     tgttcgggtt gaatgtcaat gccagcgaga gcaataacaa ctgggggctg agcgtgctga     54540
     tcgccttcgc ctctggcgtg tggttgctcg tctcgattcc gtggtttgct cttgagaaac     54600
     gccgtcccgg tcaagaccct gggacacggt ctgttcttat tgcaggactg tggcagctat     54660
     ggtatgctat gaagcagatt tggcatttaa agcagagtct cctctatcta atcggtaaaa     54720
     ctctatgctc tattatgtct actgtgtgag tattaagtgc taacggtgct ggcaataggt     54780
     tatttcttac ttggcgactc tctgaacacc actgtgactg ttattgccac tttgcagaat     54840
     agcatcgttg cgtataatac cctggaactg acatacctgc ttattgttgg tattgctgca     54900
     caagtgagct tgaagtattt gagccattcg gttacaaact gacagctttc tcttaggcgg     54960
     ttggcatata cgcattttgg acaattcagc aacgcttcaa gctcggaacc aaaaccatgt     55020
     tcaacaccat cgccgttgga atcgtcctgc ttgatggctg gggcatggtc ggcatctgga     55080
     ccgacaagtt cggcttccac aatgcatggg aagtctgggt atgtcaatcc cactctggca     55140
     tatgggaatc aatacctaat tgaatatata tatataggtt taccaagcgt tctatggcct     55200
     tttcatctgc ccctggtaca gctactcgca aatcatgatc tcggaagtca caccacgcgg     55260
     ccacgagttc ctgttcttca gtctcttcag catcattggc aagacctcgt cttttatcgg     55320
     tcccatcgtc tccagtgcaa ttatcgacgc aagtccgtcg ggaaatgtct cgatgccatt     55380
     ctacttcttg tttgcgttga gtgttgtcag ctttttgata ctgttctggg gtgttgatct     55440
     aaagaagagc cagagagagc aggagaggtt cttgttggac aagttgcggc ggttgaatgc     55500
     cagtacgtcg tcttctgatg aggggacttc tgcagcagtc tgaactacta tcttcagatg     55560
     tcatgggtgg ttgactgttc tgtttgtcta catagtacta tacgcgccac gactgcgata     55620
     ggaaataacg acatgaagcg gctgtctacc gaatacagcc attgatagaa agaggtggcc     55680
     agtcatatgt ttaagagaaa agacgaggga cttcaataat cacatcaggc ctaagagaat     55740
     acctaaacta gccactggtc atgcttctta accggtctat gcttttcatt catggataga     55800
     attggcttaa cacaagactc tttctttttt ttcttgactg gcaaaatttg agaacaaatt     55860
     gaacacggct ggtcatcgat cagatggatg aagaatttta ctacctgttc aaaaacaatt     55920
     tgtgtgaagt agatcatttc ttggtattga acaatatttt tgtaaatgta cacaccagct     55980
     tggggcgtac acgggttgcg ttgcaacgaa gaaccaggag acaagacatt taaacgccag     56040
     acctatgcac tgccataagc gccaattccg atacaagata ccgataccac aatcaaagag     56100
     cagatcattc cccgtcggaa gaagcttcct tggacttgct cttcttcttt ttctttttct     56160
     ctttgcgctc ggcagcctcg tcggcgtcga catcctcctc ggcatcgcgt ttccgcttgc     56220
     tcttttcctt cttctctttc ttttccttct tctccttctt ttccttcttc ttcttttcgt     56280
     cgagatcggc cggtgtcacc tcctcgggcg caacgaaatc cttctcgcgc tcgcgcatct     56340
     tctcgtcccg cttgagacgc tgtcgctcga caacttcctc cttgtgaacg cgttccttgg     56400
     cctcctttga caagaagtac tctccagact cgatctgcaa atcgaccttg ctcttctccg     56460
     gtgcgggagg gaacggcgtg tacgtcttct tcgtcttgtc ggtgaccttg aacggcacgt     56520
     gacgcttgga cagcgtgcgc ttcttgaagt taggcaggaa ccggtcccag gactcttccg     56580
     ccagcgtcgg gtccttggcg agctcgcgct tgatcatcaa ctccttgatg tggtagatcg     56640
     ggtggatatt cgccatgcag tcgtcgataa tgcgtcgcac ctccttcagt cccttgaacg     56700
     gacccatcac cgccaccgtg ttaccctgaa ccaggatgta tgtgctagtg agcagctcga     56760
     gcgctttgag ggttgaaccg ttcgggccga gaatgcgctg gcgccgcttc acgaatcgct     56820
     ctttgttccg cacttggttg cggatcttga tcacgtcaca ggccacgccg tcttcgagga     56880
     tcttcatcgc ttgtgtcact ggtacgcttc gtgcgagcaa cttgatcaaa tcccgggctt     56940
     tgatgatcgc tgctggatcg taggtcttcc gcgtggtctt cactgtcatg ctaccttcaa     57000
     ccaaatccag tgtacaagcg atgccctgct tctccagcgc tcgtgtgatc accggccatg     57060
     cttccttcaa gtactgttca cggtatttgg ggaagagtgt catgaaggac gactcctcgg     57120
     cgaaactgcc cgcggcattg tgttctggtt tgaattcttc gatctgttac gagaatccgt     57180
     cagtaaggat ctgatgcaaa agagacagca tctgtgttgg tttaccttcc atttatcaat     57240
     atcatctgta tcccaggcct tttccttatt gtgtgttgaa ggcatcttgt tggtggttaa     57300
     ggaaaaagaa ctggcgtccc ggagctcaaa tgaaaatccg cgccaacttt tttttctccc     57360
     cgctttcccc gattgggtag gatctggtgc cttacatatc aggtgtcaac acatctagat     57420
     tggttccctg cgtagttatc tttcctttct gttagttcta cgctgatatc cgctgcgtac     57480
     gggctaatta tagttaaagt tggggaaatt tatcattggc atataacaag ggtacttcga     57540
     tatcaggtac ctcgcacaga aaagacaaat gaattggaga ttgatggcaa aagtatgcga     57600
     tttccacatc cataaattga ctatttggac catcttaggc tttccaagta ccaatcttcc     57660
     atgactgatt tgtactaatt gcagccgcaa tatgtctgat atggatcatc ccctccatgg     57720
     ctgttttagc ctcagaaccc ctggagacca atcgcaagga ctgcacgcga taggcacgac     57780
     tctcgggtag atctgtgccc aatggtcgcc tcaaggctcc gcaacacacc cataaagagg     57840
     agatcgtgga gcttatacat gtcgagttct catgttggtt cttccaatgt ttcgccaatc     57900
     cagatgccgt aacttctcgc agtgtcgctc tcacccaggg gcattcaagg atgaactcta     57960
     ataagccact aagaggcggc atggcctctt cccgagtaag ggacaagaaa accaacgaat     58020
     caacaagaat cccgcgctag tcagatcccg atatgcaact ctgctcgtgt aaactcccag     58080
     ttgttcgtga tttggaggta atgattgggt actaaaccgg cgcgggaaac acggtgcacc     58140
     attggaagaa tgtgcatata ttggttatcg gagctcctgc tgcatagaga ataccggtag     58200
     cagacgagac ccaacctttg ttccctatgt aatgtgcaac atttgaacgg acgttgtggc     58260
     tgcccattga ggtttgaagg gggctcgctg ccgccgtcgg ggctatcact ttttatttgg     58320
     aacgagagtc tgctccgaag gcgtgaaggt gtgaaggcgt gctagctgat tgcacgaagc     58380
     tctcaagttg tcaacctggt atggacatcg gtaacagctg ggattgacat tgaagcccag     58440
     tcaaagcgta tgtacactct gagatggatg aaaatcggtg gttccctggc tcgcccgtga     58500
     gttcggagta acggcaagtc ccctcctgtt tcatcttcct gttctcttct gcaccttttg     58560
     tcacttcgct gatcaggtac atctcttggg gcgtgaccgt gtcaaaaaac atctttctct     58620
     aaaaggcatg gtcagatcgg gggccaacgg tgtcgggtat cgcgcactgg gcaccatctc     58680
     aacggctcta tctgcacccc ccaagctccc tgctctcaaa ccctctcctg ttccgtttcg     58740
     ctcccatttt gtctaggagc agttaactag aagttcaact taccctagac agcgacagct     58800
     atgcctcggc cccaggtctc attcaataca ccttcacttt cccaccgcgt tgggcagtaa     58860
     ccccaacacc gatttcgggt ggatacgagg ctcttcggag ccaagacttg atgtatgtgg     58920
     gagttgttgg cttccgcaga aacccgtgat gcgcacggtg gactacgagc atcttctcac     58980
     ctcaatcgcc gccgagtcgt tccactcgtt ctctgtgcga ccacgcagtc ccctttcatt     59040
     gaatcacgcc gagattcccg aggtctccac tggacttcgg caaacataca gcgacggtta     59100
     ttgatacgga tccccatcgc attacagatg gcaaaaggaa agaacaggtg catcaaaaac     59160
     gctcattcga ctaaccatct ttccgctaat gcgatatgtt tgtgcaaacg gcatgcgaag     59220
     agcaaaacaa caaaatctgt acaatatgct ggatgcggaa tgcaggaggg acggcatcgt     59280
     ggcgtcgaca cagggcccaa ttgtcttgcg aactagtttt ttgttctttc gtaagaggtt     59340
     gtcccatatc gaggcataat gcgatgtctt tatggctttc tgccaatgca cacgtatctg     59400
     cgctgtcaga ctttatctct cgatatcatc ttgggacaat acctacagtg ggaaatatgc     59460
     ctttagtgtg ggatctgctg cctcttgttg cgcttgctcc accaaagaat tgaaagtatc     59520
     ttgggacata tgcaagcgtt gagtcaaagg gtatagtgca aatgatcgga gaagttgctg     59580
     catgtttgca caactgtatc ggccgatgtt tcgcatccgt cggtctgcat tgaatcaatc     59640
     agtctcgttc gttcttcctg ggcagccaaa taccgaccag tcgaccacgg agatagagga     59700
     agaggaatca tcttcgcatc cacctcgacg aggcccgcct cggtcatgag atttctcagt     59760
     ttcgatccga tccgaaggtc tttcctgtct tccagtgcac gcaggtattg tgtgctccac     59820
     ctcctcaaag catgctcatc cgtgattgag ccgttgtctg attgaacatt gaagtatatc     59880
     tccaccattt ggacccaacc tccaggtttc aagacccttg acgaccgctg atgttagtcc     59940
     tggtgtttca gttggaggac tcctgcctca tggaggtggc ggcaaggtcg acttgctctg     60000
     gaggattcgc acctgactat gtcgcgaaga taggatggcc atcgggatcg gttgatgccg     60060
     gtcgcaagga gtctagagtg aacaaggtcg aaatggtttg caggaaaggt gaaacggcgg     60120
     ttcaagtcat cgacctattc ggcacacgtt agcgactgtc tttcgggagg gcacgcacac     60180
     ctggacggaa ctggagttca agattgacgg atcccacaaa ggtcccgaag cacgaagtca     60240
     tgggtcagag gcagtgttcc agccttatca tggtgtaaac cacaccggcc cccacggtga     60300
     gatgtgagac agggttactt acctggagcc acaagttgtc aggcatgtcg tctggactca     60360
     tgtgaggggc aatgtctacg ccgatgacct atgaaccaaa atatgaggat gctgtcgggc     60420
     gcaatcaaag ggaacatctc acttcgcagt caggattctg ctcggcgaca tcgacggccc     60480
     aggatgcgga tccatgccca cagtctagaa ctcttctcag tcgacggatt ggtgggaaga     60540
     tcagacggtt atcgaaaatt ctttggaaaa cttgttgttg gtcttcgagt cgttgtgctt     60600
     cttcctggct cagccgtcag tgagaagatg agacgacgat gaaaatctgg gccccttacc     60660
     tcatcgaccg gtccaaagta cgtacgatgc tcgatcgaat atttctgata ctcacggcct     60720
     tggaatgtga ccgtgtcgag gtattcacgg tctaattcta ccgtctgtga atcggggctc     60780
     ctggcggcca tcaacgtcag ttgcctttgg tccagaggag cggcggaaag aactagcata     60840
     cgccattgtc accctaaatc gactggcgtt gtggacgaac aggaaaatat gagctggtat     60900
     accctgattt gtctaggcag ggcggggttg aattccccga gacaagatct tgcttcagat     60960
     cacaatattc gaaaaaggag tgaaatttga tgtgctcggg gtttcatggg agcgatcgcg     61020
     tgccacttga agacctcggc ggtacccctc ggagatgatg gcggttcgcg cgaggatcat     61080
     tcacccttgg gcgtctgcac gcgaaggctg tatggagggg cttccaatta taccaaggga     61140
     cgtactaaaa tgtacgaatg gggaaagcca agtcgttcac ccagccgaat tgcctctttt     61200
     taaaagacaa gactagatgc aagactcgat ttgtgaagac acggggtgct taacggtcga     61260
     atatttagca aggatggggc ctggcgtggg ttgtaaccaa atacgatcaa tgcggactcc     61320
     caactccccc ccaaatcgtt cgtgtggttc cttggggcca actccgaaac gctccctcgc     61380
     atccttgcta gcagaactac taaagatggc ctgaaccgct ctttgcagga ggctcgtgtt     61440
     gctactccgg gacactggta cgtcaaccaa ggcttgacga aagaaaaaaa aattgcgggt     61500
     ctgttgacca gccgaagagt gacgaatagt cccggacgat tggtaccaga atgggtaagt     61560
     atcagaacag atatggctcg gtcccgcttc ttgaagccaa gctaatgaac cttgaaacta     61620
     ggcggcggtg ccgtcaacta atgcacagtt cgccgtctcg catacaacat agtgcctact     61680
     ttcctcgagg gtccaaggcg cccgacggtg tggatcgagt acaaatccgg ccacgccgct     61740
     gaatcggact gggatttcta tacgcccgtc aaagaatcgc aaattagcaa gctaaacatg     61800
     tggggaattc cgcgattatc atcagcggtt aaagtggtaa gtctatagaa agttgaatcg     61860
     catcttggct cgaactcctc accatgattc cactgcagcg aacaaacaat gtaacaagga     61920
     ttcgaagaat ggaagaaaac ggaccatcca tcaattgaag caaaattatg cagcatttca     61980
     ccatgagatt tgaaacgagg gcaatgcagc cgatgtacga catgagacac catacggaag     62040
     aagaaaaaag aagaagagtt gagcaattgg ccatggtaga gcggactgag aagaagaaaa     62100
     tccgggttgg aatttacgcc aacccttgcg tatgtacgat tgtacaggcc aaataagccc     62160
     tgcattgccg atgccaaagg caaatggatc accggttccc gctgtcaccc aaaatgaaga     62220
     atgcaactaa aaaaaggaac agttagaccg aatggctatg gcttccagcc acttcgccta     62280
     tgtcaggccg tctcttctcc catatgcagt actgtgccaa gtggcttgtc cggtccggtc     62340
     tcacccaaat ggctccaaca gcccctcaaa ttgagtgggg cttgacgggc aggatcagca     62400
     acttcctcct tggggcatcc attccctcgg gattctggtg ggtttggttt tgggggtttt     62460
     ggggatttta ttttctttct tgcccctcct atttcgctct ctcaccgctt gtccgaacag     62520
     ttttgcgtcc cattccgttg gagtggacac cagacattat ggtgattgac tacagggatt     62580
     tttagcctgt ctccggatac tcccaatatg acagaagtac cgacgctatt ttgatcctct     62640
     atcttttcta gatactcctc ctgtttgggc ttgcctttat gtgccttggt ttgtggtata     62700
     ttgtacttgc tcactccgtg ctgagagtac tgggcgggaa agatatcccg tgtgaatgtg     62760
     gatatccatt gcctttagga gaaggtacgg aatatccatg gatgccatta ctcaatactc     62820
     cgtatactat acgatatggg cagtatccac tccgtccgaa tccaccgaga aaaccctgga     62880
     agcctttgaa attatttttg ctcccccttt ggtaccgttg tccggagtac ggagcactcg     62940
     gtacggagta ggtactcctg atttttcttc accctgggtc aattctccga gacaatgggg     63000
     tcccactccc tgacagcaac acagcaacaa ttcatctcat ctccagcgca agggcaagga     63060
     ccttcatact tgcagagtca catgaacata ttcccactgc gtattgttct ctcataacct     63120
     tgattatatg acgagatgtc aaagcagaca cggaacttcc cattctgtta cgcataagtt     63180
     agaagtccat tttttcaaga atatccactg ttttatccca ttcaaaagga ttctaaagtt     63240
     tgaagcaaaa gggaaagaaa accatatact catgtactca tgtactccgt cctcatccaa     63300
     actgtcggga tttcgacagg gcttacccgt ccccgccgtt ggctgaaaac ccagcgccat     63360
     ggttcatctc tcgggtagga gggccgccta ccaacttttg tttattttcc ttttggtctt     63420
     attacatata cattgggtat gttgtatgta tattgtacac tttaaaggtc tctcgtattc     63480
     tgaacctgta ttgatcgtga aaagcagtca ctgccacata tgctcatata aacagcagat     63540
     atttccataa atcgaagagt ggggtatata aagctacgca gaaaatagga agagactaag     63600
     cacaacgcat acaccagagg aatgcacatt tagaacaccg ccagtacccc ttcaagcaca     63660
     aggtcagtac aaaaagcact tgacctaccg cacatcctcc ctccctgtca taaacttaac     63720
     gcccgctgaa acaatctgca taactgtctc aacctccgct tccgtccgag gcgcatagat     63780
     caaaacatac tccgccggga tatcaggcct tgtgccaagc gaaagaatcc cgatcgcaga     63840
     tgtacccgag aaagcatgac gctggcccaa accagcctcg ataactttga tgcctagaaa     63900
     gtaatgttag cacacgaaca tcaaccgaat tgagcagacc atacaatcag ctggcgcaag     63960
     aaccacatga accgagtggt cgtttcccga atgaacatgt gcaatctcac gccgcatagt     64020
     ttgtgcaatc ccggagacag gaagatggtc tgcgacaaag agcccatcag cgtggcgttc     64080
     catattcgac ctctggaatt tcactaggtg atggttccga tgaccgaagg cagtgaacac     64140
     agtacggaat ttctgtcacg gaataacatg atcagtttat agctcttcac cctagcctgg     64200
     aaacatgcat acctccatga cagccttatc tggcagttgc gtcaactgcc tctgcggtac     64260
     aacgtgcggt ccaacaatag gcctcccttc cccacgccga ctccccaact gttcttcgga     64320
     caagatcaaa aacccatcat cgcccttccc gtggccctcg gctgccgcaa tgcgcctcgc     64380
     gtactcgtct gtgctgaaca tctcgcgccc gaatggctgg aacagcgcgc gcacgacaac     64440
     ccatcccagc gcgttgttcg gcagcccgcc gggtccgtag gatttgaaga ttttgtaatc     64500
     gcgataggcg gcgggaagga tgagagtcga gacgactagc gctgcggcgc tgagggccag     64560
     ggttaggcgg tcttgggttg tgctagggtg cgggaatggg atgcggagga cggaggtgag     64620
     ggttattggc atgtttgtga tgtttgtgtc gatggtacag agtatacgct tcggaggttc     64680
     gtagggtgtt ctatctttat ctttatctga ttttgaattt cacgaatacc ggagggactc     64740
     ttgcaatcat atgaaaatgc ccgggtggtt gtcattgcag gcccaatccg gctgacgtga     64800
     gaagccgctt gctgacgcga tcccgaggaa ttcgcgtgct ccgggatctc ttccggaact     64860
     tgttagggca agggacactt cacattgtaa atctgagatt tctttcgcta tgctactcgt     64920
     attatcatta atcccggtga tctggcatgg catgactcgg ttcatggatc taggtacagt     64980
     ggtctgttcc atggccccac agacgtggct tgatacctac atatgtaggt aggtgcgata     65040
     tagcccgttt ggacccgatt ccacttcgga tggtttcggt gaatcgctca tcgctgcggt     65100
     cttcgacaat ctgtggcata tgggtccgta tcaccggctt ccaggtggca gcaagcagac     65160
     atcatgggcc tgaagcgctt tccttcttgt gcccatagcc aaagcaccca accgcatctc     65220
     tgttgtgggt tgattatgtc gataatgttg ataatgatat caaggtataa aagagacaga     65280
     gcaagggatt gcaagctttc aatcctcttt actctcctct cggctgatag aggtcaagga     65340
     gtgtgcaagc ttcaagagga ccacactctc cgtggcggcg aagtagttca agctgtgtag     65400
     tgcggttaga acaagtaatg tgaatgtcta aggacgttac tcacctgtcc atcaaaatgc     65460
     ggagatggcg cgagaaatga tcctcgtatc gtttcaatgt gtcctcgagt tttccaattc     65520
     gcgttggatc atatcctctg gcatcagcgc cggggacttt gcctccagcg aggtcgggat     65580
     cggctgaggc caaggcgcgt gaaagtgatg ccgcagtcca ggaagcaaac atggtgcagc     65640
     aagtcaccag tttcgaatgt atctatatag ttgttaatga atgctaccgc tagtgtggag     65700
     aaacgtacct tcaacagttt agcctgtgtg agcatgcatt cctttaaaca tgtatccaag     65760
     aaatccacat gatcctgcat tagctcatca accgtccggt tgacctgctt catgtcattt     65820
     tcctccatct ccgacgcatc ggcgtcaacg ctgttgacgc gatccatcag acccaaccaa     65880
     ttcggctcaa tgacctcggc cgtacaaaag tacaaaagct gctgaacaaa caccaacatc     65940
     ttcgcgcgca gattccacgc ccgtcgtttc catatttcaa gccgtcgatc ggaggactta     66000
     tgacgccagc tggtggtttt gttctggtct gcccaggacg tgaccagcaa cgtctcaaga     66060
     tggcgcagcg atagaagatg gcggaaaata agttgatacc gcagaacagt cttgcggcta     66120
     atgaccaatg acagagggaa tggaactgaa tagtccagct caagcgcatc gaatccaaga     66180
     atatctttgt cctcgtcggt ggaatggacg gcagacactt gttgcttctc cgcttctgca     66240
     ccctcttggt tgacccctga aacattcaca acttgcatca accattttgt gaggccgatc     66300
     ttgttcattc gcaccttgac gtcttccttg aacgggtcta gcgccgcaac actgccaggc     66360
     tgtcgaagaa caatatccaa tagagactgg agcttgccct cgttgacagc gcgtgccggt     66420
     tttcgtagct cagaagcacc aagttcaagg aagtatgaaa agaaatcgga gcgatccagg     66480
     aagaagtaat gtttcaggga gcggaatcgg gtggtaaggg agtttttcgt gacgagaaga     66540
     ttcaacaagg aagcattggc gtaggtgtag gcggaattta cgttgtccaa gaagcgtgga     66600
     tcgtcgagcg tcttcgggac atctttgacc tctttgctga cgtcgacacc accgcattca     66660
     cgcacgacgt tgagatactt tccagcgagc aaaactttat cctgcacgct cttcagctga     66720
     ggcggaacct cgtgctctcg aatcgtatag cgtttctccc aatactcgtc cgtgtagtcc     66780
     tcctcgagtt tctcgcgttt gatccatttt tgctccttga ctaggaactc ggcgtgggga     66840
     tctttgatac cgccgtgatg cagccattcg ttcagcatgg ccatgtaagg cctactggcg     66900
     tcacgcagta aggtctgaag cagggttttg gtgattggat cacctgagaa tgaggccaga     66960
     cgtcccgtta ggagcccgag aatattgcct cctttgcaca ttttcttgcg ggccatagac     67020
     cctggtacta agtctccgcc ttctttgagc tgttcaagta tattgtcaac atcttcatcg     67080
     aagtcgtcaa ttgattcctc aaggtcttca tctagaagac catttttgag cagcagttcc     67140
     tggcccatcg aatataattg ggatagacat tgactggtgg gcattgtgtg gagatgaaga     67200
     aggtgcaagg taaatgtagg attgttcagc agctggcctt ccagctgggc gataaggatc     67260
     aggtagtctt tgaggagctt tcgaatcgat gcacacagcg agtgactgac tgcgccacac     67320
     tcagcgcggc tttgtatttc cacaaatgcc tccatagcac tgtagtgtgt cgccattttc     67380
     aacattgact gaatgaggtc acggagtgtc ggatctaggc ccggagctat cttaaagact     67440
     gggcccgtaa gccggtcttt ctcgatcgat gggtcgtatg agctagcgta gtggatgtat     67500
     tgaccttcaa atcccatgaa gacgaacaac aagtcctcca ggatcgctgc ttcctgggca     67560
     tcgggtgaga gctctcggag tggccgaggg tgaagggcct gcgggaccgt cgaagctaga     67620
     gggggaactg atacacgaca tgcgagggga gctgtcgagt gtggtatcaa tgacgcttgg     67680
     ggattccacg gagctgtaaa gggaagatcg tggtcagcaa aatccattgt attgcgacgt     67740
     agggaccagt cacagtctac cgcaccatta tccccgttcc gagaactggg gtttgtgtcg     67800
     tcgagttgaa cgggcttccg aggccgagtc ctatcccaat cgcctctgct agctgccggg     67860
     ttcgcagggt tccttcgcac tgccttttct cgtgatgtga ccaccattcg ttcttggcgc     67920
     ttctcggaca tgctcttctg atcacgggaa gctccgtgtt tctgactcga ggtgctgtgg     67980
     cgcaaaggat ccttgttctc gacttgtagc ggcgacggtc cacgggtttc ggaatcgacg     68040
     cgattggaga cggcgcgggg tcgtggagcg ctcatatacg cggcgcggtc attggcagac     68100
     ataatcccgc gagggcgacg agtaaatcat gcagcatagg agattgaaag gcgcggaatc     68160
     gaagaatcag taacaaaagt agcagaacca atgtatatga gaagatgcaa gtatccaaaa     68220
     caactccact tttggtttgg gtagatgtcg cctcaggcag caaggcagta acaggcacct     68280
     cacctcttgc gtacgtcgag agcttccttt cccgagcttc actcagacat ccacctctgc     68340
     tcctcttccg ttccaactga ttctctcctc catcgtgatt ctatattcct ttattgcttc     68400
     tttttttaga caagactctc ccgtcccatc agatattcca atatgttcat tgcacgatca     68460
     gagtatggta agcttcgtca ggatctcccc ctcaccgcgg aatcaactaa cagctctgga     68520
     cagaccgtgg aatcaagtac gttattcgag attaatccgc gtgcttagac agatccgcag     68580
     cctgacaatg ttccctccgc agcaccttct cccccgaagg tcgtttgttc caggtcgaat     68640
     actctcttga agctatcaaa ttgggctcca ccgcgatcgg agtatgtcat accacccagt     68700
     tcctctttgc tccaagtttc ctagaatgcc ctcaaacaca acagcgagcg atctttgtgc     68760
     tgttgtcgga gcacaacacc aaggataatg cgattatggg accgtcgttc ctaacactca     68820
     tctaggtagc aacctccgag ggtgtgatcc tcggtgttga gaagcgtgtc acatccacgc     68880
     tgctcgaagc gtcgtccgtc gagaagatcg tcgaaattga tcagcacatc ggctgtgcca     68940
     tgtctggtct gcaggccgat gcccgcaacc tggttgaaca tgcccgcgtc gagtgccaga     69000
     accacgcctt ccactatgcc gagcctctgc gggtcgaaag taccacacag gcaatttgcg     69060
     atttagctct gcgattcggc gagagcggtg atgacgagga gagtgtcatg agcagaccgt     69120
     ttggtgttgc gctgttaatc gctggttatg atgaggacgg gccccaactg taagatacgc     69180
     agttcccttt ttctgcctta tttactaact ccttgctaga taccacgctg aaccgtccgg     69240
     cacattttac cggtatgacg ccaaggccat tggctcggga agcgaaggcg cgcaggcgga     69300
     gctgcagaat gaataccatc ggtctttgac tctagcagag gccgagacgt tggtcctcaa     69360
     gacgctgaag caggtcatgg aggagaaact tgattctaag aatgtccagc tggctagtgt     69420
     caccaaggag aagggtttcc gtatctacaa cgatgaggag atgggccacg ctgtcacaca     69480
     gctgggtggc aaccaatgag ggccgattag tgccgaagat atctcttgaa ggggctcctt     69540
     ggactcgatt tggaggctag tacctatgtc gggggcaata gaaaaataat gacgatgccg     69600
     tccaacgctc acatgctggc ctaactacgt cgtatttcat gcagtagatt gtccgtgaat     69660
     gtggtcacgc acgggatatt ttggctatgt aaaataacat ataaacccat ccttcgcaac     69720
     atctaacgga tcttataaac acatggcttc agcacctggg cctcctgctc aggtgacatg     69780
     ccagactctg attcaggctt gcggtcaaca aagcgcttct tgctaccagg cgcaggcgca     69840
     ctgagagccg aagcatgttt ccccttggta ggcgcaccac cctgcttaac aaacaccatt     69900
     ctcacgaaca tcttattgga cttatccacg gattcctggc gaagcatgaa cccacgagac     69960
     cgaaacacct ccacaaacgc cgagatatca gtctcgtcgt tattgtcaga cggccgcacg     70020
     tcctcagcaa agatatcagt ctcgtcgacg tcagaatcgt caccgccctt cttcttggac     70080
     ttcttcttgt ctgccttgct gccgggctta tgcgcgccga tctgagactt ctttcgttgg     70140
     accttgccaa atcgactttt gacctcactg acccagcatt cgcccttgcc gtcaccgcgc     70200
     aaaatacgcc atgcctcctc gacgaacgaa acccaattgg ttcccatcag actcagacag     70260
     aaaatagcga catccgccgc tccatcttcc aagggaagat tcgagatatc ggctttggtg     70320
     atcagcggat cgggcgctgc aagatcgtag ctgttgagct tgatgttcag cttcttggcg     70380
     gagggtgtca aggcgcgcgc gagctgtgca tcgccacagc ccagatcggc gaatgtgcat     70440
     agtccggtgg gacgacgggg gagcgggtaa cccttagcag ggttaagcgg ctttccacgc     70500
     ctgggaagcg ggatggcacc gcgggtgcgg atggtcttga tgtagtcgtc gaccgggttg     70560
     gagggccagg actccttcac ctgtcgcgcg aatccggcat ggtactcgtc gaagagctcc     70620
     gggtttgtac tgaacatctc gagtgctttc gcggagggag tggtgtagag ggtttcgttc     70680
     aggtggcgga accgagagga gaccagcttc tgtcgcatcg cctgctgcag cggagtcagg     70740
     tttgatgttg gtgggagtac aggtgcaacg ggggcgggag cagctgccgc aggaacttct     70800
     ttagccggag tagtggtagc accacctgcc tcattcttgt tctctgggac gttgtccttg     70860
     ttctccttgt tctttttgtt cttcctttgc ttctttttct tcggtgcttt atcctcggct     70920
     tgatctgcct ctggatcggc agcagcagtt tcgcttgtag gcccctgggt ggtggctgtc     70980
     tcaagtgtct gcttcttctt ttctgtattc tgcttcttct tctctggctt cacggaagcg     71040
     tctgcgccac gatttccacc cttggccgta ccctcgatgt gcctccggta catctcatcc     71100
     acatttcctg cggtgacgcg atcgttggca cgcttgcgct tattgttctt cgcgttagcg     71160
     ttggaggcat ccttctccgg ctgagactcg ttcttgggtt gcgcggcctg agtctgtggc     71220
     tttagagcag aattctcaac ggaccatcct ggaacagcga acatgattaa ttccaaagga     71280
     ttggttgtaa atttccaatg ttttcgaagt agaggaaacg gcaccttaga aaaaaaaaac     71340
     ctctcaaaat ttcgttatcg gtaaatttac tatcagatta catacacatt ggtgcctcag     71400
     gcgccagacc ggggtaaatc tcgcctaaat gcctatatga cgttgtcttg gagcacaaga     71460
     acgttgtacc ataagccctt gtaaattatc taggtatgaa tgtcaagaat actttagcag     71520
     tctgactgtg tcttaagaga gaaccctgca gatatgtagg tgatcatatc cttgacgaac     71580
     cgcgatgtat cgcgggtgat ctgcgatact cggcagcttt tccctcttag ctctatttct     71640
     tacttatctg atcactgtgc cttttagacc cacaatgtcc tcgcacatgt ccactctgca     71700
     atcttgagtc cttccaaggt tatggctgac gacctgaaag accagctgga catgccagcg     71760
     gatattactg ttggcggttc tgccgaagcc tcaaccacgc ggtcaggtcc ccgcagactc     71820
     ccgaagaaac gaaccaaaac cggctgtttg agtatgttac agaacattag ggagagagag     71880
     tccctcgttg acgaagcctc atagcttgtc gcaagcgtcg gatcaagtgc ggtgaagaga     71940
     aaccaatatg cactaattgc gtgaaatcca agcggatctg cgagggatat gcccagcgag     72000
     tcgtgttcaa gaaccccata ggcatcttcg ggtctttcag tagtggtcac ggccaggatc     72060
     cacaaataga gcaaccacat atgagtctgc cgatgcacaa cgactacggc tctcaactcc     72120
     ctccccaaca agcggcagcc gctgctcagc atccaatgct agctccacga cccgttgacc     72180
     cagcggcgat gggatatcgt tcattcccgt cccaaacccc ttcctcaagt caaatccagc     72240
     cgattaatat acctcccttc tattatccag cagctcaagt gcagccacca aaccacatgt     72300
     ggcacactca gccgatagct caaacggaga gcacgctggt tccgcccaac gggactgacc     72360
     tcccacaggc acagcaatca cctcagtttg gccagacgag cgctccatat aggcatcatg     72420
     caaacgtaca agaggtaccc cggatcgcca gcccggtcgg tcggacagca gcagaacacg     72480
     cctccaatgt ctccccggta ccagcgctca atccaatgcc gggaaacagg gagagcgaga     72540
     ttaacccgct tcctcaggta tgcattgccg ttatctcttt gcttttagcg gctggtatgc     72600
     tgactataat ttcttagatg acccagccgc tgccgacgat atatcattat cagccaccgc     72660
     caggacaatt gccgcagcaa ttgcggtctc atgatcagtt tataccccat caggtaccgc     72720
     atcaaccaca agtgatatac atggaggatg aaagcgagga ttattacgac gtagactcgg     72780
     acgatgaaac ggtggatcaa tcgcaggccg aaggcttcaa ccagctgagt ctcatcatgg     72840
     cctctgctaa ccgcgatgaa cgacaactcc gctccttcac gacttacctg aacgagccca     72900
     acgtgctcgc ctcatatcgt cctacacttg gctcttctcc tctgaacaac ccaaagactg     72960
     cccgcatctt tgctcacttc attcactcga ctggtccatc catatctata tttgaacgac     73020
     atcctactga ctcttcgatt gttctggggg cgactgtccc accggcacag cagggtctct     73080
     gggtctatac gcttgccctc aaagctttgg agcacccagc ccttctccag gcaatactgg     73140
     ctgtcagtag cttacacatt gcatatttac agcaagttcc cacaacagta tctttgaagc     73200
     actatcacta cgccctgaaa cgagttggtt ccgccgttgg ccttcccctc cggcgtaagc     73260
     aggtcggtac cttggctgcc actcttttgc tgggctacta cgaggtgatc tctgccgacc     73320
     actcgaaatg gaataatcac cttggtgggt ccactcatct gatccgagaa atcgactttg     73380
     ccaagaccac cagagaccta cgggcccata gacgtagagc tcacgaaaag cgacgccagt     73440
     cgggctggtc ggactcgtgg tgggggatgc ctgacgatgt ctctgaggac gatcccttct     73500
     ctgagaaaga ggacagcgtc gatgaaggtc tcctaggcgc cattattggg cgagcagtca     73560
     actacgatta tttcggctgt atcaatgagg agggtacgtt gccctccaca aagcatttca     73620
     cccgcaagga cattgaagta ttccgaattc aatgtgatct atactggtgg tacgcaaagc     73680
     aagatgcact ccagagtttt atcggcggga acaaactatt gtaagtctac acatacggct     73740
     actaagagac aaaacgattt tgcttattgg taaaaccaga atgccctatt ctcaatgggg     73800
     tcaatgtccg cctcgagcag gcattggccg tttagatgcc atctacggct ccgcagatca     73860
     tctatggcta ctgctcgctc gggtcacaga ttttggcttc cgtgatcgta agcgaaaatt     73920
     gagaacccta aagtcaggcg gggttgactg gaggcccggc cctgagatgt ttaaattcat     73980
     gggtcggttc gctggcggcc ctccgggtca aggacctgga ccatctgctg gcttcggtcc     74040
     ggggcgcccc cctggctttt catctggcac gtctaatatg cagcgtaaag gggacgccag     74100
     ggccccatcc gtgccagacc ctactggagt gtctccttct tcaagccctg ggcccacctc     74160
     tgccgacagt ccccccatgt acggaatgat accccctcaa ccgcctgcac gtcttccctc     74220
     gggattccaa gatagaccgc gtgagcctcg tttgtcacca gacgaggatg acccggacca     74280
     cgaaatgagt tacaaggaag ccgaacaaga atgggaagag atcctggttg ccatggacac     74340
     gttctcccaa gcgttgggcc gcgatttcca gcctttgcca gcggatgtcg cgcccccaat     74400
     ctctacaccg tttggtcccg cccttcaata ccgtacacac accatcgccg tgatctgggg     74460
     tttctattat gctatgcgcc ttttgctgaa tcggattcat ccctctatgc cgccggccat     74520
     tatgatggca gccggggtct gtgctccaac gacagccggg tttgcccaga ttattggtaa     74580
     gatcctgggg ggtgtctact acccacaacg ctttaacctc gaagccggaa gcttgagtcc     74640
     gaatttgggt tcttcgttaa ctgacatgtc ggtgccacta ttctttgccg ccgtgcaata     74700
     taatgatccc acgcagcgaa catggacgac atcaaaactt cgcgacatct ctcgcctgac     74760
     tgggtggaag agcgcggatg ctattgcagg tggctgtgag aaagcatgga tagtcgctgc     74820
     aaagcaaggt cgcgggccac cctatcaacg gtcatttgag actgaccgag tacgagaaag     74880
     ggaacaagag cttgaggtaa gcatatctat tggatctatt ggataccctt ggcctacaac     74940
     atctatgcta atgtaatgcg ccacagtatg aggctgtgtc gaaggaggtt gaagatcgtc     75000
     gatttgtgac agtcaagtca gatcgagcgc attgggcttt ggggatcttg gaagaggaca     75060
     ttgcgaattt agaggtttag gattggatga agtatacaat gcaccagtac ctagccgact     75120
     agtacataca tgtacatagt acattaggca ctacatacag atcatgcagt agtagtgtag     75180
     aaaggtgtgg cgcagatagg tcttcgagtc catctccccc acattcgaaa tacgtccgac     75240
     ccaatgtcat cactgatcga cttctgcctg acgtttttac ctctctcatt ttattttttt     75300
     gtctcttttt acccccaagg ctgactcttg atttctgctt tctgtttctt cgtgctcatt     75360
     tctgcctccc agcctctctc ccttctccct ctctctcgtc ctatcagtct atcagtccct     75420
     cgccttgtgg ttcctcggaa accccaccct cggtacggaa gtcagccgct cgcgtcatcc     75480
     acggttcatt ctcccctttt tgttgtgaaa tccggtgata cttccagatg tctcggtatg     75540
     atgactatcg ctcgtcgaca gggaccctgg actctcgcgg tcgatacgat cgatactcac     75600
     ggggtccccc cgtggccgaa cgaccccgcc atgccgaaga gcgctttgaa gcacgtctcc     75660
     gtgaggaaga ccgatatgga ccccctgcgc gcgcacccgg gagactctat gaggatgacc     75720
     atctagacca cccatcccct gccatgtctc ttgtggcgca tgaccggcgt cggcgccgtg     75780
     atgacagtcc ctcattccgt cgcccccaac tcattagacg gcagtcgtcc ttggacacct     75840
     tcgaccgcat accgcggcgc aagatggaac acttcgatgc ccgagaccga ccccgcgctc     75900
     cccgtgtacc tgtcgttgct ccgcctcgtc gccatctctc tccgggccgt tatcgtgagc     75960
     gagaagtcta tgaggatatt aggattgccg agcccgacta ctacggtgat gaagagttca     76020
     gagacgttcg tgatcgagat atggtggacc gtcggcgccg ctctagcagt actgttcgca     76080
     gacatcatga agagaagcct tacccgcgca aagggaagac ccgtgtccct cgtcaccttg     76140
     ctcatattca cgccatcatg gatctagggt atccgttcaa ggaagaggtt ggtctgtctt     76200
     ccaatagtac tctagtctgt tgctgacctt aagtaggatg atgttatcgt cattcaaaag     76260
     gcattatcga aggcgcagat cgacgaagta cttaccttga gccgcgagtt caggcggcct     76320
     tcgcccgtgg aaagtgagtt tgcactcacg cccgcattcc caattcctcg tgaggaagcg     76380
     tgatactaat tagcgagcag ccgaatacat cgggttgtcc tcgtctcccc ccatgaggga     76440
     acggccacgc gagcgggtga cgacagaaca cttgcgtgtc gaagcttctc cccgcacgag     76500
     ccaggcgttc atcgtagaat catcaccttc ccgacacaga tcacgatcgc gccatcatat     76560
     ggaccaatat gaggagtttg tcgagaggcc gcgagtacac ggagtctctc ggcgacgcgc     76620
     tgtatcagtc aatgaccgtg ggcctcatct attgtctccc gtgcagtaca tcgaggagcg     76680
     agactcggat cctgctcgga cgggttcaat ggttcttgtt cgtccacggg agagcgacca     76740
     cgacatgagc gattacatcc gcagtctaga agaggagacc agacttcttc gtctggagag     76800
     gcagggtggg attgagatca ctcggcaacg cgaaacagat atcattgacg ataaaggtaa     76860
     tcaggaggag gttactgaga ttcggaggca ggagcgttca ggtatgacgc cacaaattac     76920
     tctatgcttt cgattattct gaccttccct agaacccaac tctcgcatca tgcgtgctat     76980
     gatggccact ctgacctgac ctggcttcaa tactaccgag gcactttcct gatttttgaa     77040
     gcagagactt acgacgccat gattttaatt tgtttccagt gactccaggt tctggatggg     77100
     gatttccaga tgttttctat gtatcttttc agtcaatttg cagattattc ctagggccag     77160
     cattggagac ttgacaattt ataatcacag gaggctgctc ctgagatgga tgagattgac     77220
     ataacatctg ggggccgtca agtataagtg tactagtaga aaacattgaa ggaagatcgg     77280
     agatgataca aacgagttga tacgtggcgc aagtgaggcg gtgcaaggtc gaggctcccg     77340
     cccgcataac acatgtggtg ataccccatc atcactccca tccatttctc gttactctct     77400
     cctcgttttt cttctaacta aaaaaaaatt accaaaatac accgatcatg gatcgaatgc     77460
     aggcattcgg aaagaacttc aggtgagtac accgtcatag cccccccttc catctcgtcg     77520
     accctattct accccctcgg cttgtgaccg gtcgctttac taacatcttc ttgccttgtg     77580
     gttttctgac ggacagtgcg agcttcacgc cttttgcgca gcgtacccag caaatgatca     77640
     aggagcagct gggccaggcc gaggacaaga cccagctccc cgatgaatac atcaagctcg     77700
     agaagcgcgt cgatgcgctg aaacttgtcc accagaagct gttgcaggtt acgtgagtaa     77760
     tcttcgttgc tttctgcgct atggatggct ctcttacagg tgttaaccgg cgccccctct     77820
     cgcgaacagc tcccaatact ccaacgaggc ctacgactac cctcccaaca tccgcgaatc     77880
     cttcaatgac ctaggccgga ctatcaacga gaaggtccag ctcctgtccc aggcaggctc     77940
     tcccgccgag gcacaagctg ccctggcagc cccgccttcc gcaaagcccc aacccaagac     78000
     cttcaaccac gcgatcgccc gtgcctccct ggccggctcc cagacgctcg cgcagagcac     78060
     cgagggcgag gacccgcttg ccactgcatt ggagaagtat gctctggccg aggagcaggt     78120
     tggcgaggct cgtctggccc aggatgctca gatccagtcc cgcttcctgg ccggctggaa     78180
     taccaccctc aacaccaact tgatgttcgc tgctaaggcg cgcaagaatg tggagaacgc     78240
     ccgcttgatg cttgactcca tcaaggctag caaaaaggcc ggcgcccacg gcgacctaga     78300
     taacctgagc gaggatgccc gagcggagat cgagcaggcc gaagatgagt ttgttggcca     78360
     gactgaggaa gctgtgagcg tgatgaaaaa cgtatgctcc cgttatcttt cttttctttt     78420
     cttttgtttt tcgccctccg aaatccgttc cgtggtacta acatcgcttg caacaggtcc     78480
     ttgatacccc cgagcccctg cgcaacctgg ccgatctgat cgccgctcaa ctcgagttcc     78540
     acaagaagtc atacgagatt ctcagcgagc ttgctccaac tgtagatgca ctgcaggtcg     78600
     agcaggaagt aagttctcgg tgatgctcgt tctacatgtc cattacatct aaccacggtt     78660
     ttttttctta ggccagctac cgcaaaattc gtgagggcgc ttaagcgttg ttttgaaatg     78720
     ccatgtttct tttgttatcc ttctgcctgg cttcgtattt tgtctgttac tccgagccat     78780
     ggccttgtgt tttgtattta agctgctttg cttctgccaa gcccgacaga tcattgagtc     78840
     tgggtttttg gattataaag aatttccata aaagcagtat tgtagagcag atgtagagca     78900
     gatgccacct tcattcaaat gtatggttga tcgtatcgat gtcatatgga tccaccgccc     78960
     gccaattctg cctcaggcag gccagctcca ggagctccgg catcaagata ctccaactcg     79020
     ccagctcgcc tttttcagct cgcaacacac ttgacagtcg catatttccg gagaattacc     79080
     cctggatatt tgatcactcg aatacgtacc gaagactcat caaccccgcc ttcattgtgc     79140
     cacgctgcac cggacaatcg attacttgtc cgtccacctg cgccatcaaa ggatccgggc     79200
     attcgatagc actcgtccag agaacttata ccaccaagca aaggctgcct cctctgagct     79260
     ctccatccta gctcgcccac tccccgccca ctctccgccc acaccaacat tcgtgtaagg     79320
     caccaagcga tctccaccct gggctgtgct ttactccgac gaaccaagag aataacaaaa     79380
     tactgaagaa atggcaaacg ggtatgtttc cccttctctt ggcccgggat aaacaatgta     79440
     tacctatcta tagccggtca atgatcacct ggttatgggt tcgcgtcgtt taatctatat     79500
     cgccacgccc tgatctcccg atactctgtc gacaagttta caaaaataca gtcgctaaca     79560
     tgaaatttaa tagctggagc ctggtcattg gcctggttat tatcgtcgcc ctttcgacgg     79620
     cagcgtggtt cctaagcccg aagggcgata accaaacgtg agtccatgct tcgctctgtg     79680
     tacgctgggt gtcgagccca ggggccattc cttttaaagt tgcaaaccct tgagaatact     79740
     gactctgctg tcctcagtct cttccgcagc acgctcatcc ttaccttcgt ttcctgttac     79800
     ttgatgtggg gtatgttagt tgttacctgt tgtccctatc cacctatccc cgtgatatgt     79860
     gtactacatg aaatatactc taacatactc aatatagcaa tcgtcttcct ctcgcagtgg     79920
     caccctctta tcgcaccaaa gcgctcagac atcagacctg atcgcgtacc gcaataaagg     79980
     cattcctctt actggtttgt tgggttttgc gtcaattctg tcaactgaca attcgggatc     80040
     ctgtcgtgat atattgtctc gtcttaccct gtcatgggat aacacaagat gaagtcaagt     80100
     ttatctcatc tcacgctgcg acgcttgtgg tccggacagg aatgaagact gctttttccg     80160
     tctctgtgct tagactaggt agcgggctac ttgtggaatt ggtatgtatt gcgagcctgt     80220
     gtgggtttat agctgcttca tggttttgta tggctcttcc ctagatggcc ttttcggggt     80280
     agcattttat tttatgtttt tggtttgatt cggtttttgc tctgtagttg ctgctcggtt     80340
     tctttggtca tggaaagtac atattcatac ccttttaggc catttactac atctagtcga     80400
     attattgcct acgactatgt catggacaag tacccccaat gtcgaccaag ggattttcgc     80460
     tccgtagagt acacaggcct tgtgatatgg ccacttgatg gacgctggta aagctaggtg     80520
     gaattaattt ttgtataagt acaagttatc tgaatcactc ctaaccgact cccacagcac     80580
     cgagaatcac cctctgcact gcccaccgga cgatttggcc cgcaacagca accgcaacag     80640
     cacgcagata cccacagcca agtaagatat acaatgcctc aatattactc agaagtacta     80700
     ggtgcgtatc cacaacacca agagaaagca acgaagcaag caaatcaaaa agtcccgtca     80760
     gataactagt cggcgtggaa gttcgaagcg aagcagccgt ggcagccagc cacgattcca     80820
     ggaacgaaga agaacgagcc aaatccggcg gcggagtcgg tatagctgct ttggcggaga     80880
     tgagagaaga ggtttgcgtg gctgtggcga acaggctctg gtgcaccgcg ctcgacattg     80940
     cagccggctg cgtcgaggcc cggatctgtg ctgctgaggg actgtgcgct gggatgtcgg     81000
     agaggctgcc gctcccgtct gcgccccaga ttaccagcag gatggggaag agctttgcgc     81060
     agctgctgac tagcagggcg gtgctgatcg ctgctgggct tgcggctgtt ggagggggta     81120
     ggggctggat gttctgcagc ggggctgttg atgcccggcg caggggtggt gcaggtcgag     81180
     gcggtggccc cattgacgac gtgccttgcg gtggtgggga gaggtcggtt ggggaggcga     81240
     cctcgctgta tgagctaggg gttggagttg ggcaaagtag gctggcggaa tgactggcgg     81300
     ggttctgggt gtgtgggttt accggcaatc cggatggcga gggttgtgtc gttggcgtgg     81360
     gggggccgga ggggaggagg gtggcatctc cagtagactt tctgctagga ttggtgttgg     81420
     cattgctgct gctatctggt ccgctatatc tgcgcgactt cgggaccagg attgaggcca     81480
     aaaggcgcac ggtgaggtga tgcgcgagag ttgcggctgc attcaaactg aggaagaaga     81540
     ggtattggat aatgataggg gcgcgtgaca ggaaggttgt tgcgagggat gggtccttct     81600
     cgatgcgtgc ccaggtcagg tagacgtcga agagaagcag aagaacccca aggcggatta     81660
     tggatcgcta aaaggtgact ttatcagtaa ttggctcaca gttgtttaac gtagtgtacc     81720
     cacatcgaac tggttgtcgt ctcgcccgag ccgattgaag aggagatgtc ggtatacctg     81780
     ttttcgggat aagttagcca ggtggcgtcc ctctgggata tgtacaatgc ggttatacct     81840
     ggggcttgat tagcaccaag tcaatgaaga gcacaacaaa gtcatattcg acatatttgt     81900
     cggcaaaccg ctggcaccgc gggcattgcg ttagtcgcac acccttgcct tgggacctgt     81960
     catcggcacg actgtaggcg ctgtacaggt gagagaccgg ataggagcac tcgatgcaaa     82020
     taggcatcgc gtcacatcca aggatctttc gggatgtacg agagtctcga tagtctccta     82080
     tcaggatatt gaaggcggtg aagccaatat cggaggatac ctaggtatac ctccagggct     82140
     atgaagtatg acctgaagct gcaacgtaag gaactaccta ggtagagcat acctactaga     82200
     ggtaggcaat tctccgggga accagtcata atactggaaa ggaaatagag acaaaaaaag     82260
     caaaaaaaaa gaaactccga tagggggaat cgaacccccg gctgccgtgt gagagacggc     82320
     gatgttagcc actacaccat atcggatact ggatgtagat tgtgtctggt ttgtgtctgg     82380
     tttgtgtatc acagtcccag tttaacgtgg tcggttgctc tgcgctcctg tgcgtggtag     82440
     tatataaccc tcgacctcct ccctccaacc tagggtgagc cttggaatca ttggaggaga     82500
     tgtcttgatt ggccgcgaag gcgtgttcta tctaaaattg ggacctcgcc tctgtctgcc     82560
     tcgtgagcta actgttcact atgacattca ctctataaat ttggatagac ggcccgcgag     82620
     ttcgcagttc tcgcaaaccc actaagtccc aagatccaag caatagcttc tcctcgcgct     82680
     ccccacgtaa agaacaatca aaacgctagc cctgacctac tacggtgcgt tttgaggagc     82740
     ggtatctgcg gaatcagacg catgcatcct gccaatatcc aaatcacggt ggcgattcaa     82800
     ccctaatgca ttatgggaat gattcgatgc tactattcta caaacgtaat atcataaacg     82860
     aagaaattgt acaacatgag gccggagacg cgaggaaaca cggcatgact agctcggtct     82920
     tgtcaatgta ttctgttgca tatcattaat gcatataggc agactaagat ctagtgatag     82980
     ataatgtcaa cgtttgtata tattgtaaat gtttcccgtg cgcttctcct gagaactttt     83040
     gccggctgct tctaccgctg atatggttcg ggactactgt tatcccgatg aaaagtactt     83100
     ttgttacttt tatgtgacct gtccctaata gctgcccagg tggtttcgat actgtccccc     83160
     catatttttc cattcactac cagcaattta tgttatctaa aaggtgctga aaatttccat     83220
     cctcctcaaa ccatcttctc attcatttct ctcaaaatgc ctatatgtaa accttacgac     83280
     gatgttgcct gggcaataag cacccagatc tggaaggact ggccagaact tcttcgcact     83340
     gatgaggaca tctacaatga tatcggaatc attctttctg aagagtttag cgaccttcaa     83400
     tgggaacttt tcgaattcct ctccactggt ggtttcaatg tctgtttcaa gatgaatttt     83460
     accaataact tttgcgctgt catacggttc ccactgccgg gtgctgtgat gttacccgaa     83520
     gaaaaagttc gcaacgaagt ctctgctatg caatttattt tggagaaaac cgcagaccaa     83580
     atgcccattc gagtgccctc tgtctttcgc tcggtagaga caaaagagag tacttcagac     83640
     ctggggcctt tgatcataat gaactatatc caacacaaag aaagtatgag tgatcttctt     83700
     gaggccccgg gacgcgaagc aggagaaaat cctgtactta atccaggcct tgagctggtt     83760
     aggctggaat ctctctacaa agaactagcc aagatttctc tttcgctggc gacactttct     83820
     ttgagccgga taggatccct gcacaagaat aacaattcta tatgggaatc atcatgtcgg     83880
     ccgttatcct actctatgaa cgaaattgtt cagttaggga cgctccctcg atcagaatta     83940
     ccgactacca catatgacaa agcttcatca tactttgaag ccctggcgga gttgcatctt     84000
     tcacacctca aaagccaaag gaatgaggca gatattgagg cagatattga cattgatgtc     84060
     ttagcggata ctttccggcg cagatttgtt gctagatttc tcttccgaaa actggttcga     84120
     aacccggagc aaaggcggca atggattttg catgataatg gcccattccc agtatggtgt     84180
     gacgattttc gacctgaaaa tgtacttatt gatgaaaccg agaaagttat tggagtcgtg     84240
     gattgggagt ttacctatac tgctccggtt gaatttactt atgcaccacc ttggtggctg     84300
     cttcttaaaa agccagaaga ttggcctggg ggcctagatg aatggtgtgc agagtatgag     84360
     aaaccacttc agacgtttct tggggcaatg cggaaatgcg aggacgaggc aattcagaac     84420
     aaacagctac ttcagagcca gcggctgtct agtcagatgc gggacagctg gcagagtgga     84480
     aacttttgga tcatgtacgc tgcaaggcac aattttgctt tcgatgccat atattgggaa     84540
     aagattgatc agcggttctt tgggaagaca gaaattgcag acgacaataa tcgtgatgta     84600
     tggcgcaaga ggcttcatct cttagaacat ggagagaaga agcttatgga ggaatacgtg     84660
     gctttgaagc tcaaagagag gagcataggg cgtctcactt gggatccaga tgagtacact     84720
     gtgggatgga ttcaacgaat gaaggagatc agatggaagg agatggagag ggaagagaag     84780
     gaaagggtag agagggagag gatggagatc tgtgctgaat cgtaaataag acctaggcct     84840
     gagctatgat gctaccgaga gcatgcctct ccttcgatac tttatagttt aaagctctca     84900
     aagcctctga agaattagtt gacgcttcaa cgtagtgcga tgaaagtcga tgatcaaagc     84960
     acatccgagc tcttcgctcc agaggatgtt ctctggccgg agatcttcat aaatgtgtgc     85020
     actcgatcaa gtagcttgct ttgttcttta atggcattac cgtgttgttc cagaggcttg     85080
     tattattctg atcattctga ccgagaaagc ggggctccaa aaggaaagct catcagatcg     85140
     gtggagcaca agaaactcat tattggttgg gggctggagg atgcaaacag ccccccaaac     85200
     ttagacaaaa gttgtacctt tcttgatgca tcaagcgttt aagcctaagc taagcctaag     85260
     cgtattaggt cttagaattt tgacctccta ggttcaacac cgttggtctc tatttgtacg     85320
     ttgttcaata tatgtggtaa gctattatcc tcctgcagcc ttaatattcc tttatatata     85380
     agcactatgg ttggtgcgca acattaccta gtacctacat cctacctaca tatgtatgta     85440
     catacctacc tacctaggta catatgtagg tacgcagcaa taagattcgg tccgggccgg     85500
     taacgtaatg ttttgtaatg ctgccattca aagttaaatt ctcctaccca caaaaaccat     85560
     aaaagggtaa ttctttgata aaatacggta tttttaagag tgcatgcgac gggtacagtg     85620
     acgcagcaaa agatctaaca cccccttttg ccccacatgt ataccgcctt cctatactat     85680
     ctacaccgcc ataatttcgc gctaatggga gctcatctat ctataagcat cggcctgatc     85740
     ttatttatat agggaataat gatatgccaa aggctatttc agtcaaaact gcagcataca     85800
     tggcataggt taaatctgga tcatatgagg catctctctg agacgatacc gcaccgggtg     85860
     gaggctccta ttgagagcta gggtggtata caccataata gatttcacta gtatgaattc     85920
     gtggagcttt tatactggca gaaatttatg taatcaaggg ggtgtggggc tagggtgcta     85980
     gattttttgc tgcgtcactg tacatatgtt gtagttcccc acctatattt tactcaaccg     86040
     tgcgaattgc tccttttact atgatcatcg ggttagcaga aattccgagg tcgcattcat     86100
     tttcagctac ttggtatttt aaccttccat tccaaatctc aacttaccga tcaatactag     86160
     taatgtggat agacgtctat gtctgtacat atgtggtaat caatatgtta gatggaagaa     86220
     catgcataca aaacaagaga atatagagtt tgaaccatcc ggatggttcc atgagttctc     86280
     acatgttgag attgatatca caatgacact ttcaacctta ttgttcataa gtcacagtcc     86340
     gcgccttact gtttaagctt ctgttgcctt acacatgata tctttcgttg atcaaattgg     86400
     ccttattatg gatggagaat cgccagactg agagagaaaa aaaagccgga atgcagtgct     86460
     acactttaac ctcgcactgc gtatcttgtg aatggaaaat acgcactgac tatccttgga     86520
     tggcattgta tcgagccagt aagtccgcaa ctaggcagac aaggtttctt cactagactc     86580
     aacgcctata gtttatttaa cgccagaggg aacgcaactg tccagcattt ctgaagtcgg     86640
     atcagaggaa ctcgaagaag gggacagcac ccctgatagc gaccttgaac tcggcccttg     86700
     gtggagtatg gccaatagca agccagccac agctttcttg attcattctt gctgttggtc     86760
     tctattgatc cggcattttg caaacgatga ggtcgatcta gacagacttt ttgaagtctg     86820
     caggaacaga tccgcttcaa gaacagcgga aggcgtacac gattttgact cactttggtc     86880
     aagcctccag catccactca taaggccgat tatccgaggc attggagatg acactaaaca     86940
     actatcaaaa attcagcgtt taaacatagg cgcgagcaac agtacatttc ttggacctga     87000
     ctgcttcggc cggctcccca tagagatacg acttgaaatc gcggcctacc tttccactgc     87060
     cgatttcctc ggccttcgac ttgtatcccg agcgatggta cctgttttct cgctacaatc     87120
     attctggagg acgagatttc gagtaaatgg agaccgtgga tttctgaatt gtctaacgga     87180
     tgatcgcggg aaacagaaga actggcgatc gatataccat tgtacagcaa gaattgaaca     87240
     agcatatctc cacgtctggt ctgtgcgtcg acagtggaga aataattgtt ggctaaggga     87300
     caggtactca atgacacaag ccctaagcgg ccaaactgag tttgaagaca actcgctcga     87360
     tgaggtagcc tggaaagagg ctgcagcaga gattcgctgc gatagaattc cgaaacggtt     87420
     gtggagagac gggtttaagt gcaaatgtcg ccaggaagag ccaattcccg tgtcgcacac     87480
     agctttgtta catgaccttg ttataggcat gacggtgttc atcttacatg aaggaacgac     87540
     aagaggaagg aggtctcaca tcattggatt tgatctgata agtgcagatg cggaaatccc     87600
     gaatatcaca cttgggcacc ggctaccagg aagccaagta acaatcgact tctatggccg     87660
     acatctgcga ggattcggaa tagtcactgg taatagtgga atccgtgcct tacgcccagt     87720
     cttcgacagc ggaactatca caagttggat aggtgactcg gaacaagatg agatgaccat     87780
     gcaacttatt ctgaaggatg atgtcaaagc tatttcggcg aagttcgatg taagtcattt     87840
     cccctgagcc ccgcatatac gcaaagggta acataaatca gtattgcaag atgatttctc     87900
     tatccatagc atagggggcc taggttttgg atcactttct gagactaatt tactggcgtg     87960
     ctttactttg caacaggaca atatcgctac acacaattaa accattagcc ggatcaccac     88020
     atcgcgagtt acataatttt accatatatt tggaaggttg ctccatactt tcgttaacaa     88080
     tagctatgta cctagctatg ttgtacatgt agtcataaca tcctatagaa gtgacacgcc     88140
     gcctaatacg gcgtattggt aattcaggta gcatccatcc atggatggat cttcaatgtt     88200
     ttctgcccgc caaatgacaa catttgaagc aataaggcat gaatcaggcc aaaactgggc     88260
     catcccatcc gggtcccctt atacaccttt tcttgtggaa tactcatgga tagacaatgt     88320
     catttgacgt caggggtcaa acgggataat cgtttcaatg ccacgtttaa accgtcgcct     88380
     ctaagacgcg gtaattattg tttgacttgg atccttactc ttctctattc ttctcttttc     88440
     tccttctaca ctcagcattc ttttcccatc ggcataggac cggtggtcac cttttggatc     88500
     ttttacctcc gtcggtccaa gcgactgttt ggcacctcgg atatcaagtg gagggagcaa     88560
     gggagcaacc aggatggcca ccacccgaaa gccatcgtcc ttgaccgacc tcccacttga     88620
     gctattatgg atgatctctg agcacttatc atcagttgat cttgcttgtc tcgccttagg     88680
     gaaccgttat ctgctacatt cctttggtgg aactgctttt aagaacttct caaactgccg     88740
     caccggaaac cccacggatg acgcacgtat caagctgtta tctcggcttt cttacgacct     88800
     accgcagtag cgtctctgct ttatttgccg tcaacttcat tgtggaaaaa ggctgggctg     88860
     ccaagctgct atcatcctat ggtcaaccac cgcacagatg ccttagatta taccaattgg     88920
     aaccttataa gacatctacc cctcgctcac cacccatcat atacctttta caaatttcac     88980
     tttgtgcatc tacagcttgc catgagaagg ttttactatg gaccggagtt tggaatcccc     89040
     gttgagtcat tactctacac agagataaaa gcgaaccgat tcagatctaa aggcccgccc     89100
     ttactacaac cccctatcaa caagacacca gaaggggata cccaagaaga catgatagcg     89160
     ctattctctg ctgaagctcg aatttgctct acgcctccgg ctctatatat gcggaggcaa     89220
     gacatagcgg tagtaacccg acaaaatcta ccacggatat ggccatgccg cgaaaacgga     89280
     cctatgaaag tctgtaagca tatccacact tttgacccgg gcttcagcga tatcttagcc     89340
     tctcaaatta ggcgttattg ctctaccaca agccccaaag tcctagccga ctaagggagt     89400
     tgtgataaat gtaatacctc ttggcagttg gagcttcgaa ccctggatga aactcatgca     89460
     agcctcactc ttaccccgtg gatagaccta ggaccggggt taagcataga agatcctcag     89520
     tggaagtatc gtcttgataa tgtacctaag tcgtcttcag caaaacacga aatagtggac     89580
     tctcgcctac ggttcgaaag ggagtctatt caggctaggt gtccgaatgc tctatccgag     89640
     gatgagatgt attaccggaa tgtcgctttg ctagaaggga aggcatacca aacggtgatg     89700
     actccagtgt acagtggaat ctacatattg cacggacaag cagaagcaaa gacaagtcct     89760
     tctcgctgta tcattctgtg agaaaagcaa gctggggtgt ccaatgtttg tttagttcct     89820
     aagaatatca tcactgtaaa gctcacccac gttcgttcct tccctgctgt gatacttctc     89880
     aatcgggaaa ggccaactcc tatgaaaaga caccttttac aaacaatttc gagcagttag     89940
     catccatcgg atcagcgtat agactatgta tcataatcaa agagtcgtat tcggtgcgta     90000
     tagaacaata tatacaatat cgacagtcat tgttggcaga cgcttttctg catgcctaat     90060
     gctcagaaac aaagataccg gccataccca tgccctattc gaagagatta atatctgaca     90120
     tcagggtcat gatgatcgga ggtaacttac agtgcccacg cacatcgaag tcacggcgac     90180
     tcgcttatcc tgtcgacgta gctcagacag agcagtgaca acctggcgtg cgccagtggc     90240
     gcccagaggg tgaccaaaag cactttgaga tattagtatg gtatcaatca aatttggtcg     90300
     aagaaactct tacatagcac caccacgcgg gttcaccttg gattcatcca agcccagctt     90360
     gttgacgcag tacacaccct gtaatgaagt atgttagtct tgcaaagtaa atagtcacta     90420
     ctttgtaaac ttaccattga agaaaaggcc tcgttaatct caaaaatatc aatgtcatcc     90480
     ttgctcaagt tgaacttgct caggattttg ggaatggcaa gggatgggcc aatacccatt     90540
     attctgggtt ccagaccaga aacggtagcg ccacagaact tggcaacgat gggttggcca     90600
     agctgctggg cgcgcgagcg cttcatcaga accagcgcag cagcaccatc agtaatttga     90660
     ctggcgttac cgccggtggt agcgctaggg gcccactggg ggaaggcagc gcggaccttg     90720
     ccgagggact cgggggtagt accgtagcgg atgccgtcgt cacggaccac gacaatatcc     90780
     ttgacctcgc cggtcttggg gtccttaatt tgagtcctga cggggacgat ctcgtcctcc     90840
     agccagccgg ccttctgggc gcgctcagct ttctggaaac tgttggcagc gaatctgtca     90900
     tgttgctcgc gcgagatgtt gaactggttc gccacattct ccgatgtttg gcccatgggt     90960
     tgggagttct gcgatgcgat cgggtgcttg gtgatgcgct cggacatttc gggggcgccg     91020
     ccgtcggcgt tcttgctcat gctctcggct cccacggcca caccgacatc gatggatcct     91080
     gcgatgattt ggttggcgat gttttgcacg gccagtagac cggacgagca gaatcggttg     91140
     gcgatggagg cagctgctgt tacggggtag cctgctgcca gcacggcgga acgggcgaca     91200
     tatgcggagc cggggcagag gacattgcca acacagacat cttcaacgag gttggggtca     91260
     aggttggact tctcgcgaac ggtctgtttt gatacattag ttactgagac ttgttcccaa     91320
     tgggggagaa aaaaaatacc gtgagaagtg agatgaggag atcatccacg gtggtatcct     91380
     tcaatccacc tttgcgggct ttggtgagcg gcgtccgggc caagtaagtg atgacctgcc     91440
     aattgattaa tattaatcca aggcgcaagg agttgtgtaa agcagcaaag cagtaacata     91500
     ccacgtcatc tgggttcttg gctagaatct tttggcgggc cgagccagga gccagctggt     91560
     tggcgacgga gttcagacgt tgttgtggtg aagacattgt agatgaagaa gacaacttga     91620
     aaaagataag actggttcta atctcttttt gatctcttta atgtcttcaa atgtttcaag     91680
     ctaaaagaaa tgaaccgcgg cttctccagg tttcctccac gccgaaccga gtggaagtac     91740
     cgagaccttc ggaggtcact cagtgtatga tacggtaatt ggccgttcct cggcttgtca     91800
     tgggagatgg tgattggtag attggggtat tgaagaggtt tcatgggccc acatgtacat     91860
     tggcttcaaa tatctgtata tctgtatatt tgaatatttg aatttcatcg cgatgggagt     91920
     aaatcgacag atggagaatt ccatactctg tccttcaact acatattgaa tctaatatgt     91980
     tgatgtggcc tcatctttca agaacaattc cgacgtggaa gagctattga ccaaaactgg     92040
     ggaaaaagcc caaccggggg caatatgggg gatttcccgt aaacagactc cactacgggt     92100
     gatggccaat gtaaaaaggc ttagggaatt gcctctgttt atgaacggca gatcgagtct     92160
     ggctaacttc cgtcagagtc cccgaggcct ggcgatcttt atatctgccc agtttcggag     92220
     aggttctaaa tttccatcac aacagagaga atagacgata cccgttgcag aagaaccact     92280
     catttcgtcg agacattgaa tccttactga attgacaaga agcctcgact gaatatatct     92340
     caagcttctc tgtcgcgatg gacattttat ccgaagtcgg tgcgcctgct gtagctatgg     92400
     catcggcctt gtcggtggcc gccggcgctt atctgaacgc gaagcttgcc attgccactg     92460
     atttgcgaac aatccacagc gacaaggctg ccgcaaagcg gttaagtgag cgcatcgcta     92520
     agctcgatgg ctcaacaacc atctacaaga tgctcgagcg ggcggtggaa gtggaaggac     92580
     gagctaccac agatgcgctc tggtttgagc agaagacctg gtcgtatggc caattgaaag     92640
     attgttagta tcgctcctcc atcgaagagg aaatatcacc taggtacatc tgattgctga     92700
     tacgactgtt tgcagtggtc gacagaatgg ctgctctttt gaagagtcgt gatatcaatc     92760
     ccggtgatac agtgggtgtc tttaccacca actcaccgga gatggtcatg accgtatacg     92820
     ctctatcaaa actgggcgct gtggcagcga tgatcaatac caacctgcga ggtttgtgga     92880
     tcatccaatt ccaacccagg ggaatagact gttgacacta gtgacagacg atactttcac     92940
     ccattgcgtc aacgtctccg gctccaaatt gatcatctca accgcagacc tgtgtcaaca     93000
     cgtctgcgtc gacctaccac acttcacact cagcctgggt tcattcgaag gtgccgaagc     93060
     aggcgcaatt gagcccatca cttctggaac cctccagcaa ttctccccat taggacttgc     93120
     agcagccaag cgtagcccaa aggacctctc cctcctgatc tacacatcag gaacaaccgg     93180
     gaaacccaaa gcctgcgcga tccgcaacat gctcactcta atcacctcca acccacactc     93240
     ggcagatgta agcaaccact caaagtacca cccattccgc gtgtattccc ctctaccatt     93300
     attccacggt acagccttct tcaccggcct ttgtgccgcc atcggaaacg gaggcacatt     93360
     atgccttgga cgtaaattct ccgcctcgaa attctggaag gaagtgcacg attcaggtgc     93420
     aacccgcatc ctatacatcg gcgagctatg ccggtacctt ctcgcgacac cgccatcacc     93480
     ctacgaccag gaccacaagt gcattgtggc aagcggtaac gggctgcgcg gggagatctg     93540
     ggagaagttc cgtgagcgct tcaacgtccc tgagatccgc gagttctacc gctcaaccga     93600
     gggagttgcc aaattcgaca accacggtgt tggagcttgg ggcgctggca aggtcgggtt     93660
     ttctgggcct atccgccggt tcttggaaga tgacactttc atcgtcaagt acgatactaa     93720
     caccgagatg ccgtaccggg atcctgccac tgggttctgt gtgagggctg cgcttggaca     93780
     ggagggagag gcaattggtc gcgtccggga ccgcggtatg ctgattgagt atctgggtaa     93840
     tgagggtgcg acggaagaga agcttctgcg tgatgtgttc cagaagggag atctgttcca     93900
     gcggactggt gatctggttg ttcaagatga atctgggtgg gtgaggttcc aggaccgggt     93960
     tggtgacact ttccggtgga agggtgagaa cgttagtgcg ggtgagattc gggaccatat     94020
     ttgccggatt gagggtgtgc atgatgctgt ggtatatggt gtgaagctaa gcgggtatgt     94080
     ctcgaggctg tctttctctc ttttgttcgg caagattgga ttgctgacgg tctatactag     94140
     gtatgatggt caagctggag ccgctggtat tacactagag tcaccagagg ttgagactga     94200
     gttgatgtcg accttatgca aggcgctcaa gaagaagggt gttccttcat acgctctgcc     94260
     tcgactggtt cgactcactg agaagtaagc attcccttga ttgcgataat ttggccgcgc     94320
     tgctaatcaa gcgtaatctg cagggttgct acaggtgtca ctttcaagca ggctaaaggt     94380
     gatttagcga agaagggctg gaatcctcgc caggactcgg gcggcgatat tttgtactgg     94440
     ttgaacggca caaagtatca gaagctggaa gagcaaagtt gggcggagat tgagagtggt     94500
     aaagccaaaa tctgagcctg cactctttat aatgtactca atggttccaa ggttgttcct     94560
     cttgttctag gatatcctga gtacatatgt aggccagaca ataaacgccg ttgtagatat     94620
     gttagaacga tgaggtctag ttggatccac ccgaatgggt ctacaacatc caaggaggaa     94680
     accatagtgg agggctttct tggagcctgg aatgtatgtt tcataaatga gataactgat     94740
     ccctggcatg tctgctctga tctgacggca ttcggatgtc gatcattatc gttgataagg     94800
     attaaggacc tggagtatag tgggtcagat caaactcccc cacttgtgtt aaatgttagc     94860
     ataagatgaa tattctcgtc gaacatgaaa gaattcgaat agaaatacaa tttcccatag     94920
     cagggatttc tttcctcaca tgcaggtaca tgagtcgtag aaccacagag cgacagaaac     94980
     ggtatagatc tgcccctggg atcacgtgtg gaggcgtcat caagtgacat ctctttctcc     95040
     tcacaacctt tatctcagcc tctgaatccc caactccata ccccttctga accttgaacg     95100
     cactcttttg gtgctacttg actgcacata cctgagatat ccaccatctg cgtccatttt     95160
     cccgaactac aactatcata ggcatgaagt tcttatcagc cgccagcctc ttggttctta     95220
     ccgctcctct tgcaaatgca gccgcattat ctatcttcga tcccacgcag gcttcactga     95280
     aggcgaacga caatgagaag tacccagtca agggtgaaaa ccccctgcag tattgtgcca     95340
     agccagacaa ctacaaactc gagatcgagt cggtggatct ggcacccaac ccgcctctac     95400
     cgtacgtcgt ccacgaagag tattatctaa acgtagtaga ttccgatagc taacctctcg     95460
     gtgataacag aggacagacg ttaacaatct ccgccaaagg taccttgctc gagagaatcg     95520
     agaagggcgc taccgtgaac ctggaagtga agtggggtct catcactttg atcaagcaga     95580
     ccgtggacct ctgtgatgag ctcaaaaatg tggacctgga gtgtccccta gagaagggcg     95640
     agatggttct gacgaaggaa gtggacttgc ccaagcagat cccaccggta cgctgttttt     95700
     tttttttttt ttacaatcgt ctcagagtaa accaaacagc taacgtcctt tttacagggc     95760
     aaatactccg ttcttgctga tgtgtacaac aaggagcaga accaagtcac ttgcctcaag     95820
     gccgatgaca tcgtgtttca cttttgatcc tgtctatttt ggacattgct ttgcatccac     95880
     tcaccaggtg gcttctctcg atttgctaaa ctgtcaacgt cattagctta tgtgcttgac     95940
     tcgggggcca aacatccgca atgctctttt ccacgccctt cttatgacta cttcaacatt     96000
     cgcatctgtt gtttcgagtt ctataacgct ttgcagtact ttcggatatc atttggactt     96060
     tctcattttt acgcttttcg catctgttat tcttttacaa tcgtctgtat aaaccgcgag     96120
     tacggcacta aagcttgacg gccacatgtc tgtggctgtc acatacaatc acgtcatctc     96180
     cactgaccac ccaacatatg ttaaatcgta gagccgggaa gagaatatat gtaaaggggt     96240
     atacgaactc atatgagttc tcagttgcat tgggtatctt ccctctctga tatttccatg     96300
     ttctcttccc gactatactc aaacgctgag atcctcaggt gatgtttaaa tcctggaggc     96360
     ggaacggcga aaccaactcg ccatttcccg gctaaatgac aaagacaaag attcatgtaa     96420
     aacaagtcta ctctccaaac agacgacgca cgcgtttaag aacgctgtcc ttctccgggt     96480
     cgtaggggtg gtctttgctg ggaatttcga ggacagccgg gaaaggatcg gcgaatgcgt     96540
     cgacgctatg gcggatgcgt tctgcgatct gaggttgcgg cacccgttag tgaacatgta     96600
     cgcaatggga tgggacgctg taaatatcta gcgcaagata cgaggaagca actaacgtgc     96660
     tggttaatca agagcacagc aatgtctttc ctctcctggg tgaagttctg gaacgcccgt     96720
     tcgatctccg aggtctcggt tttggaatca acgacaagga agtttctctg ggagtctggt     96780
     ggttcggtga catgctgtaa gaagagccag taagttaggg tggcttttca tataaatgtc     96840
     atggagatgt gacgtagatg gggtagtgaa cagttcatac cccgacacct gcgagcaaaa     96900
     gaccagtaac ggagctgggt tataggttga gctaggtcag ctgggcacaa ccttttcgag     96960
     gacgagcaat ttgtaggaag ggtctttact cttcatcacc aatgacagca aggaattgcc     97020
     gctcctgggg taccgagtta gcgatcggag gggtcattcc attgaatcga tgtcaagtac     97080
     cttggatgtt gcggccgatg ccgccatgat gaggggaaat aaatgaaagg gctgagattt     97140
     gcgagacaca cagtcttcga actggaagtt cgagatagat caggtaaatg acagatctgg     97200
     tccagctgtc cgttgatcac cgtggttatc gccgggagct gcgcattaca taagctgatg     97260
     caatttctca gatttgttta ctgcagggct tcaacgtcca caaaacaatc gtgacctttg     97320
     actcaaccgc ctctcacctt tgatgctctt gcatcgtctt cttgattaag acgaagctgc     97380
     tgaggaacag cttccgtcta ctacgactcc catcctccga catcatgcct cgacttgtac     97440
     gccgccgtcc actctccgag cgcatacgct cacacctcaa tccatatgac tttctgcttt     97500
     ggctttccga ggaatttgaa ggcggtgatt gggatcagct ggagaaaaac tggactctgc     97560
     ctattggtat tgcgctcaac gtgatattcc ttattgcgcg agcaaatagt cggtccggtg     97620
     gcagcaaggc ttttgacgat gtgttcggcg acgacgatgg cacatcccta cttgggtggc     97680
     ttgtacgtta ttcttttcct atctttatat ctctcatgtt gcccaactat tcgcgatatc     97740
     catgaaaagc taatcggccg tgattgttct tcttaggcct cattcatcgt ccatttgatg     97800
     gccgttgcct ctacggccaa tgccatctac acatttcaga agacgaggca ctatcgtctg     97860
     tttgagaact ccatcgataa caacccggcg acaccatcag cacatcgtgt acgcgttgat     97920
     tcgagcccca tgatgccgtc tcccctgcga tacatcgcca aggcgctatc aacggaatcg     97980
     gcacactcga gagcccaccc agatgcacag cgggatgtct gggagcttgc aatttgggat     98040
     ccttcgccac tttgtctccg actcttttgc ctgtttagcc caggacacgt cttggtatac     98100
     tggctgttcc tcccgaccca gctttccgat ccacgcccca gcgtgacgat tgtgacaacg     98160
     atcgtcttga cagctcttct gtctgtgcag atgtccttca tttcttcttc ttatacacag     98220
     caagccaagg accagaaggt tgtacacaaa gaggtcttca aagaatatga cactaaatat     98280
     gtacaacctc gaacgcatcc cttgatgaga gatgttggca cgcagttctc ggatccgtat     98340
     ggtgaaccgc ccaagactga ggatgagtgc aacagggtcg agacttacag cccagcccac     98400
     atcattaacc gtggtttcaa gaccagtccc aaccctaatt acctgaagca cgtcgaccca     98460
     gaaggtttca ccccggttcg tcagccgact gcatcgactc cgatctcctc tatgttccag     98520
     ggtccaccaa ccaacacccc gagcatgtcc cgagatggct cgccgatggc tcgaggtact     98580
     agtcgcacaa caatgcggca accgcagttc cgatctactg caacaacaac aggtgatgga     98640
     ggaagcctcg gtatttacag ccacgcaaac tctccactga ggaagtctgc gacaacttca     98700
     ttcgatcgcc gcttacaaag caatggagac tttgtttaca aggagcgtgg cacaactcca     98760
     ttgatgcgga gctccagtcc gctgaaaaga agcagtgtgc cgggaggaat gaacccaggt     98820
     gacccagcca ccatcaatag atcagataac atcagcaacc gccgagaagc aggccggttc     98880
     taagactaat gaatgaccga attccattta cacaagcatg aaactttgcc aacccagatg     98940
     cgcagttttc tccaaggcat gcgcggcaat gacacgatag cagcaccctt cacacccatc     99000
     gtacatttat ccccatcctt aattgaggct atgcctgata caactttaca ttttacgtct     99060
     gagaggtcga ttgtggagga ttgaagtcca cataatccaa caccagacat tagccgtcga     99120
     acagctgtct ctccatcccg ttccgttgga accagagcat catcagtccc gatggagaag     99180
     gtcctgaagg atcccgtcca gagcatctcc aagtgaatcc gagatcaaaa aattgagaat     99240
     gcgagacgcc gcgccttcaa cctggatttc tatgaccttc atttacagac tgggacagtc     99300
     tcagggaaac cgagcttcga gatacagccc ccacgagagg caggccctaa gtgaagaatt     99360
     ctcgcgcagg gaagagacag gagagggcta cggacacgtc cgtgtggagc gcacttccga     99420
     cgcaacccaa agaggagaag ccatcaatat ggcccggaac atgactgaca gggatccgtt     99480
     tcgtcatctg agtacgttca gggtgaatcc ggggcataca acccccacaa agccgacgcg     99540
     atacgagagg aagttgcacg tcgcgctgaa gagaaaaatg atggggaatg gtggtgagac     99600
     gctgtacacg agtttctaat gcgtcacagg gatgtcctaa caggtcgggg acgacctgcc     99660
     acttgatggg ggatgctgtg cagcaaggaa atggaatcat catggaggaa agatattctt     99720
     tctgatgggg ggtactggtt atgccagcag aaacagagac aatcccgcct tccataatat     99780
     ttccataata cttacatacc taggtatgta tgtattcata cctaccttct taggaaattc     99840
     agacctctcc tattccatca cgttcatgcc cttatccatc atattcatcc ccaggagtta     99900
     gtttctgaag gaatcagcat aataaggtgt aaacccagca ccgaggatct ctccctggac     99960
     acctcaggca ggaggtaggt cagaggatcg tctggcagga ccggaccgtc ccgtctgtca    100020
     cctcttccac ccatatcgac ttcatctccc ctaaggccct gcatcgttca agttcccttg    100080
     atccatcaga tacatccgtc gaacatatca agaccgtcca gataacctgt gaccgtccct    100140
     tcaccgtact tccaacagaa gaatcaagac cgtccagata ccctgtgacc gtcccttcac    100200
     cgaacttccc acagaatcat acgacatccg cacgagactt gccgtcgccc accggacaag    100260
     ctaaacccgc tacagatata gcttctaacc tcccgcagct ttctatccca tcaatcccgt    100320
     atacttaacc tggcactatt tcgtcacgtt gagtagctct gccgccttga aggttccttt    100380
     acaaccatct tccatcgact gcgtgagatt gagaatgacg aagctaaagg aagtcgattc    100440
     aaagtcggag tctgaaagcg accggcgaca acagacccaa aaggccaaga tccttgcgaa    100500
     gattgcggag aaagtcttca acgacgtcgt cgaatctgtc cagaaaggaa attctgaaag    100560
     cctctgggag gtcggtctcc aggcttttga gcaggcaaac gagctttcat tgattcagaa    100620
     ggctgggccc atcgaaacgc ttcctattgg tgaggcggcc aggtttgaca tcgtcaatgg    100680
     cttcggactg caagagcaag gcgaagaatc ccttgaactt caaccgtggc ccccatgccc    100740
     actcccgacg gtggagctgc ctgactctgc ccgtaagtca ttcccgaatc ctagagattt    100800
     ctctaagcgg cttgatgctt ttattaggct ggaactaata actgatagag aaaatgatcg    100860
     aaatcaccaa taagtattta cgcctttcaa cacagaatga agcagctaca cgctgtatca    100920
     ttaacgacat tctgttcgct ctgttagata cagttgtgcc gtatccaaac aatggccaat    100980
     ggccattgaa tcttcagatg gagacctcgc taacctctcg tccgttcccc cttaggggaa    101040
     ggtgtaccaa gcaaagggca cctgcgatta tacattgtgg tacggagata agggcggcgc    101100
     agacaaggct attaacttgg tccttgtcga ggcgaagaag cttggccttg ctagccaagg    101160
     tgacgaccag gccttaggat atatgggtaa gtctttatgg acttctgttg gaaaagctct    101220
     ttactaactg aaagttctat ttccagcctg tgtccaccaa gaaagaagga cccagccttc    101280
     tcagaactct acagtttatg gtctgagtac cgatggtgag gagttccgtt ttcttcggat    101340
     taacgaaagg agcgaggtat attaatacat tccgaaatct cacagaacta cctagctaat    101400
     gttaacagtt caccaaagtt atcatgacga aaacgcctgg tgggaactac tctcgtatca    101460
     cgagtatgat tgcttttatt atgagggagg cggtttccca gtcgtcttac acgtctagga    101520
     atacttcaaa ggatgtgtcc atggaagatg accccgtgac tcttcccccc gatgtgtagg    101580
     atactttcca tttctccagg agaattttta gcttgccttc agacaaaacc tttacgttct    101640
     ttttcacctt aatttccctc gatttcgaga tgatatggct ccgagggaag tccaagtaac    101700
     gcgttatacc gtttgaaata tctacccgtt tactgccaac catctgcaaa gaatcagtca    101760
     tgaacccaag gggcagaatg tgccagtcga gcttacagaa attcaataca tccatggatg    101820
     taactaatcg agccattgat tcattggatt ctgtatccgt acggagtaga caatcgccct    101880
     ctaccacaat gctcaacgcc accttcagat atctggatcg cactttcttc tcaaacttca    101940
     gctattcaac ttctacaggt gatgcaattc attcttgaaa tgtggggctc acgaggaaac    102000
     tgcccattcc agatgggtta tttcagcatt tcccccaggg gttagcattc ctcatgggca    102060
     ttcctcatgg gcattccgac acattattct tacgcgttat gagcgcgatc acctatgaag    102120
     atctctcagt ctttttggat cgccccgctc atttgagtct atcgtattcc ttcgacagcc    102180
     gccgacatag acctttgctc aggagaacca acgcagggac agactactct cttcccactc    102240
     ttcacttctc gctcatacac ggcatgggct aggacaacta ctcattgtgc tgtgcccata    102300
     gcatttgcaa caccaaccac aatcacttca gtctccgccc aacatggacg aagctcctgt    102360
     caaacttccc gatggacacc tcgtgaatct ctcaccacga cctatacgcc aaagtgccta    102420
     caaagcgtac cgagccgagt acaagtcttc gacggaggcc tcagcaacac ctccacctcg    102480
     ataccgacaa gaaggaacat caccagaata tgctgtgtca ggaggcgcat ccgggaatat    102540
     ctcccaactg ccaaaagcta ccaagttgcc agtcccgagg agtctcgccg aaagtcgtaa    102600
     agatgattca aaccaaacga ctagtcccac tgcccttcct aaactgttcc cagccagtca    102660
     ctcctcggga cggctcggtg accagtctgg gccgttggac aaaggtcacg atcaatactg    102720
     gaggaaaatc cgggataaat tgcaggagtc gccattatca acgagacgtg tcaagagcaa    102780
     ggaaagcgac aataaccaat ctcctaactc acgcatatcc taccaccgca gcagacctcc    102840
     tgccagcact agtcaagatc gggcaagtcc ccgggcaggt accccacgat ccggcatccc    102900
     gagtccaagc actgtcaaga gcagtcccgc acaagggtcg aggaacgatg cttccactcg    102960
     tcctgtggac agccaaagca aatggcggaa gaaagacgac caatgggtac tcatggatgt    103020
     taccgaaacc gcgtccctga aatcatcaag gacggacgcg acgactgact ctagcgctcg    103080
     atctcatcct tccgtttcgc cagtgtccgc cgagaacagt tcgatcactg actgggaaga    103140
     ccgattcgtt gtgaatatgc caactgcaaa ggatcccaat ccaccaatga tgacggctca    103200
     acaaattgcc gagtatcaaa gaagcattga acgggtacac cgggacggtg ggcaaatggc    103260
     agacccggac acagtgccta gtcgtaacgt gtctcccgag atcagattca accctagcga    103320
     acaaaaagca cagagcccaa gggccatcaa cacatacgat ggggtgtacg agggacctca    103380
     agcgccgacc ttgtcgcgag atgaacattg cccttcgccg cagcctcagc aaaatgctca    103440
     gccggagcaa gtttcacagc ctcacctcca gcagccccag ccccagtcca cgactgcgcc    103500
     gcaacgtcaa atagccaacc gctactatag ccccgatgaa atcgggtgta atcggattag    103560
     cacaatttgg gaggagtcgc ccacaaaacc gaaggagaag cgatccctcc aaaacgcgga    103620
     cgggtctttt ttaggctgca gggaaatatc cggggagaag aacccagacg aaatcctcag    103680
     gttcgcttcc tcagacgatg ccagtctcca cccaccccca ttggccttag gttccaagaa    103740
     caagcaaaag gtgttgaagg aagtgaagaa agcgacagac cgacaacccg cccacagaga    103800
     cgaggggact acagtccttc gagaagaact accacaaact tctcagaata cgagacctgc    103860
     ccaatgctcg aagccgtcag tcatgtgcca ggatcagagt tgctcccaga acccatcccc    103920
     aattccgcgg acgaggtcgc aggactcaag caaggagaat taccatccta ccagcaatac    103980
     accccagcgg tccggaagcc aggaagaaaa tctgggggac gacgatgtgt tcattatcac    104040
     acccactatc acacgcacta tgattcccac gcccgacaac aaagcatctt cgccaaagcc    104100
     gcaagggctg cgtcgtcctg gtggcacaaa ccacacagtt accgccgagg ccatcaaggc    104160
     cgttcgggca aaggctcaga tgatttccac accgtcagga ttgcggcccg gggaacccac    104220
     cgtggatacc aggccaacag ggcgtacctt gacaacttct caaacactgc cagtcagcag    104280
     cgtctccacc aggaccacca aagacgaaga cgaggaggat cggaaccaag accatgcgca    104340
     agatcgctgt tcagaacgag cagcaggtac aacgtcgaat actatccgtg gcttcatccg    104400
     tacctccggg ctcgcaaaac cgtcagggct agtcaggtca cccacggata gccttgctgc    104460
     aatactgcgc aacaggactg agtcccttcg cacacgtgcc gaatccttac ggcatgcttc    104520
     ggggtctccc cagcgttcgg accagaagca atcgccaagt cctccaccaa ttcttccgtc    104580
     cagggacaat tcggaatcat cacggtcaga acggtcattt cggtcaacaa atggaacctc    104640
     accggtcccg gcaaacaggt ctccttcgcc gccaaaagtt gccacgccgg agaaaaaacc    104700
     ggaggaaaat aagcagcctt cttcacgacc acctgcccca agcaaaccaa caacgaaaag    104760
     agtgaccctg tcagaggaac ctccttcgtc agccaaacct gacaaacccc gtttgtcaac    104820
     taaaaagatt tctgcactag caaagccgtc aacattggag aaaatctgca agtctacatc    104880
     tacaacccca cccgcgcctg agaagtcttc tcctcccaag gcaaagacgc ccgatgcttc    104940
     accaaaaaag gcagagcagg cgaaggccct gccccgtctc catacttccg gtaaagtctt    105000
     ggagatcgcc gaactcgatg gtcttcaggt tgcaagtcct aaggagtctc ttcaatccaa    105060
     catcacagac gtctctgccg acctaggtga catgcactct gaagacaagg atggttccga    105120
     cggacaggga ctccaccctt tggctttttc acttcttttc aatattcttg ttgttgctgt    105180
     cacccaggtg aataaagctc tccgaatggg caccgacagc ccttatgtca aatttgtggt    105240
     caataacacc ctgaacatga cttgccactg ttggcatgtg tccaaatgca tctacatcac    105300
     ggtttctcac taccaggcca caggcgcctg gcccaagcct cgccgtgacc aggctattac    105360
     ccggttcgtg gtggagcttc ttcaagccat tgtatatctc ttgattcttg ggtttgcagc    105420
     catgctgatg gcccgtactg ttggctatgt tgttctagtg agcagctgga ttgcatggtt    105480
     tgccaggccc tttgcgtggg tctttcagtg tgttggccgt gccctgataa tgtaaaatca    105540
     gccagacctt ttgctgtatg cttgtacaag attgcttctc tggaggtctc gagtttggaa    105600
     gtggtcgttt ttgttgcttt cgactctttg tcctggtctc gagcggttct acctactcac    105660
     ctaattgtgt cttttggctg tattcttagc tcatcgttaa atagctctca accttggata    105720
     ttccatatga aaccatctat cattgtgtat gccaatgtat gtagtagaca acaacttgca    105780
     tttatattga gcttcttgac ccaaaaccga gacacaaaag ccgaagaccc tgaacacaca    105840
     gggatgtgat ccagcgtcga ctctcccatg ttgaagaggg aaataaaata ttatcagact    105900
     tttgttgtgt cctccccaga atccgactcg tgtatgatac tctctctctc ttttgctgtc    105960
     aaaaaaaatc aaggacgaaa aaaaaaaaaa aaaaaaaaaa aacgacccaa ctccgtcatc    106020
     ctggtgttga atggtcctgt atgctagccc ggaatgatct tgcgaaagca atgcaaacgc    106080
     agagaaaaga caccgaattt aaacatagaa ggtccgtttc tcaaacaatt tccatgcgct    106140
     gatgtgaaga gaaaaaagaa agcagaaggt gaaaggcaag gggaaaaagc atggctaggc    106200
     tattgtaggc cgtgatggcc gcccttgcca gctctatgaa ttgagaccaa gcgcagaaga    106260
     aacacaaaga taaagacgga atgggccgta agggcaatat tatgttgaat ttttgttctt    106320
     ctttcatttt tttttaattc ctccattctt ctggactgta ctaggccaaa acagaaaaca    106380
     tcaaatagtc cagaagagaa gctccgggcc ccaagaagaa tagatccgag aaaataaaag    106440
     agaatccgat cgacgaagcg ccattgttaa aagagacggg gtatcggtac attatgttga    106500
     aatgaaaacg ctgaggaaga aatcgttgag aggtcttcag tcgtgacgcc ataagacatt    106560
     gcagggggag cccgagatgt gttggagtag tagtttgtat gggctgtgtt atcgttgaga    106620
     tgagtgatgt tgaattaggt aagatgttga gttgttatga gatgtttgca aagatggcat    106680
     acgaccgagg gcgtcgaggg tgtgaatgag tagcaactga ctctgagttg acttcgggaa    106740
     gggaactggt ctagttggca gcaacgccgt tcggttcggc gtggccgttg gtcaatggct    106800
     ttccagtcac ctcgacgttg aggtctttga tctcgaggcc attgaataat tcgaagacag    106860
     cgttagatct gtggaagtcg ttgtcgacga tattgacaag ataccagtcc tccatcacat    106920
     gctgaatcag ctggcgacta gggctagctg cgtcatgaca cttggaccag tgctcgccca    106980
     aaaggtatgc ctcatccttc caggccaaga aactgactgt ctcgacgatt gtgggctgga    107040
     taatctctcg tccggcgaag ataccccacg tcagggcatt cgggctgtca cgtgtgttgg    107100
     tcttaagctc gcccttcttg ttggtggcgt ggtaggtcaa atcatcgttc ttctcaatgc    107160
     gtgtgatgag ctcatcaatc aagttggagg ggaccagaag ctccaggtag gccttctggt    107220
     agacgaaacc gttcttcggg ccccatccat acactggatg agatgacttg actccattga    107280
     cagcgggctg agagttgatt gtcaggaatc cgcgctggtt cagtttgagc aagtcctcct    107340
     ggatttcgtg ggcttcggtc gtgattggtg agtcactcca cggcagtcgg tcaagcttgc    107400
     ccgtcaagaa attaacaaag atatccgaga tatccttgat cgattttggc tcgccccaaa    107460
     gtttgatgtt ctgctcattt gtgcccttca agcccacacc gtaagcgtcg agttcaccga    107520
     acgcagggga acgagaatcg gtccagcgac cgttagggta ctcgtcccat gtctgggtac    107580
     gagcaacgta tgatgagttc cggttgcgcc agaatactgg tcgcacatcc tctgatcttc    107640
     ggccaaggcc aagggaaggc cgccagggca gtgggcgttg aatgggggaa tcttccgacg    107700
     gggtaagttc gagctctttg agaaccaatt gagtcgcctg agccaggttc atagtatagc    107760
     taggcaattt gttaggaaat gtcgttgaga agagtagtag agtaagctta caagtgcaag    107820
     tgcttgatac cagctgcgat cagctgcctg cacatattgg cgatcagagt ctttccgata    107880
     tctcgaaccg cggaatcatc gttcttgacc ggctcaaggg cctccatcca ctcagaaggc    107940
     actttaacct tagtccagtt ggaccgacga atgaaagaag cgtatgtctg gatgggcatg    108000
     ataccgggga tgatggggac attgatcccc ttggctcggc actttttcac ccattcgatg    108060
     aagttttccg catcgtaaaa catctgagtg accacgaaag agctgcccgc atcaaccttc    108120
     tccttcaagt ggtcgatcag ctggtccaca tcggtgttgt catcggcgcc ctcgggatag    108180
     ccgcccacgc caatgtcgaa gtggttgcca tatttttccc gaatgtattt gaccagatcc    108240
     ttcgcatagc agaatccatt ttccgccgcc tcccatgcct ccttttctcg cggtgggtct    108300
     ccccgaagag ccagaatgtt ggtgcagcca gctttgtagg cagcttggag cgcttggtca    108360
     actttctcca ccggcatatc tgtgcaagtt aggtgcatgc aggtctccaa gccatagacc    108420
     gattgtgcca cgctgaccat ctcgcaagtc agatccgata agcgaccacc agcaccccag    108480
     gtgatatcga tgaatgaagg acccaaccca tgcatgcggt ccattcggtc ataaagattc    108540
     tgtacaccct gggcagtttt gggagggaag aactcgaagg agattccagt ctttccctcc    108600
     gcctcatttt tggcaagctt ctctcggata tgcatcgtgt cgggttaatc tagtcttcgt    108660
     aagcatatca tatagtctta agaagccacc gattcaaggg tttgtctttg tgctcttgaa    108720
     caaacatacc gacagctagc aataattaat taaattgtct gtggaacttg aaacacctgt    108780
     gcagatgaga cagactactt ctgctatctg agagcctgag cacaatccca gtgtactgtg    108840
     acacctaaat gtccaggacc taggaatgaa gtggaatgga taaaacaaaa attcgagggt    108900
     aaaaaaaaaa aatttgacta aaagaaggaa ttgcgaggct ccaagggaga gtgaaggaga    108960
     ggaattgagg gattccggtg agcggaacat tttggggaca acatttggcg gggaaggccg    109020
     gccatcggag cacgtgtttt gtttgtttaa aggggaatta aggggggggt ttagggggga    109080
     attaagaaaa taatgtgcat agtataggaa atattacgtt tttctttcat ttcctgctct    109140
     ttttctatca gaaaataact ggcaatggga cttttatagc aaaatcagtt tctctgacct    109200
     gataatgcgc aatatgaagc cccataccgc ctgccccgcc atagaaaagg aagttccggc    109260
     aaaattttcc cgacttgaat ttcgttgacc ttgactcttt gactctttga ctctttgaca    109320
     attgcttcaa tttagcgtcc atcacaactc caagattccg agatgtcgac tgttcctccc    109380
     ccatctgccg atcaggacta caagtccacc ctcctacctc tcctcatctc caacaatgtc    109440
     ctctcgttcg gcacctatgt cctgaagtcc ggccgtgaat cgccctactt cttcacctct    109500
     tccctcctgc acactgcacc tttgctgcgc gcctcctccg ctgcatacgc cagtgtcctc    109560
     tccgccgagc ctttcgtcac taccaatgcc gacggcaccg ctcagcccaa cttcgacatt    109620
     atcttcggac ccgcatacaa gggtatcccc atttgcgcat ctgtcaccaa cgagctcgct    109680
     gtgcgggatt ccctatccgg caagactacc tgggacaatg tgagctattc cttcaaccgc    109740
     aaggaggcca aggcacatgg cgagggtgga aacattgtcg gtgccccgct gaagggcaag    109800
     cgggtcatta ttgtggacga tgtcatcact gctggcactg cactccgtga ggctgtcggt    109860
     atcattgaga aggaaggcgg tattgtcgcc ggtgtcgttg tcctgctgga tcgggaggaa    109920
     cgtgtcagcg acaccgagcc caagagcgcc attggcgttg cccagcgcga tcttggtggc    109980
     aagatcccca tccggtcagt tatcggtctc catgacctga ttgagaagct gggtgatagc    110040
     attggcgccg gtgagatcca gcggctgaag gattaccgtg agcgctacgg tgcccaatag    110100
     acatcggctg gaatccgcca aatcaaaggc atgatgtatg agcaaagaca acaggatgga    110160
     taccaggata ttttggagtc tgaaaatatt attacttaaa tattacccat atccaagtaa    110220
     ggaacgggca catttctata tggattattt gacatgtcga tacgcaacca tatactatag    110280
     gctagctagc aaatggcatt cccatttgcc catcttggaa ccacatgata tagcgggtaa    110340
     gcaaagctcg cacttttgat ttgggatcgc tcgggaaggt tcctggcaaa cgggtcatac    110400
     cagtgctcgg tcaggaatca gggatattga agagaaactt ggcgatatac tccaatcggg    110460
     aaacatggag ctgtgaatgc cagaccggcg gtctctgcct tgctaattat gtagagcata    110520
     ttgataatct ggtgtgttgg tgcaaatgtt tttactatct gaatatctct acctatattg    110580
     tatgtattcc aacacacccc tgaactgatt agttccgccc ggacgtcgga ttccctgaga    110640
     gcaagacaat gttccacata agcttaaaga aatagatagt ctgaattgaa gtacctcggc    110700
     aagccaataa cggcaattga tattacgcgg caagcgacac agcacggcag atgctactag    110760
     tgctgtgttg tgtttgacac cccaaaagca atacaagtac cgcatttaga atgaatgggg    110820
     cagtctacgg tctatctatg taggtagatg tatatatcag acacggcgct cgggcaatat    110880
     gtatctacca agtttatcac ttgatcagtt acatggtggg acatactttg acaccgtaca    110940
     cactgattcc aataagaagt aactgcagtg gataagacgt tggttttgtg cggctacggc    111000
     ctaaaagaat atgtatggag atggaccagt gaatacacat acatatatat atgtatgcaa    111060
     tttggccttg cacttaggct tctccaatga gaacagtaga ctagattgaa tctgaattct    111120
     ctcgcactaa tgcgaccttc cagggttgcc ccagattcta aatgagacat ctaatcggtg    111180
     ctgtgcatgc atataatata tggccacttc cggtgatatc ccaatggctg cctgcgtttc    111240
     acaaggagta acagcacggg aaccggggga aggaccgaga ctatttagtt attttcaact    111300
     cagtagagag ctaaaaacat aattgctcga ctagctccac ctttgtaggt atttccaact    111360
     agtatggctc agtttctatt cgagtggcag acagcttcca aaatctagca acaccaatac    111420
     ctcaactaac cagtaagtaa atagttattc ggcaacgagc ttgcctctgg agcaagttca    111480
     taagattaac ggatttaaga aaccaagaga ctggtcagaa cgtcgtaggt tctatttgtt    111540
     cggtctctga ctcgaaaaat tagggctatt acatgccgtg tcttagtggt taggtcttgg    111600
     ggtatttcta tattatattc cgcttaatgt ttataacaag gtacgtcgag tataagtgga    111660
     acaatctcat ttataatacc tccttatgtt ccatctgttc cccagagaat agtacgccgt    111720
     gaggttcgtt gacgtggtca gtgaatacac ataaacccgt gacgcttttc ggaatagtga    111780
     attacaggtg acatggtgtt acctctgtgt tcttgactct actacatagg aacattgagt    111840
     gtctctgatc tagtgtcacg atcccaatag agcactgaat cgtctcaaat ccaattatca    111900
     aaccttaggg gcctggatta ctacttggaa tcttggcaga atagtagata tatcaatagt    111960
     gaaagtacta tgagtaactc cctcaaccat ctatgtttat tcaactgccc tctcacgaaa    112020
     agctaggatt actcatagat agccacctaa ttctagaacc aatcatcccg gtgttcacga    112080
     tggacgccag gttacagctg gctaatgcag catatgtagc catatttcct tattcggaag    112140
     gctcactaca cgggcaaaca gtgtttcggg agtttcaacg gccaagatct acgagccgtg    112200
     acttgaacac ccgttaaagt gactcagctt tctgtaggat agtatatggc caataataat    112260
     aattagctgc cgttataaaa tagtacaaaa tgcagcgtac agggaggctc gggtcctgta    112320
     tacctatgta ctccatacct ttatgcaggc cgaataacaa ctttgaaccc aagcacccac    112380
     cccaatagga aataaagata tcttgttttt gtgtgcattc aaacaccgag gtaacctgtt    112440
     gtttctctga cggacaccat tttagatttg gtgcgcgtta gacggcattt ctgctgcaac    112500
     tgttgcctct accacacatc caggaccctg gaggaaatgt tcgagaccgc gtcgatggtt    112560
     cgatatcaat gatatatggt tcaggaatgt actccaaccc aagtactttg gtagcaaaat    112620
     tagtctagtt tgtcgaccgt caaagtttca attggaccaa gataagactg gatgtatatt    112680
     cggtgctgat cagatcaggc tccccgttgc tctagacacc atccataagg cagtctcacc    112740
     gagttgtttg tcatacctgc aatgcatgga ttgctcgatt agcctcgtcg agccacggcc    112800
     attccgtggc ggccgtccca tgcagagaac tatggttatt gcttgaaccc cgagcgatgg    112860
     tgacgcctcg taagacatag atcttcgccg cctgagtccc atgggctctg taaatagcac    112920
     acggtaatta ggatgtcaat caacgcgcgg acagagctcc gtgtacttgc atccttttgc    112980
     ctcctatcag ctgcggcttc gactctaacc gttcattccg ggattcaacg agaatcatcg    113040
     aagtagctca tgtctagtct taggaaccaa aaagaacatc aggagacttg gttgggggaa    113100
     gtcgacagta aagtatcatg ctccctttga accacatcga gtgatcttac cacagctggt    113160
     agtgctctac tatctcccag acattttcag gtttctctta tttctattaa cccattccgc    113220
     agctctcaat ttcctttctt tccctctttt ctacttggga gagctcctat aggttggagg    113280
     tctattggtc atattctact tagaggaaaa tgattgaagt ctctcgttga taccagtcgt    113340
     ttttactcgt caacaccctt tcacaactgt gactttccga gaaagcaaac tgttagttat    113400
     ctctgccctg ttagtatctt tccttttcag aatacctgac cgagaatatc ttgccattcg    113460
     taccagtcgg gtacacgagc gtctttccca tatcctcctg aagaaattaa ccaacctgct    113520
     aacagggaat ggtgaaacat agtagctgtt tctcggaagt tccagtggga tcagtttcct    113580
     cttgctcttc gccataatcg acacatgcta cgatcctaag gttcactgga gcggcttact    113640
     acattgtttg tcgaccatga attggagata tacaatccca gtgcttgcct ttctcgcaac    113700
     tccaggaatc agttggcctt atgacgagac tcttgttgct tataacctca atgagaatca    113760
     gacagcaacc aacccttcgg attactgggg agaatggccc gaccacacat acttcccttc    113820
     tccagaaaat tggcgtttcc ctgtatatac gctttttctt gaccgatttg ttaacggcga    113880
     cccaaccaac gacaatgtaa atggcacact ctttgaacat gacatcaatt cgaaccaaat    113940
     gcgacatgga ggggatgtgg ttggtctgct ggacaccttg gactatttac aaggaatggg    114000
     catcaaggtt agctctatga atgaaactcg tggggacatc caatattaac caactactga    114060
     actttttagg ggctctatct cgcaggtttg gttttaatga accagccgtg gggctctgat    114120
     ggctactcgg cacttgacac tactctactc gaccagcatt ttgggacaat tcaaacatgg    114180
     agagcagcta tcacggagat tcacaaccgc ggcatgtacg tgatttttga caataccgtc    114240
     gcaacgtaag cattccagtc tgatcgtctt cccttatggt gtcacaagga tctaacagca    114300
     gtagcatggg agatctcatt gggtttgaag ggtacatgaa tacaaccact ccattttcag    114360
     tcaaagagca caaggcttcc tggaaatcgg accgtcaata tgtcgacttc cgatatggca    114420
     acacctacaa cgagacatgc gattatcctc gcttctggaa tgagaccgga taccctgtgg    114480
     atgagtatgt cgattatcaa ctgcgcggat gctacgatag tgattttgac caatacggtg    114540
     acatcgaagc ctttggtgtc tatcctgact ggaaacgaga gctcgctaaa tttgcctctg    114600
     tgcaagatcg gctgcgtgaa tgggtgccta gtgtcaggga gagacttata cgccattcgt    114660
     gtatgatcat cgcatctttc gacatcgacg gctttcgtta cgacaaggct acacaagcca    114720
     ccgtcgacgc tcttggggat atctctgggg cgtatcgaga ctgtgctcgc cgtgtgggca    114780
     aaaataattt cttccttccg ggtgagatta caagtggaaa cactctcggc tctatctttc    114840
     acgggcgagg acgtcagcct gatatgcagt cccaaactct cgaggaggcc tttatgatga    114900
     cgaatgcctc tgacccggat tactttattc gtgatcaaaa caagcaggcc accgacgctg    114960
     ccgcatttca ttactctgtc tatcgctccc tcacccggtt cttgggtatg gatggtaact    115020
     tggcggctgg ctacgacgtt ccagtcaatt ggaccgaggc ctggtatcaa atggtgctta    115080
     ccaatgatat ggtcaatgct aacacgggca aatttgatcc acgccatatg tatggagcca    115140
     ctaaccagga tgtgttccga tggccaaccg tcgaatacgg cattgaaaga caactgctgg    115200
     ctctttttat cacgacattg catatgccgg gcattcccat gcttctatgg ggcgaggaac    115260
     aagcattcta tattttagat gcttcggccg ctaactatat ctatggccgt caagcaatgt    115320
     ctcctgccac agcttggaaa aatcacggat gtttccagtt gaattccacg caatatttcc    115380
     aatggcctat cgagtcagga cgtttaggat gccacgatga gacagtcaca tacgaccacc    115440
     gtgatcccgc tcaccccgtg aggaacatta tcaaacacat gtatcaaatg cgacaggact    115500
     ttggtgctct gaatgacggg tggtggattc agctactctc gaaccaaacg cacaacatat    115560
     atctcccggg ttctaacgga gtccctacag aaactggcat gtggtctgtc ttgcgcagtc    115620
     catattacca gctgcaggat ctgggagaaa tgggcaacca aacggtctgg tttgtatacc    115680
     aaaatgaaaa ccgaacggtg aactatgagt tcgactgttc tgacccaact gcggcattga    115740
     ttgctccgtt cgataccaac accacagtga agaatctgtt ctacccccac gatgagttga    115800
     ccctgcaaga gggtccggcc aaacttgctt tgaacggctc cgataactac aacggttgcc    115860
     ttgacagtat gaagcttcaa ccgtacgaat ttagagccta catcagaaaa gagaaattcg    115920
     tctctcctcg ccctatgata accaagttct tacctgggca cgatgctccg ttgctatctg    115980
     ctgttgcgcc ggatcaaagt gaatcagtgg atatcagctt gttcttctcc acagagatga    116040
     actgctccat agtgaccgac tcaatatcag ttgaatcgtc tactgaaact ggagaatggc    116100
     cttatttgga ccttgacagt gtcagttgtg agagtgttga accggagact acatcttgga    116160
     ccggccaaat cccatctacc tggtcttgga gggccaccct gaccggcgtc tacaatggcg    116220
     tgcatagatt gacggtgaac aatgcgacaa gtatcgatgg gagagcaacc aacgccatcg    116280
     accatttctt gatccgagtt gggcagtccg ataatcccat gatctttacc acggcaaact    116340
     actccagcag cttgcttcat gagcgcaaag atggtacact tttcattgca caacacgcag    116400
     caggagcaga caaatatcgg tactctacca attggggtag tactttcact caatggctcc    116460
     catacgaggg aggaaaccac agtattcaag aactgccttg gtctggaacg aagaaacaga    116520
     gatgggaggg gaaacacgtt cggattgagt actggagccg cctcacaggc agtagcgact    116580
     acgtccaaga gggtgatgga cccgactgga ctcctgccat ccgacgtcgc ttccctcatc    116640
     tctttttcaa tgggcctttc aacaggtacg gatatgatgc tggcttggat aacatcgtga    116700
     gacaagatac cgatggtctc tggaaattcc gctttatgac cgaatggcct gcccagggtc    116760
     agttgaatgt ctggggtatc aaccccgata atcaaccgga tcaaagctac atctacggtg    116820
     attccgatgg agattcaatc ctcgaccgtc taccaccttc ttcgctcagt gtgacgacta    116880
     taaacatcac tcatcatcca cccaacccgc accttgcttg gaggattcaa ctagatgact    116940
     cgaatttgca gtttaagctt gttcctgcag gctccaaata cgttcaaatg gccctctttt    117000
     tccttctttg tattgttccc gttatcacgg catcaacctg cgcttatata ttcaagaaaa    117060
     cattctaccg gatcaaattt aaccaagtcg gtgtgagtga aaagaagacg ctcatttcaa    117120
     tggacttcat caacaaattc aaggtcggcc acatggaaga tggacagtcc agaaatccct    117180
     tcaagcgcct tgcaagcagg tcaaacttcc ttcaaagcac ttctgctttt ggaaatcgca    117240
     ctggccaccg acgaaaggtc ctcgttgcaa ctatggaata tgagatcgac gactgggcca    117300
     tcaagatcaa aattggtggc ttgggtgtta tggcacagtt gatggggaaa cagctcgggc    117360
     atcaggatct tgtctgggtg attccctgtg tcggtggagt gaaatatcct atcgacaaac    117420
     aagcagattc gatgtttgtc atgatcttaa gaaattcata cgaaatcaag atccagtacc    117480
     accaactgag gaacatcaca tatgttttac tggatgcgcc cgttttccgc cagcaatccg    117540
     tcacagagcc ctatccagcc cgtatggacg acctcgacag cgctatctac tactctgcct    117600
     ggaatcaatg cattgcccag gcgatgaagc ggtttcccgt tgatatgtac cacatcaatg    117660
     actatcatgg ctcagtggct ccgttatatc ttttgcccga gactattcct atttgcttat    117720
     cgcttcacaa cgccgaattc caaggtctat ggcctatgcg gacacagaag gagaaaaccg    117780
     aagtctgttc tgttttcaac cttgatgtgg atgttgtaac acgctatgtt cagttcggcg    117840
     agatctttaa cattcttcat gccggtgcaa gctatcttcg ccttcaccaa caaggctttg    117900
     gtgctgttgc cgtgtcgaag aagtatggaa agcggtcata tgctcgatat cccatctttt    117960
     ggggcttaag aaaagttgga aatctaccga atcccgaccc ctctgacaca ggcgagtggg    118020
     ataaagcctt acataaggag ggcgatatta acgtcgacaa tgactttgag aaccgcagag    118080
     cagaactaaa gcgccaagct caagaatggg ctggtctcga gcaaagacct gacgctgatc    118140
     tgttagtctt tgtgggaaga tggtctatgc aaaaaggcat cgacctgatc gccgatgtct    118200
     tgcctagtgt attagagagt cgagagcatg ttcagctcat ttgcatcggg cccctgattg    118260
     atttatatgg caaattcgcc gcgttgaaac tagaccgaat gatgaagctt taccctggtc    118320
     gagtgtgctc caaacctcag ttcacggtgc tgccacagtt catcttctcc ggcgcagact    118380
     ttgcactgat tccttcgcgc gatgaaccat ttggtcttgt cgcggtcgaa ttcggtcgga    118440
     agggtgccct tggtataggg gccagagtag gcgggctcgg gcagatgcct ggctggtggt    118500
     atacagtcga gtccacgacg acctcccacc tgttgaaaca gttcaaattg gccatcgata    118560
     gtgcgttaaa ctccaagccc gaggtacgtg caatgatgcg cgcaaggtct gccaagcaac    118620
     gattcccagt tgcccagtgg atcgaagatc ttgagatctt acagtccaca tcgattcgag    118680
     tccatcaaaa ggaacgagcc aaagctcagt cccagtccac cgctgctggt gcatataacg    118740
     ccatctatgg gatgatgacc ccgcaggctg cgtcgacaag gtcgggcgca tcaacacctc    118800
     cattacaacc ctcaagtcgc ccgggtacta caggatctct acagcgaagt tctatgatct    118860
     acagtcgtga cgcaagccct ggatacgatg ggcgacctag gtcgggactc agtcgtcagg    118920
     tgtcacacgg cgttcggccg gtatctggca ctatggagcc tcgcggtcga tcggacctcg    118980
     ggaaaggcag tgttatcgag ggtgacgaca gtgctggcag agccactcca gaagccgaag    119040
     acaacagcga tgacgaaatg atggccactt gctacggcga tgatgattat tccatatcac    119100
     ctgaaggaac agacccagga cgtgcacaaa ctccccagcc tccgggcgtg gctctcacca    119160
     aggaggctct atcggcgcaa cgtgctagtc aaggctcctt gttggcccga tgcagcaata    119220
     cgccctctag ttcatcggcg ccgagcactg ttgggacgga tgacaccctt attcctcctt    119280
     cacgcccatg ggcagagcca ggcaaccgtc tcggtaacgc ctctgcccta tctgtcgatt    119340
     cggttgttgg agagaagaaa gactttaaac ttcaaaaagt tgatccgttc ttcactgaca    119400
     gcaacggcga gtactacaga gtgtttgaaa agagactcga ggaacttaat ggggcgaact    119460
     cagacaacca actctgcatt gagcaatacc ttgagaagag cgagaagaaa tggttcaaca    119520
     aattccgtga tgcacgcctt ggcctcaatc aaggatctcc agcagggtca gtgcatcggg    119580
     gcaaagcagg aacatccccg aacgggtcag ttaccaacga cgatgcgaca tctcatgaaa    119640
     gtggtgagcg cgagaggaag gatgctcagc cggatgaatt ccttctaggc gatgactacg    119700
     tgccaccaac gggactgaag aaatggatgc aaatgcgtat tggagaatgg ccagtgtatt    119760
     ctctcttcct cggactgggc caaatcatcg cagccaattc ctaccagatt acccttctca    119820
     ccggagaggt tggccagacc gccacgaagt tgtacggaat cgcgacggtt taccttatta    119880
     cttctattct atggtggttt ttcttccgat actgcaaatc cgtgctcgtt ctgagtgtgc    119940
     catggttcct atacgggacg gcctttttgg tcattggaat ggcacacttt gagcccaact    120000
     cacacagtcg cggatggatc caaaatgttg gcagtagtct ctacgctgct gcatcatcca    120060
     gcggctctat cttctttgcc ctcaatttcg gcgatgaaag cggtgcaccg gtcaagcagt    120120
     gggtgttccg tgcttgtctg attcagggca cacagcaagc ctatgtcatc gctctttggt    120180
     actggggttc aactttgact aaagctacca acgcgggggt tatggatgtg cagggcagca    120240
     tcaccaacac ctggaggatg acgtgcgtat aacattgaaa tccttcatcc caaatgatcc    120300
     aagtcttgct aaccattcct atagagcgat atgtacccca attacgctct ttttgtgggc    120360
     aatcggtctc atcgtctatt tcgggttgcc aaactactat cgccaaactc ccggtaaaat    120420
     gccatcgttc tacaaatctg tctttcgacg caagattgta ctttggaatt gggtggttgt    120480
     cattctccag aacttctttt tgagtgcccc atatggtcga aattggaatt gtgagtctct    120540
     agtttataca gaacccccca ccaccatccc tcccttccta tgcgttgggt tgcactaatg    120600
     gtcaccacag tcctgtggat ttcccagcac gccagcccgt ggcaaatcct acttctctgc    120660
     gttgcattct ttggctttgc ttggatagtg gttctcttcc tgctagctag actatccaag    120720
     tcccatagtt ggatcctccc agttctcgca tgtggtctgg gtgctccacg ttgggcccaa    120780
     atctggtggg gtacatcggg gtccggactg ttcctcccct gggctggaag ttatacctcg    120840
     ggggctcttg tatcccgcag cctttggctc tggctcggga tcttggatgc attacaaggt    120900
     ctcggatttg gtatgattct gctgcaaact ctgacacgta tgcatatctg cttcaccctt    120960
     ctggtgtcac aggtcctggg ctccatcgcg actatctgtg caagagcctt tgcaccaaac    121020
     aacattggac cagggcctat atcgccagat atcacggctg gtgcgggtgc gttaggtaac    121080
     gcttggtttt gggttgctct tttattgcag ctctcaatct ggtgtgttct cccccctact    121140
     aagaaagcta ttgtgagcat catctaacgt ttaaattcca gtggtggctt tcttcttttc    121200
     ttccgaaggg agcagttatc gaagccttga acagatgtgg ggttttcttt tgttggaagt    121260
     gggtggaatg gattcaagct gcaatgtctt ttcaattttc cttacattgg tgatataact    121320
     gcttgttcgt tgtggttgtg gctcaaacag caccagccca aagtatttag tgtctaatat    121380
     aatgatataa tgtgagttga catggaagtt gacaagcaac ccgccaggtt atggctacgc    121440
     atagacgtcg agatccagtt agtgtgcctg cacttccctc tgaacacctt aatatatctt    121500
     atttgtgtta taggagtcaa taggttctta gtacaggtag gatggtaaat catggcgata    121560
     ggcctcagag agagcctttc aacccactct tggtcccggt gccatctttg caacgcctgg    121620
     gaagaggaca tggaactagt tcgctggaag aaccgaagta tgattgtgcc tatggtatca    121680
     atcgatttag tcgtgagtac aaggttcgcc gacattgcag cctgctgatt gtgttcgtcc    121740
     caggaaaggg gagagagtaa tggttaagat actattcccc ttatacgagt acgtgacgaa    121800
     cggaataaaa caaaatgtgg aagaatccaa gaatttatta tatagaacta cagatccatg    121860
     atcataattc attctcgttg aaattcgtag gctacctaaa ttataaaata gcccatgatt    121920
     aacactgggc aaaacaaaag acaaatcgca gccgcaacaa gtaggggaat atgattcgga    121980
     aatccaaatg tgactcaaaa atgaactgcg gcagtgacca taaccagcca cttgacaaac    122040
     acaaacaact tttaccactc gagaggctcg ttcttcacat caccacggtt ggtcttggga    122100
     acaggagcgg cctcgaccat agttgcgcca cggcggtcac ggcgaaggta ggcactgcca    122160
     tccaaccagg gagtatcaag ggtacgcttg gactcgaaac tgcggatctt agactccatc    122220
     tggagagtaa gaccaatatc atccaggccg ttgataaggc agtgcttgcg gaaagcttcg    122280
     acctcaaagc tagtgatctt gttaccctga gcatccttga tctcctggtt gacaaggtca    122340
     acctcgacct cacggccggc gcgggcctca tcggcaatct tctgcagagc aacctcatca    122400
     gagacaacga cgggcagcat gccgttcttg aaggtgttgt tgaagaagat gtcggcgaag    122460
     gagggggcga tgatacactt gatgccgaag tcgagcagag cccagggggc gtgctcgcgg    122520
     gagctaccgc atccgaagtt ggggccagta acaaccagga tcttggagtc gcggtaaatg    122580
     ccctggttca ggacgaaatc ggggttctcc ttgtcgtcgg tgtaacggag ctcatagaac    122640
     agagcggtac cgagaccggt gcgcttgatg gtcttaagga attgcttagg gatgatagca    122700
     tcggtgtcga cgttggcgcg atccaaaggc gcggcgatac ccttcagggt ggtgaacgtg    122760
     ggaagaccag tactcttgcc accgccgcta gcaggggccg aagagttagt gtggggctcg    122820
     ttgtcggcgg ggcggtccag gacgcggtcg agttcatcct cggtctcggg ggattcgaac    122880
     acgggctgga cgtcgatctt aggcgaggct ttgccgagga cggggctggc gacgacgtgc    122940
     tcacgaacat cagcgagctt gccgacaatg gcagcagtgg cagccatggc gggtgacatg    123000
     aggtgtgtac gaccctgggc accctggcga ccctcgaagt tgcggttgga ggtactagcg    123060
     cagcgctcct tgggagacag gatatccggg ttcataccca ggcacataga gcagccagcc    123120
     tcacgccatt cgaaaccggc atcagtgaag accttgtcga gaccctcgga ctcagcctgc    123180
     tccttgacga gacccgatcc agggacaatc atagcacgct tgatgttgga ggcaaccttg    123240
     cggccgttga ccaccttggc cgcggcacgc aaatcctcga tacgggcgtt ggtgcaagat    123300
     ccaatgaaga ccttgtcaac cacaacatcc ttcatgggtg taccagacac aagacccata    123360
     tactcgagag cccgcttgca agaggccttg cggttctcat cctcgaagtc atcggggctg    123420
     gggacaacgc cagtgatcgg gaccacgtcc tggggagagg taccccatga gatggtggga    123480
     atgatatcct tgccatcaat aaagacctcg ctatcgtact tggccccagc gtcagacttc    123540
     aggctggacc agtagctggt ggccttgttc cactctgcgc tgccgtactt gggagccaga    123600
     ggacgaccct tgaggtattc gaaggtgatc tcgtcgggcg caatcatacc ggcacgcgca    123660
     ccaccctcaa tagacatgtt gcacattgac atacgggcct ccatgctcag tccacggatg    123720
     acagatccgc agaactcaat aacagcacca ttaccaccag cggtaccgat aacaccgatg    123780
     atgtggagaa cgacgtcctt actagtgacg ccagcaggga gctcgccatc aacctggatg    123840
     cgcatgttct tgctgcggcg ggtaatgagt gtctgggttg cgagcacgtg ctcaacttca    123900
     ctggttccaa taccgaacgc gagggcaccg aaagcgccgt gtgtggaagt gtggctgtca    123960
     ccgcagacga cagttgtgcc gggaagagtg aaaccctgct ccgggccgat aatgtggaca    124020
     ataccctgac gcttgtcgcc cataccgaaa taggtgagcc caaagtcctt cacgttctcc    124080
     tccagggttg tgcattggag acgcgaatca ttctccttga tgaagtcggc ggcatttttg    124140
     aagttttttc gtgaagaggt gggaatgttc tatccgaaga aaacgggctt caattagtca    124200
     gggcttccaa taaacacggg attgaacata cgtgatcaac tgtagccagg gtgcagtccg    124260
     gccggcggac ctggcggctg gcatttttga ggccctcgaa agcttgggga gatgtaacct    124320
     cgtgaacaag gtgtcggtca atgtagatca agcaagtgcc atcttcttgc tcattgacga    124380
     tgtggtcctg gaagaccttg tcatacaagg tcttgggtcc tgactcggcg gaaggcatgg    124440
     tggggggata gaaaagatta agagcagcgg tgaatagagg atatgagggt acaatgtttg    124500
     aagatgatga gaaaggggga gataataggc gggagcccca atgaagagca atatagtata    124560
     tagtaaaata ccgagaacct ggggaactgg aattggaatg actgttatat ttttctgctc    124620
     tgaagcatcc gcgatgtcgc tggagagctt ctcgaggggc aatgccgatt tcggccggtc    124680
     agcggcgaat ggtagcaatt ttattggccg aagtggcaac acaagggacg accgatatcg    124740
     gtcggcgctg gttgatccaa aaagggggaa cgcggctaac ctcgcttggc ggcggacact    124800
     cgtagacccg ctccggacca ggtaattaaa atgcgcttat tggctgttac ttccaaggtt    124860
     ccgcctccga tcggcccgcc attttttgac tcaacgctta tacgcttagc actgcgaaca    124920
     cggcatgatg gcatagtgga tatggtgatc tggggaaacc atcaagtata cccctgatgt    124980
     tatattggaa aggagatgca tacattgacc gctgccaatc attccacaat acaacccccc    125040
     ggggggtatc agacgctttc acatgttctt cgcaaagaac tgccatattt tgaacttgtt    125100
     tcatggtcta atttaatcta ccgaaagtca gataccaaac gccaatgccc gtgtctcctg    125160
     aagcaaaatt tcataaagtg tcggaagaat ccacggaacc tcgtcggcta ccgaggcaaa    125220
     gagcccagat caaccacgat cctctttcct gacactgaac cactccgcaa cgtctcgagc    125280
     gccgcattta taccctctaa cccaccttct gcatggacaa tctctggcaa tgtaagattc    125340
     gtcgattgca gaagatcttc caaccagcat accattgctt cacccaccgc aggagcagta    125400
     tggaagagct taatgggcac agtgtgatat tgtacccccg ggttcctctg tttaggaagc    125460
     ccggttaatc caagaagatg agcatggcca tcgggattaa gagccttttc aagctgtgtt    125520
     gctgtgtctc ttccgaccat atcgatggca tatcgcagct tgcctccggt gacaccgcga    125580
     ataatttcca ccgcacgatc aggatcatgt cgatcgacta gcagatctgc accggactgc    125640
     acaagcttag cgccatgccg tgctgcatcc gctacgcaaa tcacgcgtaa cctggcgagt    125700
     ttggccagtt gaagagttat cagacccgta gttgtcgagg ctgtaataag gatgtcagtg    125760
     gtcggatcgt agtactggag acattgggta tcttacctcc ccagatagca acccagtctc    125820
     cacgttgtgg cttttctgag tccaataatg acgcgaagca ttcttcatgg atgtcggtgg    125880
     gtatatcagt tcggtcaagt cttttgatga tattgggcaa attaggaccg ggggcttgtg    125940
     agatgaggga gaagtctagg ccaaatgaga cgcccaaagc cagcacagcg gcaacgaatg    126000
     cgactccaac agaagccgaa gcatggatag atgttgaaga aggaattcgg gcagcattga    126060
     agtcgttagc aatggcgtat tcttggaatg ctgctttcct aatatcccgg taatccgttg    126120
     atggaaccag cacgacgtcg cctacacgaa gacgtgatgg ccctttgggg acgtgtaata    126180
     caaggccagc cagatcacgc ccgttgatcc atggcaggct ggggatacca aagttgaatg    126240
     ccctaatcga ttcaccggtt agttgttgac tatagttcgg gggtgctggt gtccagctgt    126300
     agaatagcaa tacttacggt cccttccagt cgataggatt gaggccgact gcgaggacct    126360
     gcgaatcaag aattagcacc tcgtgttata caagatccag tcggcgggga cacgtcatac    126420
     cttgacaagg atctctccct cgtgcaaaac agaaggaatg gcatggtcat ctactaatgc    126480
     gtactgttct cgggccccct tgagaagcaa gactctttgc cttgacttct cagaccgtgg    126540
     tgacgggggt tcactctcag accttgactc attagagtaa tctgagatag actccgaaaa    126600
     caggttctgg tggaaggtag tcggggtctt ctgcaacttt tcgagttgga ggcaagtaga    126660
     ggtagtcgac atgatgcttg aaggtagtaa tggcatgact tgaagctgga tcacagagaa    126720
     acgccaatcc aactaggctc tatctatatt gcccttggta ccagtctata tgatctctcg    126780
     gacgagaaga taaagccaaa gcacgcctca ttttagggcg cggggcagtg ataccaatcc    126840
     ctcccatgat cacgtaccta gggctggagc acctccacac aacgcttggc tctggggctt    126900
     cctagcaaga tcaatgggat aatttcgtct cacatttgcg caataagagc gtttccgtac    126960
     ttccgaggcc tgctcatagt cattatccat tgctcatcgc ggggcatgaa tggcgtgata    127020
     aactgaaaga ccgagggtcg atcaacgctc ttatatttgt cgaaagatag agagggctat    127080
     gaggattagg atgattcaag gaaagtgata taagtctgat tagctatatg taccgaatat    127140
     tccaatagaa aaccgaatat tttctgctct cttgaagtcc gaaattgaaa tttgactccc    127200
     agaatcccaa attctcaagt tcgcctccaa actgatgtga tcccgggttg agatgacgaa    127260
     actgcttagg attttcacta ctccctgaat catgaatgtc tggaagtgac gataatcgaa    127320
     aatatggact aatttgttct ccttgaatta ttaaccgact ggaattgttc aatactactg    127380
     gtccggaaat atatatcgga tttgctatag cgactgtaaa acaaagcaca tcttttatag    127440
     tataaatgct tagtacaact tgagctccta atatcattgg aacacaagag tattccgagt    127500
     ctactccaca tatattgtat agaatacaat tctggggttc ctagtgtgtc tccatgttcc    127560
     catccatccg attcctcaga acccccttga gaattcacaa tccacttggt tatatattca    127620
     ttgacgagcc tctttctcag tagatctgag cattttaaca gtttttcaat tcggagtatt    127680
     tgcctatagg atctgtgccg cctcctgaaa gttccgtgcg agcacgtaat tccaccacag    127740
     aacgacaaca ttaagtgagt gtcaaggcta gatccctttg aagctagaca gaaggtctgg    127800
     aataccacaa accaataaat tctttccgat attaccgtcg tggacaaatc tttcgaggca    127860
     gtacggagta cagccgacca cttttgatat ggagtataga tctcgcgcag acgctctggt    127920
     tataaaacac cccaacgcca gtcaaaaatg actcgactcc ccaataaccc actccgactt    127980
     attatgacaa accctgaaaa agacgttgcg ccaagtgacg tggtgaccag tgcggattcc    128040
     ttcaattcgc cgcttggtgg gccacgtaaa ggtgagcttg caatacctat tcttgttcaa    128100
     agtcgacgga gctgactgtt accctggaag tcaaatggta ccgttcgacg ttttacaatg    128160
     cccttattct cggcatttgc aactttcttg cccccggaat ttggggcgcc atgaactctt    128220
     tgggtggagg aggcgaagag gaaccctatc tcgtcaacgc agcgaacgcc ttgaccttcg    128280
     ggcttatggt agtgtcttgc ttctttggta gtgttatcgt gcgatttatc ggcatcaaat    128340
     ggacacttat cgtgggaaca atgggatacg caccttacgc agcagggcta tatacaaaca    128400
     atcgatttga tcaagaatgg ctggttatcc tgggcgcggc actttgcggc atgtcagcag    128460
     gcatcttttg gatggcagag gcagcaatcg cactttcata tcccgagcca tacaaccaag    128520
     gacgcttctt ggggttctgg ctcagcttcc gagttggagg acaaatactc ggtggtgtca    128580
     tcagtctcgg cgtcaatgct catcgatcga cctcgggctc tatttcatac actgtgtacc    128640
     tgatttttat tgcgctacaa gcacttggcc ctttcgctgg tctgcttttg aacaatccat    128700
     ctcaggtaca gcgaaaagac gggatccctg ttcaacttca ggtggcgaat agcatcggat    128760
     acgagatgaa gagtatgtcg aagctttgga tcagtcgcaa attcctgtac atcattccat    128820
     ttatttgcca ggctgtttat acagaggctg tgatgttttc gtacgagggg ttgtggttct    128880
     cagtacgggc cagagctctc gggtcattcc tttccggtgt gattgctttg atcatcggca    128940
     accttctagg agccttcctt gacaccaagc ggatatcact gaaaaagaga agtcgatacg    129000
     catttttgtt agtcgtcggc tggcaaggca tgtgctggat ctgggcttca gtgttgacaa    129060
     cggagttcaa caagacaaac ccgatatatg actggactga cccaggtttt ggaagagcct    129120
     tcgtcctctt cctgttctgg gttgctggct tccagctcaa ctatatgtat ctgtaagttg    129180
     gtcttcgctg ggtgacggct cggttgggat tatgctgatt gaccaggttt ttcttggtgg    129240
     gcaaccttgc ggatgatcaa gaagaggtcg tccggattgc gggcttgttg cgtgggactg    129300
     aatccgccgc ccagtgtgtc agcgtacgta cacctctcga ctcgcttctg tatagcatga    129360
     atactaacgg ggtatctcca gtatggccta agtagcgtga acatcatggc cgcggtgggt    129420
     agtatatacc tcaacttcgg cctgtgggct atcgcgatat tccctgcctg gctcattgtt    129480
     aaagaggtgg gagaagcttt tggggataaa aagatcgcta gagagactcc tggtttgcgt    129540
     gggaccttgg atcaggagtg aatggataga ggaagcgact acctaggtaa atgttggcgc    129600
     aaatctctga gagaattggt ccggcgcaag gatatttaat ttaaatctgg ggtagacccc    129660
     cttgtccgtg ttgaaaatgg tatacgttga aaaggttatg actctatgat tggcttgtgc    129720
     ccaggattct cgcagaccag aagactttta aagctatgcg atgaaaccga attccctatt    129780
     atcatggtgg aacacgagca atgcgagacg atgccgtacg aacaaaccga tcattccgca    129840
     gacagtttgc actgcaacca tgtgccacgc cagttggtct tctcgcatcg gacccatcca    129900
     caccagccaa agattcaaaa tagtgagatt acttgattca gtaattcgac cattttcgtc    129960
     ttgggtgatc cgcaccagtc ccaaagtgtg taataggcgc agtgcggtat caatcaaagg    130020
     tgacgggggg ctcgtccact ccgtgacaga agcgtccagc aacccagtgg aagcactgaa    130080
     ctttggcagt cgatggcgag gacaaggaat gagtttgaag agctgcgggg tcgagtacag    130140
     aaaattgaaa atctgcggaa tgaacagtag cagcagcgtt ttgctgaaat gcccaaggat    130200
     accaaccacg gcgaacacca tacctgcgaa atagcagtac gtatcaccca cgaacacctt    130260
     cgacggatac cagttatgga acagaagggc tgctgataca ccaatgaatg gaagcagaaa    130320
     gtatatcgac aacaagtgcg agtcggtggc agggtgcggg tatggtgtca taggtgcaag    130380
     gtacattgca tcattgaata gcaattgaat cgcaatcacc agtgactgag cgacctcgat    130440
     accgttaata cctgccaaca tgttgatcgc gtttggacag aagattgaca ccgctgccat    130500
     gtacatgtag tacagccatc caagatcaac aatgtcacct aggtagggtt gcagcggcac    130560
     cggcacgaca acttgggtga cgccaaagtc aacaaagtac acaatgagca tcggaattgc    130620
     ggagaaagca ggtatcagga ctttgtgcct ccagcgaatg tcgaacaggt catcaccgat    130680
     cccgagaatc acgactgatt gcaaagacaa gagaccagaa aggtaagaag caagctatcc    130740
     aattgtatgt tagtttgagg ccagcatcag caaatgtaaa atcagaaccc acctttccgt    130800
     gcggaaatcg atgaaggaat cggccgttct caatatgttg cgattcaatc acgacgtcac    130860
     ggtttccgcc gccggatgtg gctgcgacaa tatccttgta gaaggcgaac ggaataaaca    130920
     tgatgagcga catcagatat acaacagcgc agacagcgcc catggtttca ggtctagacc    130980
     ccaaatatta gtacatgctg tgatcacaag ttcaagagcc gtatacatac atctcggggc    131040
     ggctaggctt tgccatatct tttcccttaa gtcctgcttt aataaatgca ggccccagcc    131100
     accgaaccag gctaaaagcc accgcaaaca ctatgccaca cagtgcaatt gaagccacta    131160
     aaggcgctcc atcaccttgg aacgtggcgt tgagtatcgc taaaccggcc cccacgaggg    131220
     ccagtagacg ccaagtctcc ttacgggaga gggtgtttga ggtatgcatg gcggacatgc    131280
     gacccaggtg gcaggaacga tgtccctttg ttgcaaagag aaattcacaa ggaaccgacc    131340
     tatgcaacaa gaggaaaagt ccacgtcggc gacgcgcaat ctgtcttcat tctccaaata    131400
     ctcgataagc ttatcgagtt ctgccagacc tatctgaccg ctaaatttgg cggtgagagt    131460
     gtatcccgtc gaccaataaa ggtaaggcga cgtcaaccac ctgtttcata ccacatgcgt    131520
     gcagatgcat aaaatttaaa tcgacattgg cccagctgtc taattcgtca atctcacagc    131580
     ccagtccgct tcgatggggg cagtggagcg ccccgagata tcggcgggat ttgccgactt    131640
     tgacgctggc catcgggatc tggtcactgt caccagattt aacttctatg gcaaccgtat    131700
     tgtcaccgct tcttctgatc accgcatgaa agtttgggat ctcaaggatg gccaatggca    131760
     actggtagat acctggcgcg cccacgatgc tgagatacgc gatgtatgtc cccaaacaag    131820
     ccagggcgca attctaaggc taccattgcg gctcatgtac taaactgcta tatcaggcca    131880
     catggaatgg tcctttcaca ggccaacata ttggcagtgt tggagaggac atgaagttga    131940
     aaatttggca agaagatgta acccaaccac caaactcagg acggcgtttc aaatcggtct    132000
     ttcgcatgac cgcaccccaa agacatccat ttgtatcact tgacttccgc aacattgacc    132060
     tggagtcatg gctggccgcg ataacacgcg atggctatct catggttatg gaacccgtca    132120
     gccccgatag ccttgcagat tggcagcctg ttgaccagtt ccgagtgtgt accgccccgg    132180
     aacgcgggga ggaaacaagt ttcaaagtcc agtttcacca tgatcctacc gatatcactc    132240
     acactgtctt accggattct gatcggaaga gcctgtcgct agttgtggct gccatggaca    132300
     ccgtcaaggt ctatcgcact gatgcaaacc gacgattcta ccatgcaatt gaactgaatg    132360
     gtcacggtgg tcttgtgaga gacatttcct gggcaaatgg ttctgttcgt ggttacgatc    132420
     ttattgcgag cggcggcaag gatggtctgg tccgcatctt tgaagtgtac acgatgccag    132480
     ctggccaagc acagaactct aacggccgga aggcggacct tcgcatgcag tcacagtccc    132540
     agtcccagtc ccagtcacca tcactccgag cgacatcgca gtccgggatc ggttctgccc    132600
     tcgcaagccg tgtgcctgcg tcggtgactg atcgccaagc caacggggaa tcccaatttc    132660
     ggcactcgtt caaacaggtg gcttgcattg atactaaaca cctcgatgtg tggcaggttc    132720
     aattctcctt ttctggtaag tgttccttcg ttgtatctac aaccctaagc ctttttcgct    132780
     aatccactgt taggtgactc gttgatctcc tccggggacg atggggcagt tcggttctgg    132840
     aaaagatctt tgtctggcga atggctcgag ttcgccgaaa cagacatggc ttctcagtga    132900
     tcttatcctt ccaagcactg cgagacatgg aaaattattg cagagtgccc aatacttgtc    132960
     tcttcccacc ctcacccctt ttattttcct tcacaaacaa tgataccctt tacatttgat    133020
     ttctgcatac tcctgtgttc tcactgtgta cctaggtagt atctctggaa ctaattagtc    133080
     gaattcaagg ttgctatttc tgttttagtc tcgaactatc cccattacac aaggaaagaa    133140
     cgatttggag atgccgtggt tggttccctg acaccctgac aattttcttc tcaagccgta    133200
     accactctca accttctacc ctcatcacct aaaatcactt cattatctat atttattgtt    133260
     aattcaccat ggctatcggt cccaccattg gcactggcct gttcatcggc gctggccagg    133320
     cgctcgcggt tggtggacct gcctcgctac tcctgtcgta catcatccta tccattctga    133380
     cctttgccat gaccacgagc gtggccgaag tatccactca cttgccatcg ccacatggca    133440
     cactagtcac caatggctac aagtacatgt caaaaagtct ggcatttgct tcagcatacc    133500
     ttcgctggta caccctcgct ttattcgtcc catacgaaat cacatcggcg atggtcaacc    133560
     ttggcctgtg gaagccgggt tctacgatcg caatcagact ggttatcatc acgaccatcg    133620
     tcgtcggatg caatttcctg ccggaaagaa tcttcaagag ctccgagcga ttgttcactg    133680
     cgatcaagat cggcacaatc gcgaccctct tcgtcctctc tctggctctg ggtcttgggg    133740
     gtgtggatac gcagccctcg tggggattca aatactggaa acacccaggg gcgatgaacg    133800
     agtatctagt ccgaggtgta tcgggacggt tcttggcttt cttccaatgt cttctcgacg    133860
     gctccatcgc cttcgcgttt gcccccgagc tgattgtgca ccacgcggaa atgccagcat    133920
     cacttatgcc gtcaattggt gaatcagcga ttctaggcgc cggcatccca ggtgtagtca    133980
     aagctgacgt tgctcaaacg gcatttccgt atatcctgag ctccttggcc atgggagtta    134040
     tggctccttc caatgacaca cgtctgacaa acaacggaac gggctccggg ttttctcctt    134100
     accttatcgg gctcaaagac gcaaagattc aagttgtacc tacgatcgcg atggtcgcaa    134160
     tcctgctctc cgcggtggct tctggacgat cctttttgta tctctcttct cgcacacttt    134220
     gtgcaatgtc ggagctcggc catgcgccct cggcattttc tacccgcaac cgtggacatg    134280
     tgccatattt ggccgttgtg gcatctgcct tgttctcctg tcttgccttt gtttcagtga    134340
     agatcccgag tacgatcatg cacacgtatc tccttcgtct ggtcacgagc gcctgtttta    134400
     tctccacgct tgtgtcatgc gccatctata ttcgcttcaa tcgacaactc agagcgaagg    134460
     gagtcactaa gcggtatagt ttctctgtac agccatttgc cacatacttc gggatggcca    134520
     ttagtaccct actgctgctg ggcggcgggt tgtgggcagg ccccaagaga aacctgacgt    134580
     cccgagcaac cagattgatc atcgcatatg tcaatatcgg tgtattcagc ctgctgtact    134640
     tattccgtcg attccaagag tttgcgcccg ttgccgaaat tgaaaggcaa atggatatgg    134700
     gtggacgcag ccatggcgac cgtgcaggac caagagaacc tcggacacag aagacgaacc    134760
     cgcatcgggg tgaagtcgat gtaatcccgg aggcttcagg ggcgtttgaa ttgcgagcca    134820
     gccaggctac gttcagggag cagtgagtgt caagataata tgcaaatggc gaggaacgtg    134880
     gattgtataa gaatggatgg aatcggctag gagtcagcgt ggttattatt gattacatgt    134940
     aattatttgt ttcgaattca agttttctgt ttcttgcgta acccgagaag aaccagtaag    135000
     gtgatttgca aattgtatag tagacatcca cgaagagaaa gaggagaaat acccaataat    135060
     acagtaacat ttcatgacat ttcatatata ttgtatcgaa accgggacaa tgtgaacatt    135120
     tgaatccaaa tgggggtttt gtattatttt tctttgttct tttgtggcaa aagcgcaaat    135180
     cacaaatcat atcggaatct ttaacaacct tggaagcccc tttaacctct ttggaacctt    135240
     tccaacttct tttcccttct ctcttcaatg ttcccatcac actttacagt ataatgcctg    135300
     aaaccttgtc gtacaagaac agatgacccc tttgcccctc tttgaaacag tattcgtctt    135360
     ctatctctcc caagcatttt cccgtgtttt ccccatgtta cttttttact ttgcttcttc    135420
     aactttctta tattcccctg gatacatttt tgtccacccg aacccctctc atttgaacct    135480
     ctaatacttc ccttcccgta ggtagcccat atcgcctttt tctttctccc cttgcattct    135540
     cacggattcc tttcccgagc cgagttcgta ggaattcctt tgtcctccct caggaaaatc    135600
     ccccgctgtc tgagaggttt taatggacca gatcacaaag ccttctggca cattcaagat    135660
     ctataccatt tttggggtct tgttcacttt gcagagatat ctcgctttac ggcacgccat    135720
     gtctgggttt cgttataacc cggtggaagg gtcaatagga ctgccccgtc gattgatatt    135780
     cgactgaggg tagatctatt cttgatgttt tttttttttt ttttttttac ttctttttgc    135840
     tttcatatca gtttcctact cacccatcta gatgctaacc cgccccattg attacctcca    135900
     ggatgcctag ggcatccaat gacattcccg tgactttctc cactgcgttg aatgagacta    135960
     gtcctgatag ggactagtgt attccatggc ttgctgagaa cagtcggttt tgcagattac    136020
     caaattacca taccggtaaa ccttggaatt ttcaaaactg acattgaatc ttgtccaggt    136080
     gtctctgatc aaaatgaaaa accaggaaag agaagaggcg gagacctcgc ccgtgaatgg    136140
     ctgctttcgg gtcgagtcac tcttccctcg ctgaacttcc caggtctcaa ccttggaact    136200
     cctttcaaag ccccctacgc acttggtctc tctgcctacc cggacggccc attctctgcc    136260
     ttaggccccc gtagcctcct ccttccctct gtctccagtt cctcaaactc gctctcttct    136320
     ttttcctctc ctttccccta ccctcttttc ttcgcgcctt tcttcctttc ttccttcctt    136380
     tctctccttt tcaacctttc gcgccgacct ctttaatctc ttcccgatta tcgattctcc    136440
     gacttccttt cccccccctt tcgcttcctt gtgaccgcac cctcttcgac tttccaacgc    136500
     gtccttgtcc aaccagacga gattggaaaa ctacacgact acgaggaaaa ttgatatgcg    136560
     acttgaacag tgacagcctg gctacgcctc tgtcgagaaa acatcatttt gtcttcgcct    136620
     gagagggggt tatctgtcgg cgatgacaga tacctcctcc ctcgccatca cgcacgccac    136680
     aacggattcc tatccggtcc acgcccatcg cgggtcccct gccgccatcg acggcgccgc    136740
     ctctgactcc ggcgcacccg atgaagaacc ttacaccatc aagtgcattt gctcgttcga    136800
     tgaagatgat ggcaacacgg tcttctgtga agggtgcgag acatggcagc acattctctg    136860
     ctactatcca gacaagaaag taccagatgt gcacaactgt gtcgactgcg agccacggcc    136920
     ccttgacaat cgccgtgccc acgaacgaca acggcagcgg cggatccggg agaaaagcga    136980
     ggacggtgac cggaaatcaa gacgatctgg ccccaaaaca caaaagcgaa agtctaacga    137040
     tgccgaggtg aacgcctttg gtcacggacg acatgactcg ggttcccgtg agcagccacc    137100
     gtccaagaaa gcaaaagtgt ctcgccgccc atcaacttca ataagtggta tttcggttcc    137160
     tggtcagtcg gctgaatcgc aaaatcgtcg atcctccacc tcggttgcga tgagcccgac    137220
     aaccatccct ggccctccca tccctcatta ttcggacgaa tttctctctc tttacgaccg    137280
     cgatgatcaa tttattgaat cgaagagcat cctcaattac ggcgtggatt tcgtcaatga    137340
     aattgttgcc tggctgaagg acccacagat cttggcgcga gttaccgatg gactcagtgt    137400
     tgaagacttc gccaaacggt ccgaagaggc tatggatcgg tctcgctggc cctcgttgac    137460
     aacagagacc atcacggact cgaccattga gatcggtggt aaacacccag ttcacaagat    137520
     cttgaaaaca caggatccag tccgaaagga cgatgttgtc ggtgaaatct ttggccaatt    137580
     aggtcacgtc aaggattaca aaaagctcga cagcaaccga tgggaggaat tggggcacgc    137640
     catgcctttc gtgttcttta accggcagtt ggacttgtac atcgacagtc gtcaggaagg    137700
     gaacgagctc cggcacgtca ggcggtcatg tgaggccaac gttaacttga aaatctacat    137760
     caccaatggc cggcagtacc atttctgttt cgttgctaaa agagacattc ctgcaaactc    137820
     ggaaattacc acgatgtggt attttgatga ctctttcttt ccttccgaca cgacagtgaa    137880
     ggaggagttc aaggacagag tggtggatcc gaaggacgcc gctatttgca ttagcaccac    137940
     attggcgaac ttcggtggtt gtgcttgtgg aaacccgcaa acttgtgtac tgaacaagct    138000
     tgatcgacgc gccaagcctc ctgccaacaa acgcccaaag tcgaaggtga agggcaaggg    138060
     caagaagcca aaacccctcg gtatccatga catcggtcgc gccggcagcg acaccaaaca    138120
     ttctgacgag catgatccgc cagccgacac ccgatcaaat tccggttccg ctcgtggtag    138180
     acatactggc agtcgcgatc tcagccccac ggctttgcag ctaacactgc cggcgctctc    138240
     cagtcgcgaa aggcgcaaga tagcggatgc cgaaaagcag ttccaacagc tagagcagct    138300
     taaaaccgtc aatcccaaaa ggaaaaagcg ttctagtggc catccgagac ggtccaccct    138360
     tgcaacagtc tcaagctcaa ctcaaactgg tgatggcttc aaaccttatc acgagcctgg    138420
     cgtgactcgg tcctctgaga tggcaggaca atcgccccag cttcaagttg cctatgtcga    138480
     cgctcaaact gaactttacg ctgacgatgt tgcgcgctcc ttcttgcgtg cagaacgcct    138540
     gaggcgagga tacaaactcg acatgatcca tccaacactt atgcttaaga ttcggtggtg    138600
     cgcgggacac cacatcgcag aggactgggc tcagcgaaat gcatgggagt ccggcgactt    138660
     gagcgtggtg ccatctggag tcctcccctg gtggtacggt tggttcccgc ttccaatcga    138720
     cgacaggcct catatcgagt tgctccagga agactcggac agaatgggaa tacctgctga    138780
     tcacggcccc cttgcgatgc cccctcggtg gtctttccac cagtccaagt atccccagcc    138840
     tgaatacaag taccatggta ttgcgatccg aggaatgcat tatgaccttc cagcgcgacc    138900
     taaccaaggt gacgttgata cccggagcgc catgtcgtac agactggaat cctcggcgtc    138960
     tggacctagc agtgatttgc tcaagccggc agttccgcct tattggccat ccactgcagc    139020
     acataccttc agaatgcctg gagctggcaa tcgtggtaat ttacatgttt ccatgccacc    139080
     accaagggcc tcgaatatcc cgtcagcgct tagtcccggt tctatgtcga cagggagtct    139140
     tgcatcgcct agttctcacg acacagcttc gccaatttct ctcatgccaa cttctggttc    139200
     tgcactcgca gccacacccg ccaagaagaa actcagtctt ggtgattatc tgattcgacg    139260
     tggcactatg gcgaccactc caacttcaga accagctcct cctgcctcgg ctcctcctcc    139320
     tccccctccc ccagctcccc cagctcctgc tcctactact cctgctccgc ctcctggtga    139380
     ttctcgtcta cgtacccaac attttctggc catcacaacg gtgtttggtg ataatcatga    139440
     acctccccac aagaccgaac ctggaggtga caagaatgag ccttctgact ctccagatat    139500
     ctctatggag gacgcaccgg agacgacacc caccaaaaac ccgtctatcc cttcgtaata    139560
     cgaccatccg cgtggcagta atggtgggcc tgtgataaaa ggaaaattcc gccgtggatt    139620
     taacgtttct tacgacccaa aatttctttt ctcgtgtgat ttcatttcga taccttacag    139680
     cgaggcggca caggcgttcg gactactttc aacctcttct ttttttctca ttttgttttc    139740
     tgtgccggct tctttttttc cttccgactt ttcggactct ggatggcgta tggcgtggtt    139800
     tggaattggt tcttggttac gggaaatacc atttgggtca gggtctttga gaattgtgtc    139860
     tgcttgagat gcagcacttg atctttcacg atttgtccag tctaatgttg gatatgtatg    139920
     gcctcttatt gagacgctag atagcttgta cgaacaatgt aacttttcct gctttatcac    139980
     ttggtatatc tcgactatac atgctctatt ctctgatgtt cctttctgtg tcaaattgtg    140040
     ctaatgtcaa acacaggtta atacactttc tattcaatcg gaagtcaagc ttcaatttaa    140100
     tgcgagatga taggctgaag cacatgactc aagcatcgcg aggggaaatg cctcctcacg    140160
     cgacccgtcg tttccgccct tatatctctg atctcaatct acaactcata tgctatgctt    140220
     atgccatttt aaagcgaaat gaatgattct aatcaaagca tcgtgttaaa cgagattgat    140280
     cccggatcta cagaggtctc tgagatcgag cagcccacgc ttcctccagc agatggaggg    140340
     aaaggcgcat ggctgatgtt agcttcatgc tgcttcattc agataccagt ctggggtatg    140400
     ttgtgactga acaaaagctg catgtaaata ctaacggagc atctagggtt ctccactgtc    140460
     tttggtgtct ttcaagagta ctactcgaca catgacgtcc tacaggggag caagaataac    140520
     ctggcgactg tcggaactac ttctacagta tgcagaagag taaatgaggt ctgctttagt    140580
     caagtctaat actttaccct agggactcct ttatcttctc tcgcctatca cttttacgct    140640
     gctaacgaga tacccgcatc tacaatacta ttgtgcaccg gcaggcttgg ccataaccgt    140700
     ggtaggatct ctgttatcct cattctcggt gcaggtctgg catctgattg ccccccaagg    140760
     tgtcatgtgt gccattggga atgggctctt gttcagtccg tcttccttgt accttgacca    140820
     gtggttcttg cgccgaaagg gccttgctct tgggactatg tgggctgcaa aaagtattac    140880
     tggggttgcc ttgcctttca ttgccagtgc ttgtctgaat aggtttggct ccagtaatac    140940
     actgaaggct tggactgtcg ttacggtatg agccaactcc tttcctcgta ttttggtgta    141000
     gacgatgtgt cgtgggtttt ataccaaacc agaaggttgc caatgccaat gatcttcacg    141060
     ttctcaaact acggctgaca aaaatccgaa ttgccaatcc agctgttaac cactctcatg    141120
     gccttaccat tcatgaaacc ccgtatccca gtatcgccat ctgcttcagc ccgccgcttg    141180
     gatctgagct tcctaaaaca agccacattc tggatgctgc aaacggggaa tattatccag    141240
     agttttggat atttcttgcc gacaacgttc ctcccttctt attcgacaac gaccgtcgga    141300
     ctatcccaga acaccggtac aatgctggtc tcgttattta acgcaacatc tatctttggt    141360
     gggatagcac taggagcact ctgtgaccgc ttctccgtca caaacatcat gctgctatcg    141420
     tcagttggct cggcattatc agtgcttcta ttctggggta tggcgtcgtc aggctcggac    141480
     tcgtcacaga cagccattgc cctccttact atcttctcca tcacatatgg cttctttgcc    141540
     ggtgggttca gctctacctg gtctggggtg attacccaga tcaagcgtga ctcatcacca    141600
     tccctggaca ctggacttgt ctttggtctt cttgctggtg gacgggggat tggaaatgtt    141660
     atcagtgggc ctctcagtac agtgctgctt cagtcggggt ctttgagggg ttcgagtggt    141720
     ctgagtggca ataccggtta tgagactcag tatggaacgc tgattctttt cactggcatc    141780
     acggcctttt tcggtgcatg gagctggata tggcggtatg tcagccctac actggggtgt    141840
     ctccgttgat tgttcggaac aggcttggag tatatgagca gagactaagc agtgaaggtt    141900
     ggtgcatggg tagttaagga gtggatgaaa aatatcaagc gatgtgaata cagtgaaatg    141960
     gtatctatct ctttatgcaa ataatttatt caaacaattc cttgaagaat gtcaaaggtc    142020
     ggagttgaaa tggattggcg tcacgtgcag tctgcggagc ttcaactcca aatgcgcgtt    142080
     cttcaatccc agccccgaca actttcttac gtatacctac tgcaaccaag ggcccactgc    142140
     cctatttaca gcaatggcaa ctgaggctgc actccaagat cctctcctgt cgcttcgacg    142200
     tgcgattgcg tctggcaacc ttccaacgcc gacgacctcg tccgagccct ccgaccaacc    142260
     tgccaccgac gacctggcca aagccacaca tctctacttc acccaaccag ctcctcagac    142320
     aatcgctttg tcaaccccca cacgatttat ctcagcatct accaactccc ccgtcgacct    142380
     gcgcagtatc ctttttgcct ggcagaacaa agatgtcgct attcccgagt acatcgccaa    142440
     ggcgcaagaa ttcaacgaag ctttgaagca gcagacgaaa gagggtgcca aggaagaaag    142500
     tgtccagatt cttatcttcc tcgagcgcct tgatcttttc acctggttag agggtgcctc    142560
     cgacgacagc gaacatatca aacccctcga gggtgctgct gccgctgctg aggcggccgc    142620
     cgcggctgca ggtgttgcgc aggccgataa tgcggccgga attgccgccg gtgcaattgg    142680
     cggcgtcaca tccgtcccta gtggagctgc aggagccgcc caggctggaa ctcaactcgg    142740
     tcgcccacaa aagcaggtcg accctcgact acaggagatt tacaatgggg agcgcaagac    142800
     cggtgaccgc aacacagtac tgcggggaat caagccgaca gtgagttact ctatacagtg    142860
     atgcgataga ccttagcaag ctaatcccac actcccaagg atttctcaca tgtccgcaag    142920
     agcgccgaat tattcctcga ccgcaaccgc agtcggccag gccagccaaa cgccaaaccg    142980
     ggcatcaagg gctccatccc ggctccgtca gccggcctct cgatggcatc gcgcaagtcg    143040
     agctcctccc actcccgccc cgacccaatc atcctaatct caccctccgc ctcatccctc    143100
     atccgcatgt cgaacgtcaa atccttcctc gaggaaggca tctttgtacc cccggaccac    143160
     ccaacactct ccagtgccac agacgccaac ctcgtgaagc tcgagcgacc gctccgcctc    143220
     aacggggacg cctcgaaccc cgcgagcgca agctcccgtg ccggcggcaa gcccacccgc    143280
     ccaaccaagt tcatcgtcgt ggacggcacg accaacttca aacccgagta ctggaaccga    143340
     cttgtcgccg tctttactac cggccagacc tggcagttca agtcgtacaa gtggtcctcg    143400
     ccgccggagc tgttcaagca cgccaccggt gtgtatattg ggtggcgtgg tgaggatgtc    143460
     cctagccagg ttaagggctg gggtcgaggt gttgagactt ttgctgttga gcgttgggac    143520
     gagaagaatg gtgttcacgg tggtgggcgg tggcgggatc gtgaggtagt ggagggtatt    143580
     tggactgcta ttgaggaggg aatgagactt cgtggatggg ggaaataagt agacttttgc    143640
     ctctctattt cggtctcagt tccctttcct gtcatcttgt tctcgcaata ccctcgattt    143700
     cttaagaata tgatgaccat tggcattcaa ggcgcagttc taggcgttgt ggttgtcttt    143760
     tctttctgtt cctatcatgt tccgtgtatg tatccatttg gatgttcata gcaaagacat    143820
     tctaaagatc catggatgaa agattactcc atagaagata gccctaacta tctagtacaa    143880
     ctaaaacaca gatctgcata catttcttgg atctattgac ccttggaagg catgagaata    143940
     taagaccatg ttctttgcga ttctcgatta agaataatat gacatacaca agcagaccag    144000
     aactcactcg ctgtgccagg gtagaacgat gcagggaact cgacgggaaa aacgaatagg    144060
     aaacggaaat ggagacagaa agaaaagaca atggaatcat atgacatgct caaatgaaaa    144120
     tcaacaaaga aatgccggaa agatgagagt tgtatggaga atagagaaga gaaaaggaca    144180
     tgcaacgccg ggactgatgc tcaggaaaag aaaccctcca acctgtcatg ttttcaatgt    144240
     tttgtttttc tgtttttctg ttctgagtct tcccctttca accatttccc tctagagggg    144300
     agagatggaa gatgcgagga aataaaaagg aaacaaaagc aatgccatcc aaatattaca    144360
     aatattttcc agctccggcc ttctctataa catgagccat cgatcataac gtctttcgtt    144420
     cggagtgaga gaacctcgtg acgagtgaat taaaaaaaaa aaaaaaagaa aatgggaaaa    144480
     atggatatgg cagccaggca tgtcaagaga ctgcgactgg actgcatgcg gagagagtaa    144540
     agaacttcgt ggtcggaaac gatcgtgacg agattgatga aatcgggtct caaaggtcca    144600
     ccggatattt aggtcccctt tggtataggg tgagggggtt tccgtattgg ggccacaagc    144660
     atgactgcgg ggttgcagtg tggtcagatt cgacctgtgc cttcaaaggc gttcgaatgc    144720
     tgattgctgg actgcatgtg ttgaatgatt cgggctgtaa tgcaccgagg ggctcatgag    144780
     gagtcggaat cccagtgata cgattcatct tcgaatgggt tgcgggctac gtcaatgctt    144840
     gtgggcggtg gttgtcaggc gcgggcagaa cggctcatgc tgcgttctgg gattgagggc    144900
     ggacgagctg gcgtgggcga gtatgaacgc gagcctccca agatgtctac atcatgttct    144960
     tgtagaacga cagagtactt ggggtcgcgc aggaacttgg ggacagagtc gcttgacatc    145020
     agcttgaaca ccgaagtttg tgcaagctcg aataggtgca ccacttcttg gagactcttg    145080
     aacatggact cgtcgtctcc cacggccttg gtcatgcggc tggcgaggct gttgcggagc    145140
     gcgtggtcga tgttcagctc acacggtgag ccgggagcca aaaacgcgtt gtacagtcca    145200
     tatgctgcag ccaaagtttc ccgcaccgaa tcaaccttgt taaacgtacc gatcttctcg    145260
     gccttgtggt agttggtagt gaattccgag acatccaggt agaaagacag gttctcctca    145320
     cacagcgaat agcgaaggaa ttcacggaaa agcagacgca gagcgggatc ctgaagaata    145380
     tgggtcaatc gggcgttatt ggagtcgcgt ggcataccac gactgtcgta tgtcggcgca    145440
     acctcgcggg ttttctcgcg ggcgatccat ccacatacgc gctgtccacg ctcggtaatg    145500
     ccgtagatgg catacttgga aggctggaaa tgaacattgg tcccaacatc ggggaattgt    145560
     ttgtcgtctt gaatcatggt gatcaggccg tacttcagga acagctcgga gatcaagcag    145620
     gtctcccggc gctcaatagt agtcgaacaa tccatcaacc agtccaccgc ggcctttcca    145680
     gtgaacgtgt tactataaac ttttccatct agaagcttgc gctcccgagc caccttcaca    145740
     ccaacgaggc cgttggtgta atcactaagc gagtccgaat ccgaggttga aatgctgctc    145800
     ttgatgttcg ggccatcctg accagcaaag cgacggaaga taacctcaat cgtcgcacga    145860
     tcatgggaca acttgtcgct atccgtgtca cgctctaggt tcaccagctg catggtgttg    145920
     cggggcgact ctagcacatc catcacgtga cgagcggtga tgccattccg ctggcagaaa    145980
     cgctgcagga tgttgatacc cttcggagtg agctggaaga gagcgccctt gagcgggaag    146040
     atcaagagcg ctttgccgtc gacagattca atgaagcgcg catcgacaaa ccgctggcag    146100
     acggatcggg ccatttcctt ggccatggag aaagtggtgg tcgtggtggt cgtaactatg    146160
     cgggatgggt cctttggatc gggcatgcgg ttggactggg agaatttgag cgagcccagg    146220
     ttgttgatgg cctcttctga ggtgaaagtg tggtcatatc ttgtgaaacg gacgcggtgc    146280
     gaatccaact tcaagctgac catcaatgtg gagaacaagt ccatgaaatc ctgcgcaaat    146340
     cagcccaatt gttccaatgt ttccttggcc gttgccgttg aaacctacct tggtgaatgg    146400
     gcgctcatcc tccgtcatgc gcaataacct tgacgacgtc tggtgcattt tgggtgcggg    146460
     cggggaagag cgggtttcgt tggggagtgt aggaagacgc tgaatagtca agcgacgctt    146520
     tagaagcgaa gtgggaggat tgtcgaccaa ggccggagaa gaaggtcgcg aagttcccgt    146580
     caattgcacg taggtgtcgc cgtcgaatgg tggggtcaca ggggtttcgg agagcttatg    146640
     cggtttcgac aggctaccgt aggaagtcga ggaacgtagt gtacttccag acaaagtagc    146700
     gagagcgtat gtcttttgtg ctaaggcagc gaaagagcga cgattgcggg agatagtacc    146760
     gctaaaatca gaatcaggaa ctgaagggag agaatcttct cggctgtggc tcctagtttg    146820
     ggttggcatt gaatggtttt gagtcttcgg gttgaaccag agggagaaaa aaagtgggtt    146880
     atgccaaaca cctgataccg gaaaaaaaca tgggaatttt tgcaacaaaa aaaaaagaaa    146940
     aaaaaaaaag agaaatattt aagagtggac tggctagctc tcaaaaaggt aaaaaaaaaa    147000
     aaagggaaaa taggtaaggg aagagcaagg aaattataca atatgacaat gtcctattag    147060
     tatttttttt ggctctcttt tgttttttct tttttttttt ttttcaaatc aatttcaata    147120
     gaaaagaaaa ggaggagtag aagaaagatg ggtccaaagg gggggaaaga aagcgggatt    147180
     gaagggaaaa taagaaaata aattattttt aaaaataaga aagaggaaaa agaaaagaga    147240
     agaaaagagg gaaaagaaag gaaaaaaaaa aaaaagaaaa gaaaaaagat aaatccaaaa    147300
     gaaaaggaag accattcggc ctgtcagcct ttgatccaca gcccacgcgt gagccccgaa    147360
     agagtttggc ctgatgcatc caaacaacgt gggccatgaa gatcggtggg ttctggggtc    147420
     tggtattaca ataccatacc tgcatagtac ttgtcttcat ctttattaaa ataaaaaaaa    147480
     taaaatgcaa ggggaagact aaaggagact ctacatggct gggatatgtg aacaaccctg    147540
     gatactacgg agtatcgagg taatagtcca cagatagtcc taggaatact catagtttga    147600
     ataattccaa atcaatctat ggagtcaacc aaggaaagaa accattaatt taaataatgg    147660
     atccccaaaa tgatttcatt gacttttgtc gaagttccaa ggtcgaccga acagatccga    147720
     tcgtaatacg ggagtactgg taatacctgt acatatgtaa tctacgcatt cattgaaaca    147780
     ttttgttgca tacccaaccc gtttcattgt tgcccctgtc tgagtcgcta ctaccttact    147840
     gacttgggac tacttctttg tttttgaaca tctgcttcgg agtattaacg ggtgaatcca    147900
     gatctgaatc ttcagtgtgt tacctatcta tatgatatcc ctgattttgg tgtcttgaaa    147960
     tgatcctctc tacgcttcta tgaaattaat actacataga attccatttg gggtgtataa    148020
     gctgtgttcc gacaaaacag gtaatgatgt aaagcttgag cccacgtggg catccttaca    148080
     cttcccgaat tctaacgtta tgttgatatg ttgtattatc aaaataaaaa tctaccatgg    148140
     aagtcgtgtt aaccttatcg agtggcaaat cctaggagcc ttcaagatat gacggggctt    148200
     gtttgtgctt aacccaaata ttggcccact ccaaacccaa cgtggtcgga aatttgatca    148260
     gaaagttgtt atcggtccga actgttgccg aggagtgggc agtatttaca tatttacact    148320
     gtcgatacgg agtacggagg ggctatatgg aatagagaat cagaaacatc ctcatacact    148380
     gtgcatcaca tgtcgccatc ggaccaaaac ccccacttcc ctccgatcgc tcaatggtgg    148440
     ggcaattatg ttgtaggaac cttggaacgc ttttcacact tccttccctg tttcataacc    148500
     gaacactgcg agtgtttcgt ctcgtcgcta atcctaatgt ggtgttgtcg tatataggcc    148560
     tttgatcatg taaactacat atattgtaca gcttgtaaag gagacacaat taatctataa    148620
     tctgtttata caatctacac aaagttaaaa cgttcatagt ggggggaggg gtattccctt    148680
     ttggcgtgta acctgggaat atatcaaggc ggtcaataca atattaataa taatcctaac    148740
     ctctcaggct tccatggcga ttccaagcgt cttctttttc gtttgcataa cccatgtggt    148800
     cccacgtggg cacacgtgga cggagatgct tagcgtctga ccgccaaatc cgcttttact    148860
     gttttgcgcc tagagggagg cgcagtctcg ccaatctttc ccctgaatgt ctaaattacg    148920
     ggtcgcgctg aggagttatc gctaataaat tccatggttt taagccgtgg tttacactac    148980
     ctttcaacgg ttatggttcg tgtatcccgt ttcctagaga gcgggtttca acttcctccc    149040
     cgcctcgggt tttgcgagac ttggggtttt cccggcttga ggaaacccaa tcatatcaaa    149100
     aaggcccaat gttatatgtt gtagtgtcgt gtacggagta ccctccaagc tctggagatc    149160
     atgatcgtca attttgctaa tcatttcctc catggcttga aatacgaggt gaccaatgcg    149220
     cagcgataca ggggttggca atcccatttt ctccgcgatc gtggagacca acgtcagcga    149280
     cttcatgcta acggtcaaga cgagagcctc atcttacacc tgattcccga gacagcgcct    149340
     caacacgggg gcacaaaaac ggccccaagg atttcattta catgaaccag gctttcaatt    149400
     gagagtttcg gaaacgctac tcaatgccct gtctggatcg agctgtcaga cacgtcagca    149460
     aggccccttc cagagatagc gctaaccaag aaacagtgct agccaaccaa ccctcccgga    149520
     acaggtcacg cgaaacaacg atgcaagacg tcagtgcgag cttcatccgc cagttgccgg    149580
     gcttgcctag actagtaata ttctgcggat acgaattaca acataagtac ggagtacgga    149640
     cctatatctt aactaaaaaa atgaaaagag aaaagagaaa gagaaagagg aaaaaagggt    149700
     tggactccgc tcagacgcat ccagagagac agattaagca aagatactcg gtgataggat    149760
     aggataggat acaagattgg cttccccgca agagggcaga cagcgaaagt taaattggat    149820
     agcgcagatc gaagacattc tacatcacag aacaaaaaac cttggaagga gataagaaca    149880
     ttcgaataag cgacacgtca tatctacttc aaaactgttg agatctatcg tgctggatcg    149940
     atcacaacac gatcgaacgg tgccacgtgg ggacggaagc agagacatat gtgatgaagt    150000
     cgggggccaa aaaaagagtc ttccggtcgc aacctctcgg ctcagccctg tataagtaat    150060
     gccgatgtgg ctcaaattaa ggccggtttc aagaagtcta acaaagtaaa caattcaacc    150120
     ttggaaaggg tgggttagcg aataattcga tcacttcata gtcggagtac tccgtacttc    150180
     atatacattt ataaattact ttcaatacaa ttagtgtttg cacatcgggt ccattattgt    150240
     gagacgctaa actcgaagcg gatatgttgg agactcttag ggctatccct gtcggtctgt    150300
     tccgccgcac atgttcaagt ggattggaaa tccaaaattg aggcccgcta aaagattggc    150360
     tcgcggaggt tttcctgcta agtctaaagt tgcggtcaga cattcaacgg taagcagaga    150420
     gagactgaac cgaatgacac ttcagtgatc atcttgacgc aacaaagtat gtattgttgt    150480
     atctggtatt gcatgtaatt tatgccacat ggtactccgt acatatgtat gtattgcatc    150540
     cctggtggcc acgcgacaag ggattcatgc agacctgcat ttttcagggg taaagacacc    150600
     tctcatatgc atatacatgt acctaggtaa tataaatatg atgtggattt gcacaagata    150660
     cacgttctga cacgagtcat ggaaactcaa aataaccaca gagtctaacc ttggaaatca    150720
     aaaatacaaa agtactaatt cagctgccaa gactctaacc ctttcaggac aagttttgct    150780
     tccttcagta ccagggctgt ccctggatgt cgatcagtgc aaatggaaag cttatgtaca    150840
     ttagttttgg ggacatacct tgcctaaaag aatagaaggg atttccatgt atactttata    150900
     cacgtacttt cctacatatc acctccttgc ctattcgagg gtccctgcat gtagcaggtg    150960
     tacttacata ctccgaactg catggttgta cgcagatctc tccggaattt agggaaccaa    151020
     catccgagga ctagtttgct tttctgcagg aatgtggctt gagcgattgg gatttgaact    151080
     atgctctgat gctccctggg ctggccatgc taaactctaa acatctgata aaccctgggc    151140
     ccgggatggt tgctaggtga agtatttaca tttaggccag gccggggata gagaaaggcc    151200
     tagatgaatc tcggtcttcg ccttcgcgct accccttgat gtgcatccta tactaaagac    151260
     atctactccg tactccgtag atgttctaga tcgcaatctc gtctcaatca tcaattacag    151320
     gatcgatctt cgcttcagaa gccccatcag cggtccagat atagacacga caagaaatcc    151380
     cagacacgta tcacattgta gaggccggag ctatcgggag gtcgggaggt cgggagctac    151440
     gggtgtgggg gaagcatacg gagtagctga ggttgccacg tggaattccg gagaggtcga    151500
     caatttagac ctcgagcaca gatctgatca tcccctagtc acagaaggcc acgcctcagt    151560
     aagcaaggcg tctacctatc atggttggca taaccccgta ttgggaccat gtggcttgcg    151620
     cagcctttcc ttagtagttc agtcacatgc ccagtcctac tgggatgaca atcctgacaa    151680
     aggccatgcc ctgattgaca gaaactctcc ttgcgagact agcgaaaata ctagtggaat    151740
     cccgtgcacg cagcactttg cgaacagagc ctcatcggat ctgttgccta ttcagtggca    151800
     tgctggggga gatagtacat atgtatacat gtctaggcgc tgggcgccgc gctgacattt    151860
     atttttcttg aaattgtcgt caaatttatg gctcccatag tcccctggcc cctaaattag    151920
     aagactctta ctccgtagtc ttattttctt ttctcctctt cacagttttc acactgtcca    151980
     caatacaaca tattatgtct ctcatttatg atctcatcca cactctagat cttagcagga    152040
     acaattaagg catcagagac actatgggtg agcatctcta taccactatc agaacttcca    152100
     aggttctcgc catcccgctc gcccactacc gacaggccat aagaccttct catacttaac    152160
     cagatacata cgaccatagg gtgtggagaa cagggcttcc cgtccgctca gccgtactta    152220
     agccacacgc cggtgagtta gtagttgggt gggtgaccac cagcgaatcc tcactgttgt    152280
     atgtttttgt ttcgctattt tatcttgcaa tctgtctgcc ttgcctgcct tgtaacgaaa    152340
     acgtcactgc cgccttggtt atgaggttgt ttttggttgg atgtcccggg ccgaggggga    152400
     aagacgccta gagataagaa caccatgcat atatgtactc tatgtgctaa gctacaatat    152460
     ggtttaccta ggtagatcaa gtatgttccg ataacagtct cactgtgtac ttttggtttg    152520
     ctggacccaa atatcagtct cggacatccc gatcatttgc gaaggacttc gagcctttat    152580
     tcccatacac aaatgccaag attctaaatc tgcgggcata tacggagtac tcagaagata    152640
     agagaggatc ttcaatatcg cgaatttaag tttgttcacg caaatgagag ttgttaaagt    152700
     gcatatatag actcccgagg tccctacagg ccttttgtag taatgtccct tttgcccgtg    152760
     tgtattatag cggtatatta taccgctgag tgtataaaat acgagcaatt tgactgtacg    152820
     gagtacccgt ggactccact tgctgaaaac agatagtgca gatggagcgg agtagtgaat    152880
     cacgtcattg actttaaata agttttagac tatgaattgt tcaaccagac tttaaaagat    152940
     gccctgaatc atggagtgcc tttgtttgta gcccacacag gcccggccga acggggtttg    153000
     acggcgaact ccggtgtggc aaaagtccta gagacgctag aagtcttcta gaaggattct    153060
     ggaagacgct aagaaacctc gtttcggatt gttccatggt tcagcgggcc actatatgaa    153120
     tccctgtttc gtctatttcc ccctttctgt tgattaaggg gcaaatatct cgggaaaagg    153180
     tttgtctctg gtgttgattc tttgttgatt ttcccctgtt cctgaattct tattgatttc    153240
     ggaacacagc cgaagaggaa ggcttggcaa gtgtcaattg catgcccgca ctaaggattg    153300
     aacgtgtatg aaaccaatta ggtcactatc tattaacgag aatagtgttt tatataatac    153360
     aatttcataa tcagtactca cattggatct acttatatcc gatctacgat gtacgtaaga    153420
     ataaggccaa aaattagaaa gaaaaacctc cgatgaatgg ataccatacg atgtatccgt    153480
     actccataca aagtacaaca ttgtactccg tactccgtac tccgtatata cccaccaggc    153540
     aactccacct tcacggtaga cacggcagaa ggaagagcca cacgggaaca aaaggacctt    153600
     caagtccacg tggcagatcg gcaaaaacac cggtgatgga gagacagctg acttacatat    153660
     gcagctacag tcctaccagg ttagcccatg aaatactttg tactatccgg ttacctaaat    153720
     tatcgtaaaa atacacatat tcctttcttc cctttcatct tgggtctcac tttccaaaat    153780
     attatctgta tccgtatttg gagcatcttt ttagaagacc caacttcatt ctttttagga    153840
     agtcccgctc attgttcgga gacatatatg tacgtaacga agaaagtaag acgaataaac    153900
     aaaatatcat attgggcaac ttgaaatgac aatataacgt agagcaagca gatgtcaagc    153960
     gatcatcacc caaactaggc cttgttatcg gaccagtggg tttgaaaagt acagatttgc    154020
     aatccttggg agaaaggcag aattgtcaga ccgaagcatt ttactaaatc gatcacagaa    154080
     atccttcttc ttcttcttct tcttctcctc cgccgtaaac tccgaccctc ggtcgtgtat    154140
     acagcaagta cactcagcgg tacaatgccc gatacctttc ccatctttag cggataatcg    154200
     acttacttca ctgggtctag tgatctcata tcccttacta gattgtatgt taaaagctta    154260
     aactaacgat cagaactact ctaattggct cattctccga gtataatata tctgataata    154320
     atgtaagaag agagatgtaa gataaatgta aagagaaagt tatataagtg gttgaggaac    154380
     gagcatacta gtaacttaca taggtaggta catacataat gcatttacct ccaagacctc    154440
     cttccttcct cttctctccc tctaccttcc tttctcctag tttttgtatc actttcgcga    154500
     tcatggggat ggtcgtcttc tgtgcgaagg gacatgaaat aaagcaagtc cttctgactt    154560
     atgtatctta agcagttgct gatcagcaat tcttatagaa gaatgtctgt cgaacaggcg    154620
     agaactgttg ccgacgcgaa tttggcagcg cgagttgatg ccctttcagc atgtcaatac    154680
     accagaaccc ccggaatcta ctagcccagc caatagtctg tctacatgcg tcaagcgatc    154740
     taggttgcaa gatcagtttc gccgtctctt gctccccaat tcaacaagta tggaaacaca    154800
     gcgatgaaga taatttcaga gagctttcag agtctcaaga cttagtttgc ttcgggattc    154860
     tatgctttta gatcgcttgg ttcgcttttt tgctactttt catgtctgga ggcgttgtga    154920
     ctgttatcac ctatcattta ttaggaaagt cagttctcac atttcacacc tttttcacta    154980
     cctatattat gtatgttgcg gttaatcctt tttatctcta gcttaagcaa caaatgggag    155040
     agaacgttta ttacaagact cccacaaaga acatgacagc cataccggta tatcgacgcg    155100
     gtaaatgagt ggaattgcag ttgccgaagg catgaaactt atgaaactca tgaaactcac    155160
     taaatgactt gcatgggaag cttggctgtg gagcttccat gtccatgtgg ccctagagga    155220
     tgcagatcgg tctttgtttc atggtctatg atctattcga ttcgtactcc gtatgttacg    155280
     cagactatct gatatcgtga ctctggccta gtacggggtc gcttgcatgg tacggcagtt    155340
     ctgcaacttt catgcagatg accatgtcga gagtcatgca cctcgcaacg ggaaccgaag    155400
     ggttgtatgt ggtacttgag cagatttgag gcatctatag gtttacacca cacgtggtct    155460
     aatccaaagg tgaacgctat tatcgctggg acagacttgg tcatttacta ttcacacaac    155520
     tactctgtac ttccacctat atcagcccgt ttgacacaca ctaccacacg tcctgcacgt    155580
     ggggtagacg gaagttgtcc gattgataca gatcgtcgtc gaatgactcg agacaaccct    155640
     ccgatcaacg acgtttgtta atgcaatcga ccagactagc ttggacaaga catgcaagcc    155700
     aagaagcaag gcggaaaaaa aggctcttgt aaaaggacac tctacactct gcctcttctg    155760
     catctgcatc aaagcggggt tagagtgaag gaagatcctt gacattcact tttctccccg    155820
     aagtacattg cactccattt tattttattc tttcttttct ttcttctcta attgcttttg    155880
     ccagaatcca cacggaagcc tgcggcccgg tcgaaagcag attgttgtat gttgcatata    155940
     ttgcctatat tagccatctt aggtatatat aagaatatat aaataaacag ggaacaacac    156000
     gttgcacgaa aagctgcgtt attaacatgt ggtctagatt taccccctga aaccaagtct    156060
     cctatatttc tgtcacagtc atctggtcct tatcccaagg gctacaacat acataccccg    156120
     aaatggggtt atttcgggct accgcatggt caagtgcaca cctctgcacc acatggtcat    156180
     gtagccagaa gaatatctac agggtaacga ttcattgagc tctttaggat taggggatta    156240
     cacatgtcag agtcaatgcg agtgttgcag cattgtggag tcgactttct caacatcttt    156300
     tgcttttgac tccactacgc tcgttgtttc actggaagaa ataacatatt cttattttaa    156360
     ggatgtcatg ctattcccag ataatgaatc cacctaaata atccaaagcc tctcaatcat    156420
     atgcatttcc ctgcgttaac atccatatcg catggtaccc cagtgatcgg tgtcctgcat    156480
     gcagagtaat atgctcaaca caacttgcca ccagcccctc cctttaccat ttgtgggtaa    156540
     agacgtgaga attagacctg tcatttccaa cacatggcca catgcatatg ttgtatgtcg    156600
     aaatgccgcg tgtttggagg ggccaattag atagagcaca gaatgtcgat gtcgaagcac    156660
     gggatttgcg aatatatctt cctgaaatat atttaccgtt caaattgact gtgcgagtaa    156720
     ggggattcaa agaagcatca ccattaccat aattagagat acaaatacta gcgaaggatc    156780
     aacaattgcc tctctgaaag accagccata tttgaaatca cccatgttgt atgtacggga    156840
     atactccgta catgggatcc atctccaaat cccgatatcc actcttatat atgtaaccct    156900
     tgggacctac gcagatcatc aaatcctaat caaatgacct ccactcctat catctagctc    156960
     gagttatact tttatagtga taacagtggt attccgtacg taaaaccccg gagttcacca    157020
     ccagacgtac cccgtatcgg gaacatgcat ccaagcaagc ttccaaggtt ggaaagaaca    157080
     aggatgacgt gatgggatca ttctcaggga tggagatgat cggcagattt gaatggaggt    157140
     cagggtcagg taggtttggg aaatttgcca aaaagggagc cctggagccc tcctgggggg    157200
     tgcttgctaa gcattccgat gttttcctac ctaggtagct atatgtgtat ggtttgggat    157260
     atatccgata ccggacgctt gggttcgggg catatgtggg acttaaatcc cctagggctg    157320
     gcatgacatg tgtatctttt ttttttctct aacattccgg ggactgcttg tgcacgatat    157380
     atacgttacg tttggttgtt atgccggttt aattcttgta taaagtatgg aaggacttga    157440
     tatctattcc agaataacgc agaagaatga ctggaaacaa ttaagctgta ttccaactac    157500
     aactcatatc atgatctata ctgtatacat gtagtcagaa agccaaatgc tatgtttgcc    157560
     ggcgcaaaaa acgcaacaca gtaagacatg ctcgcaatat atccaaattg ctgacaggtc    157620
     tattcgcgcc accactggcc caaagcacct ccggagccag ccatctcaat cacctcctcg    157680
     aaactgattt ccacacggaa catctgcccg tcagcagtgc cgtttccgct acccaccgga    157740
     gtcaccagtc cccagctgag cagcttttcc caggactctc gggccacatc tcggccccag    157800
     acacggcctg gtgtggcagc agctcccgac accgaggcag atgtctttgc cgacgtcaga    157860
     agccgaacgt attctgcgta tgcggcgggg aaagaaagcg ccagtggtcc catgctctgc    157920
     gactgggacc cgtcgtttcc ggggtcgaat agggctgcta ggcgcgttgc ggctaccagc    157980
     aaagcgagtg gcaatgacga gggactggat gatgtgatgg atgtggagaa agggaggggt    158040
     gctgggtcgg ggcaatcaag ggattgagaa gcgaagcttt tcggagttgg gacttcgggt    158100
     atgggtgtgt cggggatcga tacactatgc agcaagtcgc tgatggggag aagcgcgctg    158160
     ttgaagaact cctttgctga tttggtttgg ttgtagatgc gcctgaggtg gaattggaat    158220
     tctttgtcat cccacatatg ctattttcaa gagcgaggtt tagtaacaga ttcgattgcc    158280
     tggataaaag aaaatatgat agatcttacc ttcagatatt ccttccatcc cccaagcagg    158340
     ctcttccatt tttctgactc cacaagagtg cgttcggacc caagttcatc tgcaatatca    158400
     gccatttcag catcactgag atccaggctc cctaggcaaa tatccgaaaa ggtatcgaag    158460
     gatcgagcta gaggaacata agtatatcga tgactaaatc gactcttgac acgcttctcg    158520
     agcatctcgg ttacatcgac ttttgtcgtg agcccaatga ccgcgatggg ggctttgcgg    158580
     gcttgggcaa tgtcaaacag attatacagc agagtctgcc gtgggtgggt aacgaatagg    158640
     tcgaattcat ccaacaagat cacaatggac ttcgcagcag tcttcgacgc tgggtctcca    158700
     gaagccccga aaagctcctc tgggtgtgac aacaaagcca agagcgtcgc catcgtatcc    158760
     gcataagaac taaccttggc tgcatcatcc tcggtatgca tttcacggcc aagttggcgc    158820
     cacatctctc gcaaagctaa ccgatcatct gtatgcaaaa atccattgag acgaacgacg    158880
     tggaaatcat tgctgtggtc ctttctgagg gacgaaatga tggattccac aatcgcggtc    158940
     ttgccgcatc ctctggaacc aagaagaagc atggagttac cctctccgac ggagacggtc    159000
     tgttcaatga gctgatgaac cttttggtat tcagattcga gtccgcgcac tggaatctgt    159060
     cgtttccctg acagcttttc gagaagaatg gtcgagagaa tgcgcatttc gtcctcaagg    159120
     cccgtctggc agagcgcttg gaacatttca gcgtattctg gcaatggctc ggagccgtcc    159180
     gcaggctcat gcgtctctga ctggtcatga taaaggtctt gttggagttg catcgtaaca    159240
     aggtcatcca agccgtcctg atactcaggc gaaggcgact tctctttcgg ctctgtggcc    159300
     aaggctttct tagatctggg tttcgcggtg cttctcctcg atcgggtcct tgtaattgta    159360
     cgacgggcgg gctccgggga cggctcgtcg aggtccatat catcatcgtc atcgtcatcc    159420
     tcttcttctt cctcatcctc ctcttcaaat tcacgctcac ctccgtcttc catcggagat    159480
     tgtcgcggct tttgcgcgct tcgggtggca cgcgcacttc gtgcaggagt ggtagctggt    159540
     tttcttctcg acgagggtgt tacggcttct tcctcgtatc tctttggtgt tttgcgctgc    159600
     cgtccacttg ttcgtgtccc agcccgcgcc ggagtctgta cctcatcttt atcgtccttg    159660
     ccaccttcgc ctgtcgtttc cgggtctggg ttgtctccgc gggtagatcg acgccgtgat    159720
     acacttttca ctggcgtggg agaagttcgg tggttgttgg gagatgacgg gacggagaat    159780
     acgtcttgag tatcatttcc catttcgatg tctccatcaa catcctcgga gacccttctc    159840
     ctcttgggtg ctcgggccat ggctgtagtt tgaagaaacg ggatcgctgg tataggggag    159900
     tactcaattc gatggaaacc aagcttcgtc agggcgaggt cgcaagcaga aattgctcgc    159960
     agttttctcg ttagataagg gtttgcgcct gtgtcaatta ggatcaaatt caatcaatgc    160020
     tgtctgttgc cgaccagctt gagcctagga gctttcgccc cgaatgtatg gacttacagt    160080
     gagaaaacca acggcctagt catttatcaa ggccaatgag tgcagcccgt ctgaatcaaa    160140
     ttcgaacagg agacccctgc gtggttcaat tgctggttca attgctggtc caagtgctgg    160200
     tccaattgct caaagggtca acaaattggc cgattttcgc ctcaggccga gacgcgtgtc    160260
     gcgaagtcag gtgcttcccg aggttctccc ttgcgacttg gaagatttgt tagtcgactg    160320
     gttctccttg atattgtctt actaaatatg tatagacaag aacattttct ttctttggta    160380
     ttgactagaa ctctcaattg gaattcgaac aagacagact tcaagaaccg aagccgagct    160440
     gtattatgca gtaactgaac aggaaatcca ccacatagta catatgtagt ccttcgcaaa    160500
     aagaatcatt ttgagatgaa catatgtcaa atctaatatg ttgagagatg gatatatctc    160560
     caattcaagc atatcgcata tctgattttg tactgtactt ggtcggcttc atcacagccg    160620
     aggtccaatc tggtgatccg agccctgtgg ggtgtactta gcttcagcta ctgctacttc    160680
     cagcgcaacg ctgcttctct aacccattta attctgtttt ctttcagaca tgtcagataa    160740
     cgcagataac gcaataagcg ctccgtccag aaaactggac gagttcgagg agctcgtcta    160800
     tgagtataca gggcgtatgg gaatggggaa tgagggagta agtaccatgt gcaaacattc    160860
     aacatgtgaa ctgcatctcc catatacgca gcactagcac gcatgattga attctagctt    160920
     acccctatct caatccaaag cactgggacg tcgatgcccg cagctgtaac ctccgcttcg    160980
     aatccgcaac ccgcggtcct ccggctacag tctcgttcct gttgacgatc actcctccgc    161040
     tgagcaatta catgggtaac ctccacggcg gttgtgctgc tactttgatt gacgttctct    161100
     caaccactat cttgttgggc atttccgaac cgggcaagtt ctcgttcgga ggtgtcagcc    161160
     gcaacctcaa ggtgacatac ctgcggcctg tacctaccgg aactgaggtg cgtcttgttt    161220
     gcgaggttat ccatgttgga aaacggctgg cattgcttcg cgctgagatc cagaaggcgg    161280
     agagtggtga tgtttgtgtg attggtgaac atgagaaggc caataccgac ccggaggtga    161340
     cgcagaggat ttgattcgat gtttggtata tgccgggttc ttaagaggca gctactggga    161400
     tataaatttg tatagacttc atttgtatca ataaagttgt caaattctag ccattgtacg    161460
     agcgaagatc ctgtaatcga tgtggtagtg accggaaata ttgtgcttcg tttgttatga    161520
     tagggaaggg ctgaacaaga acagagacga acagagacta tcgcacatgt ccaagagaaa    161580
     tataatcaac caatctaagc agtactagat tatccgattg ccaaggcgag taggcctttt    161640
     tactctgtgg ccagctgctg gtcttcccgg agaccctcaa ccttcaactc ctcgccagtg    161700
     gcacggcggt acatatcacg gacatcatct gggagaaagg attagccgac aagtcctata    161760
     ttctccaatc agggaatagc ttaccagtcg tggtctcgaa gtgtgatgtc gcgtcatagc    161820
     tcttagagat gaagatgttg gactcctcgc cattgtcgat gggctcgtag agaggaatgg    161880
     ggggacccat gaacttctcc tcgatcttgc ccagtcgctc gaagccaggc tcaagctcaa    161940
     ggtggtggtt ggcatcgttc tcggcgatgg tggacacgat ggcgatgtag tagcccttgg    162000
     ggcagacgtt atgcgcagac gagaccatgg caatgtaaat gtctggagag gttagtgctc    162060
     tgtcaataaa tcgggattgt atagaactaa ccgtgcttgc gtccaacctg agactgggga    162120
     atgatcagct gcacagagtc gctgctgtcg gtcttatcga tggggtggtt cagaatgcag    162180
     atagccttga gcaagtatcc ggtgaccttg gacttgctcg ggaagtaaga aggatcagcg    162240
     atgatcttct tggtcttggt ctcaaacttc atggcttcgg attggtcgtc acggtccttc    162300
     atcgtcgcct taattccgga gaccttgccg ttctcgtaaa gcacctcgtc gacgtcggtg    162360
     ttcaacatgt atgtaccgcc gtaaatggca gacagacgag cgaaaccctg gggcagctcg    162420
     ccgagaccgt agagagggta gatatatggc gattttccgt agcgtgccat agagttgaca    162480
     tacaggcgga tacggttaat tgtttcgacg gcggcgccac tctggttgat atattcgtcg    162540
     gaggggtaca aagccatgga gtgaccgacg aaatcacggg tattatcctc gaggccaaac    162600
     ttgtcgtaaa cctccttcat cgtgcacgca tggatgttca atcctggtgg gcattagcta    162660
     tctgctttgg cgaaaccccc ggagctgacc caagttacaa atactcaccc tggtgactgg    162720
     ctgggtcgtc ctccttgaaa tcaccaaccc actcgaggaa cttcttggca cgtcgctttt    162780
     cgaacaagcc catgagcgat gagcggagag cttcaccagc atccgaaggc accttggcca    162840
     cggtcgcctt gggacccttg ccttgctgga catagctgcc agcaatctgc ttgaactcga    162900
     ggtaccgggt aacatccgtg gacaccaaaa tgttggtcaa ctccccattg gacataagca    162960
     gcttggggac caagtcgatg ttccagtcat tcaccctccc gtatttcttc catggctcct    163020
     cgccggggcg gacgttgccg tatttcttga acagctgcaa aagggtgtca atagggcgac    163080
     tctggaatta atcggtgtac atactgcttc gatgttgacg gaagctgctt ctctatggta    163140
     attgtgagct attttgatct tggtgccgtc atagcgagct tctccgactt accctccata    163200
     gtggtcattg cgatcgatgt gaaggacctt gttgcccttc acactgagca cactatagtc    163260
     aaaaacaatg agaaaattgc ggaatcacta aaaaccaagc tcaaaagacc tacccagaca    163320
     aaacacactc ggtcaggcct gaaaggaact ggtcagttgt tgactttggg gggggatggc    163380
     ggggtagcaa cataccagtg ccgagcacca caacatcata ctctggggca atctcgtcca    163440
     taatgaatat ggaagatact aaaggtagag aaaagtagaa agaagattct cgagagaatg    163500
     aggagaagag aaagtcgact atctccccgc ggatcaacga agcggtaaga aaggggaact    163560
     actatttgac ggatccgcca ctagtgagtt acctcacgat attaatgaca tgggataatt    163620
     tggcttcaac gaacccctga atatgtatat ccctgggttc atttcatctc aggggtaagt    163680
     atgatcaatt cccgagattc ttaggtacag gtctaaatta aaggaggttt gtagcgtcgg    163740
     atgacgaacc aactctcata tatccaatgt atactatgta taattcgaca tgcgcactac    163800
     taagatcacc ttgaaaagct aatgttacat aaatttgaca attgagactc ggctcaagtc    163860
     tcccccggcc tcgtgttgtg cctgaaccct tttccctcaa gcttattggt ctttcccttg    163920
     ggcttcttca acgcgctcct gctcaacctc aaagtcctcg agtccgtaaa agttctcagg    163980
     gcggtacccg cgcttgtaca ttcgtttcgc gtcctcccaa gcataccaac gttcacgtag    164040
     aacgtgcttg atgttcctca tggtgcttcg aatctagaat gatcaaatgg gtcagtcggg    164100
     tctagacaat tccaaccgtc gattgactgt tgcctcggaa gtaacgaaaa aaaaaaaaat    164160
     ttctccctgc agctttccaa gatatagatg aacaagacgg cctatacagc cggggaaaaa    164220
     ctcaccacct tgtcccgttc ctgagattca aatccaccgt aaccagcctg gattctctct    164280
     ctctcaagat ccgacgtggc aatgcggttt cgttcccgga cgcatacatg ccacagaccg    164340
     tggaggtcct gccaatccct ttcgcggagt tcttggatag cccaagcacg acctaaattg    164400
     ccaacatcag cactgctcgt agcacgttca atctataggt tcaatctatg gattggggac    164460
     aaacaaacta accatgggcg ttgtcatatt ctggggtagg taatggttgc cggttagggg    164520
     ggaagaaggc ccagagtccg tggttggggt ctgtttcccg tggctgcata tctttcggcg    164580
     acacaggttt gggcaatggc catcttgaca cgacaaatgg ggttctggga ccggttcgat    164640
     ggatggctga tacaccacgg tttttgctct tgtcgcgtcg agggttggcg cccacggagg    164700
     cagtggagga aaagcttgaa gactggatgg ctgacagggt cacggatggg tgaagtgatg    164760
     gcgcgaggta agtgggaggc aattcagcca tagccagccc cctcaggcga ctagcaatgc    164820
     gtggaacctg ctgcatgatt gtgatggctt tccccaggat ggtcggagtc ggagattgat    164880
     ggcctttctt ttcgtggaag gcggcaagac tgatcacgtg ccacaaccaa cccaagacag    164940
     cttggatgtt gccagcctcg ggttcgtcgg gttcttcata tctttttttt ccttttcaag    165000
     tcgtatgatt tcttttaatt ccatttccaa atccaggaaa cgaaaatccc aagtaccttt    165060
     ccttcaaaga tatctttagt ctttacctct taggccttgt ttgccgcggt taattacaga    165120
     cttggcccgt gcattcctta gcacccgcgc gtctaaccgc ccaatcgact actcggcgga    165180
     gcagtgccgc atcaagcgtg accaagaggc ctttgtggat tgctctcccc tccacagatt    165240
     cacctccggt ctattactcg gccagtcctc ttttttgatt tttgacatac cccggaataa    165300
     cgggaattac cttcttgtta agaaatatcg actatgaata ggccaggttc gtcattttcc    165360
     ttcaatgcct tcgcaaaccc ttatgccttt cttatctttc accaacctcc gcggaatact    165420
     tgatatagtc agacttgttg ctatgctggg ctatactctc cttggcattg ggagttacct    165480
     agcactatgg aagcatcggg gagtccaatc gcacaccttg ggccaggtgg ttttgcattt    165540
     gcgaccgagg catttgcaag gacatgcccg cacattcctg tggcgttgat ctgagcagct    165600
     cttgatgcga cgatcgtgct gacttgtcac gcttgtgcca gatcctggcc cacagccgct    165660
     gagagacatg tccggattcc ccacgcaata gcaagcacaa gatcgaactt catcattagt    165720
     ccgcgcgatt gtcaaacggg aaactgggtg cgattgcctc gagtcatatc ttctggacac    165780
     tcaagatcat ttgaatgaag ggatgctaac ataagagtat caataggcgg cggtgcgaat    165840
     tggagtttca atttacctgt tagcggaaca tctggcctac cgggcaatca gcagcgcaca    165900
     atgggaacca tgggaagctt tgcgcaaagt cttggaggat ctcaatctgc ggcaccactt    165960
     gatctctcgt aagttctctg ttgtcatggt ttgcagtggt ctcctgtatc tctaggcctt    166020
     ccaatttgtc tccgaactga cgaggtcggt gattctaggg agtttccttc gctatcagga    166080
     gcatcacagc aatcacaatc acaaactccc ggtcagctaa tgtgggccaa cgcaagtcaa    166140
     cgtgctgctc agcaaacacc tgtccaaaga caacagctcc ctccgacatc gcaaaccccc    166200
     tctcgttcct cccaacccca gggccttccc acaccccaac aatcgcaacc gccgcatgat    166260
     gacatgtttc cttctggtgc gcagtttgcc aatcgacttg atgactttag aaatggtggc    166320
     cagggtatca gcagccaact cggtgcgggt ggccagcccc agacaggcaa tattgaggag    166380
     tttccccctt tgggtcgcaa ttctgctgct gagctccctc tcggtcggac tggttcgttg    166440
     atgcaaggtg caggttttgg gggctatgga actggtctgg ggggaccgcg gtcaccagtc    166500
     agccaagtac ccaatggcat tttgggacac gagaaagagg taggtcccta caattggcta    166560
     accttttagg cggcactaac tttacagcag gacttgaaca atggtgtact tccaggccag    166620
     cgtaacttta gcgatccaca acagctacag caaagacagc aagaaactag cgatggacaa    166680
     gatgtctcta ctgcgcccca gagtacggag caaccgcccc tcgcgcagat gagtgagctt    166740
     gacagatttg ggttggcggg cctgctacgc atgattcaca gtgagagtcc tgatgttgca    166800
     agtctcgctg ttggccaaga tttgatgaca ctaggattgg atttaaacca ggcggagtat    166860
     gagttccttt gttcccatgc catttgacac atactaatat gcttctctgc ataggccttt    166920
     gcacacatcg tttgcttcac cattcgtgtc atcaatgtca gcagtccctc tggaacaaga    166980
     cttctcttta ccgggttgtt ataatgtcgc caatatccaa ccgctccagt ctcgcattcc    167040
     tgggtttagt gatgaaacac tatttttcat cttctacagc atgcctcggg atataatgca    167100
     ggaactagtg gctgaggaat tgatgggccg caaatggcgg taccacaagc ttgagcggtg    167160
     ctggctgact cgcgatgaga catatcctgg acccgttgat gtggagcgtg gtgtgaccga    167220
     acgtggtgtt tatcttctgt gggattcatc tgcctggaag aaggtccgag taagtaactt    167280
     tcatcctttg ctggttaaag aactggttaa actaaccttg atcgcagcgt gaatttattc    167340
     ttcgatatga agacttggac aaccggttgg atcctaaccg aggtgccgcc cgcccacctg    167400
     gggtagtgca tcatgcctca tgatttgaag ttaaaacgac ctaggcgcac gcagaataca    167460
     agcaatcaac catggcgttc ggtttactgg tctgtgttat attgctcagg gacggccgat    167520
     agtacattga ccttcgggat aaggcgcgtt gatttctctg gtattaaagg gctatgtggg    167580
     aaaccaggat acgatcttga aaatcaatgt cattacctgg atgatcttgt cacaatgctg    167640
     tggaatgctg tagattgctg tagatccctc tcttcatagg cgcctgaatg agctttccat    167700
     ctagccagac ttgcgcgcag tggacagaat agccatccat tcggtatcga tgttcccata    167760
     cccgtaactg tcttccaagt acttctctat cgccggacga accttatcct ggtgttcctc    167820
     ccgttgcttg tcagtccaaa aggtctttac catcgtggga atcatcaaca tggtcatgtc    167880
     aacgaagata ggggatgtga tggtcagttt tgtcgttgtt ggacggacgt cgatgtcctg    167940
     aaacccacgt tcctctagct gggtctcgat ccaagccttt gagtcccatt gcccatcagt    168000
     caaggcggcc aagagctttg gcgtctctgg aaaagacaga ttgcctggca tgctttcaat    168060
     tgctgctcgg gcgacggcaa tccagccggc tgcttcatgt cagtatatct ggttatgtga    168120
     aagaaacgtt ccgatactca cgctcgatcc aggtcgagaa agcaatagtt ccgccgggct    168180
     gcagcattcg gacggtttct agtggttttt attagccttg aatataataa ggaagtaagc    168240
     aaagacatcc ttaccatcga gagccttaag agactcaggt agtgccatat aggctgtaga    168300
     agatagtagt tagccacagt cgaatgagat tagagtgcgc ccagaaacca actcaccgaa    168360
     agcagtgaag atatgagaga attgagcgct agctagctcg ggtttctgcg catccacgat    168420
     ctttgcctcc gcgttcggcc aaccctcttc ttgcatacgg tgcgtagtgg actcgatcat    168480
     tggcgacgat atgtctccgc aagtcaactt ccacatcttc ttgacagagt catcaagctt    168540
     atcgttgagt gcgctagata taacgccagt gccgcaggca ttgtcaagga ctactaggtg    168600
     ctgagcaggg ttggccttgg actcggcggc aaccttggtc tggtcaacca gcatttcagc    168660
     gaatgggcga gtgaccatct ccccgcgttt gaatgaacta gcatagactt tactcttgaa    168720
     gaaagcctgc aatgcgggtt cctcaggcat ggttggtaaa actgtaaggt ggttgggtac    168780
     cgtgttgaat gaagatgata gatgaggatg tctgtttaga cgaaagcttc gagtgatgtt    168840
     acggaaagtc gatatcatgg gaagataatc ttcttgctgg gcttaaatgg ccctttgaac    168900
     gatttggagt tgctctagac ttcccatagc catatagaaa gtgtccgcga aagtatccgc    168960
     gaaagtgtcc gcgaaagtgt ccgagaatgt ctccgcgagt ggatttcagg cgagtgattt    169020
     ctaaaattat accttgaacg tgttgatagt gactcaaatc gcctcactga ccgtaagtcc    169080
     atggcaatga ttggttgagt gcgaaacttg cgcagtaggt agcctccaag gttcctctta    169140
     gtatatcgta atcatgttgg caaaagagga ggcctgcaga gtcaaaataa aagcggtgga    169200
     ctcattggct ggtatttcat atcaactgca aatctgagtt tccaaatgcc agccaataaa    169260
     taaagccaat gaattgagat atttgatttc aagtcgccga gtgccatttt ttgtatactt    169320
     cgatatcatg tgagaacaaa gcccccgcgc tgacatcagc aaaacgacgc cagtcccaaa    169380
     tgggcaaacc atcaacagcg gatgcggcaa aacaatcaat cccctccact tcccacctgg    169440
     ccgacctatg cactctgcta gcgagcagaa cgccgtttcg gagtcgcaac catgaggatt    169500
     actgaaattg tcatagatgt gaggctcaac attgccccat agtcattcac tgcgctaaca    169560
     aggtcgtcag ggcttcaaat cgtacgctgt gcgtacggtg atctcgggat ggtatgcaat    169620
     cctccgaatc caagcatgaa caaatcatgg cgttagaagg gtttgagcgt gatgggattt    169680
     actaatcgcg caatgtaggg acgaagcctt taactcgatc accggcctga acggcagtgg    169740
     taaatccaac atcctcgatg ccatttgctt cgtgcttggt atcaccaaca tgaccacagt    169800
     ccgcgcgcaa aacctccaag atcttatcta caagcgtggc caagccggtg tcacgaaagc    169860
     cagcgttaca atcgttttcg acaaccggga taccgcgaag tcgccgatcg gatttgagga    169920
     gtatgcgaat atttccgtca ctcgacagat tgtgctaggc ggcacaagca aatacttgat    169980
     caacggccac cgcgcgcaac agcagactgt tcagaacttg ttccagagtg ttcagctgaa    170040
     catcaacaac cccaacttcc tcattatgca aggtcgcatt acaaaagtcc tgaacatgaa    170100
     atcagtcgaa atcctgtcga tgatcgagga ggcagctggt acacgaatgt ttgaggatcg    170160
     aagagagaaa gcgaacagga caatggggaa gaaagagctg aagctgcggg agatcgaaga    170220
     gctgctgaag gaagagatcg aacctaagct tgagaagctc cggtcagaga agcgagcctt    170280
     cctcgacttc caacagacgc agaatgacct cgagcgcttg actcgacttg ttgtagccca    170340
     tgactatgtt cgtggcggcg agcggctaag agttgcaggc gaagagtgcg aaaacaaacg    170400
     taacaaagcg caggcactcg aagataacgc gcacaaactc aaaagtgaga ttgcccattt    170460
     agaggaggac gtgaaacggg tgcgcgcagc tcgcgacaag gaactccgaa aaggaggcaa    170520
     attccagggg cttgaagatg aggtcaagaa ctactcgcac gagttggtcc gactgaccac    170580
     agtctttgat ctgaagaatg caagcatgga cgaagagaaa gagaaacgac ggaccattca    170640
     aaatactgtc actgatcttg agaaaatctt gaaggagaag cgcaagatct atgagaagct    170700
     acaggctcag tacgataccg ccaaggccga gttggacgca caaaatgtgg aagtggagca    170760
     aaaggaggaa ctgctccaga cattgcagac tggtgtcgcc tcgaaggagg gccaggagag    170820
     tggttaccaa ggtcaattgc aagatgcccg gaaccgtgca agcaatgccg ccacagaaca    170880
     agagcaaggg aagctcaaaa tcaaccatct tgagaagcgc atcaaggaag aggagcctcg    170940
     cgcaaagaag gcaaaggagc aaaacttggg gcttctgcgt gacctcgaag ggttgaagtc    171000
     tcaagccaac aagctggagt ccgagctgac ccggcttggg ttcgagcctg ggaaggagga    171060
     gcagatatat caggagcaga ccgagcttca acgcgatatt cgtgacctcc gccagcgagc    171120
     tgatgagctc aagcggcagg cagcgaacat cgatttcaat tacgcagacc cttatcccaa    171180
     ctttgaccgg tccaaggtca agggtttggt tgctcaactt ttcaccctca acaaggacca    171240
     ggttccggct gcaactgctc tggagatctg cgccggtggt cgtctttaca atgtggttgt    171300
     agacagcgca gagaccggca cacagctgct tcagaaaggc aagctgcgca agcgagtgac    171360
     tatcattccc cttaataaga tttccgcctt caaggcctcc gtggaaaaga tcggagctgc    171420
     acagaacctt gcccctggca aggttgacct tgctctgtcc ttggttgggt acgacgagga    171480
     agttctagcg gcgatgaact atgtattcgg aaacaccctt atctgtgatg atgccgacac    171540
     agccaagaag gtaacattta acccgtcagt tcggatgaag agtgtcacgc tggagggcga    171600
     tgtgtatgat ccgtccggaa cactttccgg tggaagctcc cccaactcca gcggtgttct    171660
     tgtgaccttg caaaagctta acgatatcac caaggagctg cggagcaaag aacgacagct    171720
     cgcgactttg gaggatcaca tgaagaggga aaagaagaag ctcgattccg tccgctctat    171780
     caaacaaaat cttgatctga agaaccacga gattaagctt accgaggagc aaatcaacag    171840
     caactcttcg tcttcggtat gtttttgtcc taatctgttc tcccaatttg ctgttaaccc    171900
     caactagatc atccaagctg ttgaggagat gaaatcaaac attgaacaac tcaagaatga    171960
     catcgccgac gcaaaatctc gccaggccga agcatccaag gatatcaagc gaatcgagaa    172020
     agacatgagt gaattcagcg acaacaagga tagcaagttg gaggaactgc agacaacgct    172080
     cgataaactc aagaagagct acgccaaaaa ttctagctcg gtcaaagagc tgcagaagga    172140
     attgcagact tccagactag actcagaaca agttggaagc gacttgtccg cggctgagga    172200
     gcaattggtc gagtcagaaa atacccttag cgcccaagta caagagattg aatcacaaaa    172260
     acgggagcaa gcgaggctga aggtttgtga tgtctttgca acactactca ataaccatat    172320
     cactgacaat tctaggatgc ccatgacatc gcacaggctc agctcgatga cgagcgggcc    172380
     aagttgaccg gctttgacga ggagttgcga gaattagaag aagccatgaa gagcaaatcc    172440
     tctcagatca ccgaggatgc actagaggcg cagaagcttg gccatcagct cgaaaagctc    172500
     caaaaggacc agtacactgc cagtcaggct gtggctcaca tggaacaaga acatgagtgg    172560
     attgcagatg agaaagaaaa cttcggacgc gccaacactc cctacgattt ccagaaccag    172620
     aacattgccg agtgcaagtc taccctacgc aacttgactg agcgatccca aggcatgaaa    172680
     aagaaaatca atccgaaggt catgaacatg attgacagcg tcgagaagaa ggaggctgcc    172740
     cttaagaaca tgatgaagac tgtcattcgt gacaagcgaa aaatcgagga gaccatcatg    172800
     aacctgaacg aatacaaaaa ggaagctctc cataagacgt gggtcaaggt gaatggcgac    172860
     ttcggacaga tcttcaacga gctcctaccg ggaagttttg ccaagctcga ccctcccgag    172920
     ggcaaagata tcacggatgg tctcgaggtg aaggtgtccc tgggcaaggt ctggaagcag    172980
     agtttgacag aactgagtgg tggccaacgt tcgctcatcg ctctctcatt gatcatggcg    173040
     ctcttgcaat tcaagcccgc tccaatgtac attctggacg aggtcgacgc cgcgctcgat    173100
     ctgtcacaca cgcaaaacat tggtcgactg atcaagaccc gtttcaaggg atctcagttc    173160
     attgtcgtct cgttgaagga tggcatgttc caaaatgcca accgcatttt ccgcacgcgg    173220
     ttcagcgaag gtaccagtat tgttcaggcg ttgactccag cggatttgaa ataagcatgc    173280
     acatgagctt ggttgtctat agtttctttc ttggtgtgtt ggtccggtgg agtgtgagat    173340
     tattatgtct ggcctttggt gtttggttgt ttttggatgg gaatgggtct ctattttatg    173400
     aatcatgcat ggtaaagact atttcaattt tcttcatggg tatctataca agtgtacaat    173460
     ctcagtgtac aatataagtg tcgctcaaga caaacttcca aacttggaaa ctccggtacc    173520
     cggcacgtgc ccgaccctcg acctgatccg tgccaccttc caacgcgcat tgcgatttca    173580
     ttaaattacc cccattgcgc ccatacctaa agcacctcgc ctaggcatca cttatattaa    173640
     ctcatattca actcgacgtc ttgccttccc caggaccgtt acagccagat atcgtcaccg    173700
     gggaccctga acacctgcct ctacttgcgc tccgccaaca caagatgtca gacgaggaac    173760
     cttcgctgaa cataccgtca cttttgacct tagcggttgt atcatacttt gttatccggt    173820
     ggttctttaa tcgcgatgaa agcgcggcgg gtggaagccg aggtcggggg cgtggcaatg    173880
     ttgtcgatcc ggcgcaggtg gaacagatcg cgcagatgtt ccctcaacta agcactcgag    173940
     atataatgtg ggatctgcag cgtaatgggg gcagtgtggc cgcaacgaca gagaggattc    174000
     tgactggacg ggggttggaa acggtacgtc ctgcgctgtc atcgcatttc cccgccttat    174060
     ttttattcga gacaacttga cttgattgcg ggctgcaaat atcgacttcg aatttatata    174120
     gaacattgac taatctgttc tcttagcccc ctccttcgtt tcaacctcag gtcgcaatcc    174180
     ccccaaccaa cattccgccg acccagaccg ctacggccgc atccgcgccc aaagcggacg    174240
     cacaggactt gatatctcgg tataatctga gcgcaaaggc tgagagccct cctgcagagt    174300
     cacattccga ggtaccttcc aagtccacct ggtctcagaa taaggaagag cgccagcgga    174360
     tacttcagaa gcgccgggat gatatgattt tagcggcgcg aaggaagatg atgcaaaaga    174420
     acctgggcga tgcccaatga tatgagaatt ttcacgctcg cctgtcgaca ttttgactct    174480
     gtacactgct tttgacgtcg ataagtctgg ctaaacccgg cacaatgttt cccggaggcc    174540
     gatataacct ctccgctctt tcggttttgt tctggcatca ttcctcttcg tttgtattaa    174600
     agcgctcgca tgctgtatgg tgttagttaa attggaacag tttcgattat aaccgttggt    174660
     cattggattg cggagggtat attggattat atacatgaaa gtcgttttgg gcattggtct    174720
     gcgtcacata tgcaccgaat aactccaaat gaaagatacc cccaaaacag gaaaagaaac    174780
     gtcttaaatg cctagaactc catgtaatct tcttcttcgt catcgtcctg agtcccgtcg    174840
     tagccaccgt ttgctctctg ctcggccatc tgctcgcgcc gggcctgttc cttggaggac    174900
     ccaattctcc tatgagccag ttagcaacga agtatcccat atactcggat atgcaagtgt    174960
     ccgagaaaaa cgtcaaacat acctaagacc atccaccaca cccgtgataa atcctcggtc    175020
     ctctcccagc tccatagaac cgacacccgt caaagcaaca ccgccaccac cggttgccgc    175080
     agcatccagc acatcaacgc cagacctcat tttcgccatg cgcacctcac gcaggtcctt    175140
     cagcagcctc cgtatctgat ccggatccac gagatcatca ctcgcggcgt caagcagcag    175200
     attcccaacc tcaacccagt gaaacggtag tgaaggggga tctctggaag atgctacggt    175260
     ctgggctgtg ttctgatgta ggaaaggcgg cgcggcataa taccgattcc catctggtgt    175320
     atactgtggc cgagcagacg gcagggcatc gcggtccaaa atgctaggtt gaccaggcag    175380
     gggaggaggt ggggagaaag cgtttttgta atcttggtgc tgggattcga cttcgaggat    175440
     gagagctaac ggttctgggt gtaaccatgt tggtgggatg atgtttgcgc ggcgttggcg    175500
     tttaaggagg agcgcgagcc agagagggag ggaagcacgt cggggcggaa cgagaggttc    175560
     aatgggtccc tggggatagt tagctttgaa aagtttagat gaagcagttc ggaggcgcat    175620
     tcactcctag tagttcgagg ccttctagac gctggcgagg cacaattgtc actgtttcca    175680
     tctccgccag gaaggcgatc tctgacgccg taacgccccg aggaagaggg aaagccattg    175740
     agggtgtgaa taggaaggcg gatgcgattt caattaatca cgagggtcgc gatctcatcg    175800
     tttttctgag gatgatacag gtcgtcttgg tcgtgacctt gacctcgacc gtttgctttg    175860
     cgttcctttg ctttcctgtc ttttattctt atttgacaat cgcgtatttt ctcttcaaat    175920
     gcgcaattga ctattattga acttcttctt tcatgtcgcg tcgtgatggc gacctcgaaa    175980
     cggtcgaaac gtttgaaacg tttgcatcgg tcgagctccg cagccgatga ctgggacgac    176040
     ccggtgcccg atggattgaa gatcacttgg caacggtacc tgcttgctgc gactgattat    176100
     ttgcgcagca tggccaatcc tccagaatca gatctcagcc ggagtgctcg atggttggtt    176160
     ccgtttttct tggtcttggt tcctctctgg gtgagtctcg tcaacaaggc tgtcccagag    176220
     ccctacctcg acgaagtctt ccatgtcccg caagcacaag catactggtc gcataagtgg    176280
     acacaatggg atccgaagct tacaacacca ccgggtctat atctgtgctc atacacaatc    176340
     ttcgctattg tgttgctgct acgcgggtcc ccaacaaagc tcactccgga tgtcctgcgc    176400
     atgacgaacg ttggtgccac gactgttgtc ttcccctgga gactgcaaaa gttgcttgat    176460
     accctacaga ggacgacaaa tactcgaccg ctgggagcca atgtgtctca taccgtgctg    176520
     aacatctgct tgtttcctcc gctgttcttc ttctctggtc tctactacac agatgttctt    176580
     gctttgctgg ttgtcgtgga ggcgtacaat tgggacctga agagagacac agagggacac    176640
     cagcaaggcg actccggaaa agacaaaaaa gaaggcctta gcaatggcat tctggagaca    176700
     ttgggattct tggccttcgc gctggctgca ctggtcttcc gacagaccaa tatcttctgg    176760
     gtctctgttt tcctaggtgg acttcaagtg ctccgcaaga ttcgaaagtc tgccacgcct    176820
     tgcatgtcat ccaaagtgtc tactattgtg aagcaaggcc tgcagaatga ggtgtatgat    176880
     cctctcgttt cggaggcttc cttggaaggt aaattgatct ctttttacat acaatataaa    176940
     gcaaaccggg acccattcta acctagtata tagattatcc gaagaccgcc atctcacttg    177000
     caactgtcgg cctgaagaag cctttctctc tccttgtttc tctcattccc cacatcatcg    177060
     tccttgcggc ctttggtgcg tttgtgcttt ggaacaacgg agttgtccta ggtaagagtg    177120
     gcttgtttta ttacattaaa tacaattttg actaatcctt gctattcaat aggtcacaag    177180
     gagttccata ccgcgggtat ccatctcgct cagatgctct acatctggcc gtatttcacc    177240
     ttcttctcat ggcctctctt catccttccc ttggtcaaca ttctcgccct taagccactc    177300
     cctaaatatt tgaacctcgg cttcccgcct aaacagatga aatatcccaa actcaaagca    177360
     gccctggttg tgatcccgct tatgcttgcc gtggtccact tcaacaccat tgtgcaccca    177420
     ttcacccttg ctgataaccg acactatgtg ttctacgtgt tccgcattct tctgcttcac    177480
     ccagcagtca agtatgctgc agtgccagtc tatttcctct gcggatgggt cgtgatctcc    177540
     gccttcggat ttaccaccat tcaacgtccg cccaaggccc tgcgagttca gcaatctgct    177600
     tcagctgcgc cccaagctcc agtcccggcc ccggctccag ctccagcagc tcaagagccc    177660
     aaatccactt cgtcttctgt gcgcaagcct ctacaagcgc accaacagcc accaaagggg    177720
     acgaagaagc ccaaccggcc cagtaacaag aagcccaaga aggccgatcc accagcagaa    177780
     accaagaaca ctgacacaag cgagctacca gcagggatta cggatccaaa agatcccgcg    177840
     gtcctagcta gggtccagca acacatactc acgcggcaga gagaattgct ggaggcaccg    177900
     cgcgttagct tcgtccttgt ttggctggcg gctacttccc tgtctctcat cacagcaccc    177960
     cttgttgaac cccgctacct catcattcct tgggttatgt ggcgtgtgca tcttcctcca    178020
     ctgccatgtc tgttcaggga ccgagaaact cgcccccgca cagaggaagc caagcgtcgc    178080
     tcggacctca ttgtcaactt gccaaagttt gtggagacgg tctggttctt gatcattaat    178140
     ctgatcaccg ggtatgtctt cctgtacaag ggctttgagt ggccgcagga gcctggcaag    178200
     actcagcgct tcatgtggtg atattcccgc tcttttactc tttaatattc cttttgacct    178260
     accttggttt ggccatttgt acaatagaaa atgtatactt gcttgactac tcattcaatg    178320
     gtctttttct gtggcggccg tgcataaaga tgatcgtaat ttatataagg ataggtaaac    178380
     aggaacggtc ggtccactag ttgttctaag tctggttgat agaaaatcca tcgatattag    178440
     gagctatatt gtagatctgt agatcctgtc tttcatgaaa aaagaaagga gtaatatcta    178500
     catatcccgt attccattaa gccatttacc agaaatgaga catactcagc gccaattata    178560
     cctactgctg acccttccac gcgctatatt tgcggtaaat atcatggcgg aaggtttgct    178620
     tcagatcggc catcaagtct ccatcgaccg gcagcacagc ctggatagcg ccaacgccac    178680
     agaggttgtt cttccgatca atgaaccaag tgagcgtcaa gccaccgccc caagtcaacg    178740
     tccgctcgcc ataccagcca tcaacatcct caagcgtcaa caaaccgccc aacccatagc    178800
     caaccttcgt ttccgggtct gtcccgacgc ggaaaaaggg ccctagagga ctagcaagcg    178860
     cagctcggtg gcttgccgcc gcttcaggac caaggtgttg ctggaacata ttgtcgacgg    178920
     cagctggctt gagcaacatg ccatcattag ccagcagcga gcgcagaatt ttaacaaaat    178980
     ccaagccggt caagaacaac ccgtgaccac caaaggcacc acggccccgc aagttcatct    179040
     cgccgccacc gccgatcacg gcactaccaa gagcaccggg gtcactgggg ttaaggtcga    179100
     cgagtcgggc tcgcagatcc tcacgggtaa cagggtagaa ctgagaatct gtaataccga    179160
     gcggatcaaa gatgcgcttc tgcatgaact ccatcaaggt gccaccagta acgcgctcca    179220
     ccacacggcc agcccagtca agaccgggtc cgtacatcca gccggtaccg ggctggaagc    179280
     tgagcgggta ggtgaacatc tcctcaacga gacgaggttt ttcattctca ggattggcat    179340
     actgcgcacg ccacttggcg atggacgggt ccaggaaatg gtaggaggtg cccgagctgt    179400
     gtgtaagcag catcttgagg gtgatggggc gggctggtgg atcgtccagc gggctttcat    179460
     cgtcggtaaa gccagtgagg acatactttg ccgcgagctc tggggcgata gaggacagat    179520
     cgccgtctag gcttagtagg ccatcttcga cgcactggag ggcggcgatg gttgtgatca    179580
     gttttgtggc tgaggctagg tacagcacat catcgagctg ctgtggttgc ttctcgcctg    179640
     agagtagcgt gcgctctccg gttgccttgt tgtagacgaa gtggccttgg gcatcagtgg    179700
     cacagactac agcgccgttg atcttgcctg tgtcgatggc ggcttggaaa gtagtgtcca    179760
     tgtttctttt ggagagaata atagaatgat attgagagac agggggtcta gtgagcagga    179820
     gggggtttaa ataataatca gctatgtaca acacatcgag aggatcagat cggggtctct    179880
     ttttggtgaa gtacgatggc tgccttaggg ctgacagccc cgcctgaggt caatcataga    179940
     ccaatcacca tacataacct gagagcgtgt gattcggcct ccaattgagg ctaaatccaa    180000
     cttcatggcc atacatttcg ccctttgggg tatatggtca actgaaaata gtatacaaag    180060
     aagattagcg tggcccctgg ggcactaagg atgactcgca taatcaaaga gaagctacct    180120
     atttcttttc tctctttttt cccttcaggc aagctcagga tccataattc tagagtacga    180180
     gcttttaagt actacgttgt actaacgtcc acaggcgtat gctcaagtgg tggtgccatc    180240
     gccgttcgct ctccgcgttg tcagtaccag cgagctgtaa gcgcccaccg gtggtagagg    180300
     cgtacagctg atattttgct ggctgcggag ctggtttctg gagctggttt ctggagctgg    180360
     ttctggagct ggtttctgga gctggtttct ggagctggtt tctggagctg gtttctagtg    180420
     ctagtttcta gagctagttt ctagagctag tttctagtgc tagtttctag tgctagtttc    180480
     tagtgctggt ttctagagtc tggtttctag tgctggtttc tagagtctag tttctggagt    180540
     ctggtttctg gagtctggtt tctggagtct ggtttctgga gctggtttct ggagctggta    180600
     gggaaacgcc ggtcagccct aagttccgga acctgcccag gtgacttcca gccgctttaa    180660
     atctgattgc gttcgtcaat ttctctttct gaagaaacag ttggttccac ttccgttcgt    180720
     cgcatttgtc ccattcgcca atcgtgtgag tcgcgtagtg gttaatgagt cgtcttcatg    180780
     agtcgtaggc ttattcgtac atgagcacct tcaccgttac tggtcagaca tgtcaaatgc    180840
     atcgtctaac atctcaattg tataatctgt ttattttttt tattttttta tttaatattt    180900
     aatattttaa tcttaaaaat ataaaaccca tcgggtgctt catgttttcc tttcttcctc    180960
     tcatgtatca aacgcaagca tggttaacaa gatcggtcta cggggagctc tctccaaact    181020
     acgcaagtcg cctacccaac ctacacgtga gcgagagact cgagatattt caggtccaga    181080
     gattctccat ccggatctca tctatccgct tttcaagcgt cctgacccaa aggactcccc    181140
     catttattct cagttgatgt tccctcccac ttctcttcca actgtcccca tggcatccga    181200
     tgccaaactt gatcctcgag tcatggcttc taccatttca aacgcccgcc tgaatgctct    181260
     gcaatccgga gacgacctgg attcgttttt ccagaagagt aaggactgta ttgatgctta    181320
     cacccaggcc atcaaggcca tgatagagga tgcctctgtc cgcgtcaaga atggagagga    181380
     acctccattt gatgagatcg tccagatgaa ggagcgcttc ttcaagtact gccagacaat    181440
     tgtggaggaa gcattggccc tggtcgcacg agctcgagct gccagacacc tccagcagac    181500
     cgcagtttcc atcagctcga ccgtgccttc gctggtctcc tcaacttcaa ccccggcttg    181560
     gtatgagcca gacgtgccct gggacctcga ccgacctgat ggcaaagcag gattctcgga    181620
     ggcattggta agtgatttgt ctccgtgcat tggtctcact tttggagaga gttgacattg    181680
     actctgacct ctgatagctc gcgtctagcg gccgggaccg ccttcgtctc tacactgtga    181740
     gcagtgacga ctgggtcatg gtcccatcca tgccgtctcc cacatctcca accaagattg    181800
     tggcccccga caacatggac cctgttgagg aatcgattca tctcggtgcc atcgtgcgca    181860
     tcttcggcaa ggtgtacaca atgtcgaaga tgatggaggc aatcgccttc tattacggca    181920
     ctgaggtagg cctcgcccca atgcttcttc ctatctcttg cttcttggag gtgtaactgc    181980
     taacgccgac tttctactct tagcccgaca attccaagac tggtctgaca tactggatca    182040
     cacgcagcga gcaaaacgtg cgcactcagg agatggctgt gctgattgac attgtccaaa    182100
     atttgtatta cgccctctat gcccggctta ccattgagat ggccagcatt gacctctgcg    182160
     gttccttccc aatcgacgct cgtcgagtac gaatggagat tccgcacctt atgccagagg    182220
     ctaatcacct ctatcgcatc gcactggcct tcaaggaagt gctggactcc ccccaaatct    182280
     gtgccgtcct tcggaaagac atactcgcct acttccagga agcatatatc gatcagcctc    182340
     gagaagagaa acgccacttg tttacccctg atcgcgacga gtaccaccag tttgcgatga    182400
     caaccgtctc tcgccgacgt ggatcctact gtgagaaatg gggacaactg attccgttct    182460
     tcaactccgt ctcagcggaa accatggcat cactgtcaca gaagtatctc ctcttgagtc    182520
     catggcatat tccgcgtgac gacatcccat tcggcgacct tccatggctt agccaagacg    182580
     ctgtggggat ggaggtctgg gactcggatg ttgtgaacga aagacacttg tcagagaggg    182640
     cccaaattaa cggtacaggc atgggggacg agcgcaagaa agagcccatc cctgatcttt    182700
     actaccatgt cagacaagga aagtgcattt gcctgtctat ctgccaatgt tccttgcact    182760
     gtatctacag cctggagcac tgccgttgtt cggaacgaca tgtacgcatc atggcggcca    182820
     agcgtggatt tgcacacaga cggaatggcg gacctacttt cgccgctacc gcttccacaa    182880
     ttgctcgcaa gttcttcgat ggtttagctg agctcaagcg tgatgtcaag gacgatgtta    182940
     tcgccagtga attggagaat gctttcgaat tcttcgctca gtttatctcc aacgagcgcc    183000
     ttatgacacc cagtgaacgc tccgggaaga gctcctaaga gcaggagcag tctctcactt    183060
     catgatttac gatcagatca cgactacccc tacgatttac gattcacgat tcacgattcg    183120
     cagtcccgtc actccaacca cgacttacga tcacgatcac gactacgatt cacgattcag    183180
     tttccaatgg aagcacccaa aacgaaatca atgtgcaaaa aaaaaagtga aagtgaaaaa    183240
     gaacctcaaa aaagacaacg aaggtgacaa caaaaggagg aaaagctatg ggaggaagcc    183300
     aaagggcaat caacatcatt tgacagatat cgggaactga ccatgagcca tgtcatttat    183360
     ttgatgaagc accatgagag gtctacatat cctgtcttga aatgaattaa ttcagcccaa    183420
     gctgctacct aacgttccgt acagacttat cccaatagga cgatgcgacc tcatcaacag    183480
     cagagcacgc ggctgcacct tcaggaaccc atcataaggg atacattttg gaccaccttg    183540
     gcttcgcaag acactctacc ttggtattca tacctctgcc tcgtatctaa actccacagt    183600
     attgacaaac aaatcacctc catcggtgtc ttagggcatt ttgaagtatt tcccagctcc    183660
     agttagttca gggattggcg tgagactggc tatggtcttc acgctaatct tcaaccggtg    183720
     gacatattcg gatccttctt tttcaactcg ctaacttgtc ccgtagttca gtttgaaagc    183780
     actttgcatc tcttgctgac tcggctgata tagccattac tggaacatat gtgtgtacat    183840
     gtatccatgt acctatagac cagcttggaa gtcctgggag gattaactag tggaccggca    183900
     catagttaag taaatgtagc cctaagattc ccggggtttt ctattactac tgtataaaag    183960
     aaatagattc gggacaaatc taaagcaaaa ttaaggaaat ctactaggaa catttgaaac    184020
     aacaataaat agtaaaatac caaaatacca aaatgccaaa atgccgattt tgacgatttt    184080
     catattctca gagatactcc gtagtgtaag gtacaagaag gtacagtcgg cggcgcagac    184140
     cagtgatatc ttccatctct cggccctcgc cggtgagtcg caattttttt tacttttctt    184200
     tgctttacct aggtgagcca ggtctgagtc aaacccttat tttctggtct tctgcctctt    184260
     catctttcta cctttcatgc cttgatgccc cagaacccct tcgccgagcc catcttggtg    184320
     cacagagagc caagttaggg atggtgacca aggcagcggc tgtgtcacat tcgttatcat    184380
     cattatcatc attatcatcg acatcatgga cctccattag caagtggatc gcgaacataa    184440
     gcataaacca agccccggtc cagactgccc gtctccgaca accgagcaca gcacggccat    184500
     accacgcggc agtgtggccc tcctacggca tcaccactcc cgttcccgac cagcccttcg    184560
     tttcacccaa atctcccttt cgattcgaga ctggctacgc tctgtgtgcc aaacgaccct    184620
     cacgaccttt tcctccacct ttcctttccc caccctcgtc atccttctcc gatcctttaa    184680
     cgacccacgg gctaagccag gataagagat tatccgtcga gggcgagcta gtccgcggcc    184740
     tgaacaacgg agatgatgcc atcatcgtcg cggagaactt tataggcgtc gacgatggcg    184800
     taggcgcctg ggctacgaaa cctcgtggtc atgctgcgtg agtgatctca atctcaattt    184860
     ttaccagatg tcacgatcgc tgacgttttc cttccccgat acagactctg gtctagactc    184920
     ctattacact tctgggccct cgaggtcgaa aagaatttcg accaccacac gcctaccctc    184980
     gacccggtcg gatacctgca gtatgcatac gaggagacat tgcgggcaac aacatctcct    185040
     accgagtggc tcggcacaac aacttcggcc actgccatac tgcactgtac caaggaacga    185100
     gatggcacac agaagccact gctgtacgtt acaaacctgg gcgactgtaa gatcctcgtg    185160
     attcgaccaa gcgagaagaa agtacttttc cgcactgccg agcaatggca ttggttcgat    185220
     tgtcccatgc agcttggcac aaacagtgtc gacacacctc ggaaagatgc agtcttatcc    185280
     aaaatcgcgg tgcaggaaga cgacgtcgtc ctggcgctgt cggatggcgt catggataac    185340
     ctctgggaac atgaggttct aaaagtcgtt attgacagta ttgataaatg ggaggaaggc    185400
     cgcgcggcaa caaagaatgc tgcgcagcat cctcatctgt ctgatgaccg caatgtctat    185460
     gtcgcccggg aactgcttaa tgctgctctg acgattgccc aggatccctt tgcagagagt    185520
     cccttcatgg agaaggcagt ggaagagggt ctggctattg aaggaggcaa aatggatgat    185580
     atatccgtcg tgatcgcatc ctgcaaaaag agtgatggat gagagacagc tactggtttt    185640
     acgatcagac tttctttcac aaatatccac cgatcttgaa ttgcgcgtgt ctcggacttg    185700
     cgccagtttt cgtcgatacc gaatcttggc aggcattcat tcccggtcta gcatcaatac    185760
     gaaatgctca tatccatcgc aaaaagcttg tccagctaca tcgctattgc gcagatacgg    185820
     tgccttgcaa gtgtcaaatc aggatccaac catgcattgc agtgaaaatc ccaacccgcc    185880
     aaccccttga gaaggacttg cacatatctc cgggtgctcc agcgcgaggc atgattgctt    185940
     agcctcgctg gtcatcgtca tactcccatc cgttgtatcg tccatcaggt caggaactct    186000
     atatccagca gggaatttgc attggaactc cttgagttcc tgctgcaacc cgccaaactg    186060
     gtgattcctg cctataccaa acatccttgc tatcatattt gagactcctt ctttacatgt    186120
     atgtatgggc tcacctatga gggattccat tactggcgcg tgtggcctgt atgtcaatca    186180
     tataatagtt atttttcggt ctaaacagaa ctaataataa tatctcgtcg acaaatgcat    186240
     agtatactgt gttatttctc atctttaagt ctgtggacat cagtaaaatg tgaagtatga    186300
     ggtacttagt ttcaaggcta gatgccccac tttgacaaag tacttggtac ctcatcccca    186360
     gcacggacca gaacaccgcc gctcccgccc ggcagaatga aaaaaagttt cggtcgacgc    186420
     agaagctctt ggcttttgct gcattcaatc ctcgaatact tgacacacac cattcacaat    186480
     gagggccaag cgttcaaaga agtatcgcaa gcttatgcac cagtatgagc tcactttcgg    186540
     tttccgagag gcctatcagg tcctgggtat gttccattca atgcattgtt ctgatgtaca    186600
     tactgacttg cgctcgaaca gttgactcga atttccttcg cgccaccgac tccttcaaga    186660
     tggagctaat tcctgcgctt gaacgaacag tccaaggcaa ggtcaagcct cgtaagtcgc    186720
     accgaatccc acagtcccca tccgccaaga cgtattccaa ctaatgacct cacagtattg    186780
     acaaagtgct cgctcgccgc tatcatggcc gcacaaccca tcaatcccaa aaccgaaaag    186840
     ccataccgac ctctcttcct tccccctccc acagaactcc cgctccgcca ttgctcgcac    186900
     aatgcggact ccacgcccat cgacgaagtc gagtgcctcc tttcgctgct ttcacccaat    186960
     ccagactcaa agaagaataa ggagcactac attctggctt ccgccgatcc aatcgtgaga    187020
     aagacgaaca acagcgagaa ccagccccgc agacggaaaa cagaggaaga tcgtaaagaa    187080
     gaggaagcta tgcgccgttc tcacgcattg cgtgctggtg cccgctccat tcccggagtg    187140
     cctatcatct acgtcaagcg ctcagtgatg gtcctggagc cgatgagtgg gccgtccgag    187200
     atggtgcggg atggtcatga gcgtggaaag ttccgtgctg gattggatgt ggatcctatg    187260
     ctgggcaagc gcaagaggga tggtgaagct gatggcgaga gcgctgatga ggcggaaccg    187320
     aagaagaagc gcggtcctaa ggttaaagcg cctaatcctc tcagcgtgaa aaagcctaag    187380
     aagaagactg aggcgccggc acccaagaag gataagactg cccggaagga gatcgcggat    187440
     gatactgagc aacatgacgg cggtgaagct gccgcggcca agcccaagag gaaacgtcgt    187500
     catgctaaga gtggtcctcg tgaagatctc gaggctgccg agcctaatga ggccatggag    187560
     gttgacgctt gattggatct ttacggcata ggcgactcat gatgctggtt atcattgcat    187620
     gcattctcaa ccttatttca ctcctagggc gcggcgttca gatcggatgg gttatatcta    187680
     aaagttcaac cggtgtacat aatagtaatg tacatctgat atcattctag agatcgtacc    187740
     cagtacatcg tagattaagt gtttcgacac tggtgccaga taaaccatgg gaaagaagaa    187800
     gagcgaagtc cagtcgatgg tatatacatt tacatgttca gatattgtac aagtattctt    187860
     ccccagatga agtgagagga gataattctg cctgtcgcca tgcattctca cgagaagata    187920
     tcccagccga gcagcaatct cgaggccatg cggaaggcaa ccaccgatac caagcagcgg    187980
     tgctgtcttt caggtatgag tcaaatcaaa gaatagccat aaagagcaca ctccaaactc    188040
     cagtcccgga tatgatggca tatgcgcatc tcacagcagt ctattgcttc gcggcaccgg    188100
     tattagcagc cgcagcaaca ttcgccgccg ccgccggcgg tacagcaggc ccttgatcga    188160
     gctcgcgctc tttagcccag atctcttcaa tacgccggcg gttgctgcgc gcctcgtctc    188220
     ggttgcgctt tgcgcgctgg tatcgctctg cggataggca tttgttcacg tcgaccttga    188280
     tatcgttaca attgcccaaa gctttgtgta ggaatccttt ggcatgacac tcgtcgagag    188340
     cagtcatgat ctcttcgcag tctgtacgac atcagtcagt atcggcactt atgaagcggg    188400
     atgggatggc tagatggatc ttccgggtgc ggtggactcg acgtactggc attgtaggag    188460
     gtgtggaggt gagaatgcat tattgcggtg gtactaggac gaaaagaaga acgacttcaa    188520
     agacaaattg caagttcaat cgtacgatca acgcaaagca aggacattgt ggctccgcaa    188580
     aacccccggg cggtaagaag atcgggcaga ttctgccggg cggacagccc ctcacaccga    188640
     taaaaaaaat atcgccgata aaaaaagtgg acgggtgtga tcagtttcgt cacgacactt    188700
     tcacaatgtc ttccatgatt acaactacaa catgggtgag gcgtggtgtt gctgcccagt    188760
     tccctaccaa atatgagatc gacgaggccg agatgggccg tatatctaag cttgcccgca    188820
     tgcagctcga ggatgccaag gacgatatga atgctgccca ggatggttct ggagatgagg    188880
     ctgatgatgc tatggaggaa gatactgaag ggaagacctc agcaaccaat ggcaccgatt    188940
     caaaggagtg agtagtgttt agcgcagcga ggatttaact cgagctaatc gggtttacag    189000
     cgatgatgat gtgttgaagg aattcgacat ggataactac gacaaggagg aggtcgatga    189060
     tgacggcgag aaagtcacca tgttcggcaa tgtccaatcc ctggcctacc atcagcccaa    189120
     cgaggaagac ccgtaccttg tgatccccga ggacgaggat gatgaggagc gcgaggagct    189180
     ccagattatg ccccacgaca accttttatt ggccggaaag gtggaggacg aagttgcgca    189240
     cttggaggtc tacgtctacg aagacaaagc cgataacctc tatgtgcacc acgacatcat    189300
     gctgcctggc atcccgcttt gcacagagtg gcttgatatc cctgttggca agaacccaga    189360
     aggccgcaca caaggaaact ttgtggctat cggaaccatg gagcctgata ttgagatctg    189420
     ggatttggat gtcgtggact gcatgtaccc caatgccatt ctcggacagg gtggccagga    189480
     tgccgagaag acgaagaaga agcaaaagaa gaaggccaag gccaacgacg agtaccacat    189540
     cgatgcggtc ctagcgctgg ccgccaaccg tcagcaccgc aacctgcttg cgtcagcctc    189600
     agccgataag accgtcaagc tctgggacct aaccaccgcc acctgcgcca agtcctacac    189660
     caaccacaag gacaaggttt gctcactaga ctggcaccca acggagtcca ccatattgct    189720
     gagcggcagt tacgaccgca cggtagtggc agcagacatg cgtgcgccgg acgcccaggc    189780
     acgctggggc gtcgacgcag acgtcgagtg tgtgcgctgg gactcgcacg acccgaactt    189840
     cttctacgtg accaccgacg gcggcatggt gtaccgctac gacatgcgca atatccccac    189900
     cacccccgcc gagtccaagc ccgtctggtc tctgcaagca cacgactcct ccgtttcatc    189960
     cttcgacatc aaccgcacca tccccggctt ccttgtgacc ggttcaacag acaagaccgt    190020
     caagctgtgg agcgtcgaga atgacaagcc cactctggtt gtcacgcgca agctcgaggt    190080
     cggcaaggtg ttctctgcta actttgctcc tgaccaggag gtcagcttcc ggttggccgt    190140
     tgctggtagc aagggtaatg tgcagatctg ggatgcttcg actaacggcg ctgtccgtcg    190200
     tgcatttgtg tctcgcatgc ctgaccttgc tggtgatgtc caggagcgca ctgttggtat    190260
     caatcctgat aatgacgatt ctgatgacga tgaggaggtg gagggtgacg agggtgagcc    190320
     tcgtggtggt gatggctggg agtcgatgga tgaggactag atggacacag atacccgtgg    190380
     atccttccgt ttcatatgcg ccaaaaatag atttgctgtt gggttttgcg tgttaatgac    190440
     cagtttgtta tgaagttttg gaaatatgag aacaattcca atcatattca atcgttgaca    190500
     tacatatgta tgttgtaata taactacacg tccacgggta gtcactacat aggtaacagt    190560
     tcgaggtagt gcactctacc gtgacgccgt accttatgat gccctacagc ctgaattatt    190620
     gtttaatagc tgaacgtgta aatctcctta tccacgtggt actacgcttg gttcgattgg    190680
     acccacataa tacaacctta tccttactcc aaatcaccta attgaggtgt catgaaacaa    190740
     tatctccttc attacttagg cacatttgac tagacagacc gagtcccgca caaatccagt    190800
     ttttgtgcag ttttgacaca atgagcacag tgcgggctgg actattggct gtgatcaagt    190860
     catcatccta tgtatgtgag tgctggcttc gaattcgata ttcgacattg actactcacc    190920
     ccataaacaa tactggcaaa gtttgacaaa ttgcaccttc caatcaaaga ttgcttagga    190980
     gtaaatgcgc tactaggtag caagaaacaa aaaaaaggtg tataaacaat gacagtagac    191040
     ttgaattggc tggtacaaac aaagaaattc gaagctctaa ccctgcactc ggaacgtgcg    191100
     accactagca gtcttgcgct cacgttcttc attctccggt cgagctcggt tgagtactgt    191160
     tgggggttag cagtgaacat actttccttg cttgaatgac acataccctg aaggaaatcc    191220
     gctgttctct tcctcattcg agtgtggatg taagcctgca ataaaggttt agtcatcgat    191280
     tccttggaac cttggaaata tccaaacaag cccgagagaa actgcgtacc tttgaggctt    191340
     tgatgtggta gtggaaataa tcacggaagg tctggatgtg ggaaatgttt tcatagcgac    191400
     gctgcggggt caggtgtcga gggaacagaa ctgaaagccg agtcagtact aagatggaaa    191460
     ttgatggcac actttgcatt cataccaaag gtgacatagc taacttcgcc tccaggagca    191520
     ctcaaaccag gcacatttgc aagctcaagg ggagggtcgt tacggaacag gacttgaggg    191580
     gcattctgaa gcgtcaagac acgtcgccgg gcgtcgacga attcctatag gatgttaata    191640
     agggttcctc gtggatccac agaccagttg aggcaaagta caaacctgca ggaagacctt    191700
     gccaaagatg cggtctgtct cttcgcggaa cacggtgctg aagatcactg tgactcggtc    191760
     ccaattggct ttgatataga tagcctcctc ttcacggtag tggatcgcca taacttcacc    191820
     gccctcctgg ataccctgtg gtgctgactc tgacgtgtat ctggaagcct cctccgcgag    191880
     cttgttgaat tcatcgaatg ctctctcaaa gggagcagcc attgcgttcc gtttcaggag    191940
     ggcaagcttc ataatcagga cattccgggc ctcctcctct gcgggcagat tttcgagatc    192000
     gacttgtact gagaaatcat atcccggctc cggagacaca atgtagggac cgtattctct    192060
     ctccaacacc tcctgggccc cgtactgaac cagttccttg tagcacttca cattgatcga    192120
     gatgaggatc ttcgtcttag actcgggagt ggagagatga aatgtcacac cgtcgaagtc    192180
     ggaaaccact tggtcaatgg aggcgggggg tgctctgagt ccagcttgtt agccgggtgc    192240
     ctgcttcggg gtgatctgta tacaatgcgc ggggtcgcag tgctaagggg gaggaacaaa    192300
     gcatacccag aaaaacgctc cgtgaggagt gactggatca aagcattctg ataatctaag    192360
     agaagcatga cgggcaggac aatggatggt atacagtgca aatgggtggc tgttgtgagg    192420
     ttactcgtga tcgtcatggg cggtgggggg agccggagag gtcgctgtca ccgcccgtat    192480
     taattttgtc ctatcgatag caatcggaga ttccaaaaat tttcccatcc gccttcaacg    192540
     atggtgaaat catacttgta cgtgcgattt tttgtccttt ggaattccct gatctgggcg    192600
     ctaaccctta tgcagtaaat tcgagcattc gaatacattc gggctcgtcg cttcggcgtc    192660
     ttcgaatgcg gtttgggcca aagacgatca gaccggcatt gcacgtcaga cgggcgctgg    192720
     acgagccatt gtcggcgcaa gtgaggaagt cttgtgctgg gatgtaaaga agggtgaact    192780
     ccttggaaga tggcgcgatt ctgcctgcag agcgcaggtt actgtggtca ctcagagcat    192840
     gacagatgaa gatatattcg cagttgggtg agtgtcctcc aatgtggcct agtcgggtga    192900
     tattggctaa ctgttatgtt tcttttcagc tacgaggacg gaagtattcg tctttgggat    192960
     tcacgcaccg ccacggtcat tatttctttc aacggtcaca aatccgcagt taccaagttg    193020
     gccttcgaca acgcaggcgt gcgcctcgct agtggctcga aagataccga tatcatcctc    193080
     tgggatttga tcactgagac cggtcttttc agacttcgcg ggcacaccga tcagatcaca    193140
     tcgctacatt tcctattccc gtcccccgaa ttactcactg cttccgggtt gagtgaacac    193200
     tcagggttcc tattaactac cggaaaggat gcattgatca aagtctggga tctggcctct    193260
     cagcattgca tcgagacaca tgtggcacaa tcaaatggcg agtgctggag cttgggtctt    193320
     tcacctgacc agggcggatg tatcacagct ggcaatgatg gtgaacttag ggtttggtcg    193380
     attgacgagg cggctatgat ggagatttcc agggagaagg tgggcgcaga tggtcgccga    193440
     attctcaccg aacgaggaac tttctaccgg catggcaagg accgcacaat tggcatccga    193500
     ttccaccccc gtgcagacta tgttggatta cacggttccg acaagtcggt cgaggtttgg    193560
     cgcattcgct ctcagtcgga ggtccaaaag agtatggccc ggaagaagaa gagaagaaag    193620
     gagaaggagg ctcgcaccga ggagaatgga ccagaacagg ataacgataa gcctgaggat    193680
     gtttccgccg ctcccgtgtc tgaagtcttt gtccaacatg ttatcgtgcg aacaggcgga    193740
     aaggttcgtt cctttgactg gatgaccaac aagtcgagtg gcttgaacct ccttgccgca    193800
     acaacaaaca accagcttga agcctacaac gttgtgccag cgaacaagaa gaatgccgac    193860
     agcgaggatc cggactacac tcggagcttg gcagtggaca ttcctggcca ccgtacagat    193920
     atccggtcga ttgcattgag ctccgacgac cgaatgcttg cctctgcttc aaatggcact    193980
     ctcaagattt ggaacgttcg caccgaaagt tgtctacgaa cactagaatg tggatattcc    194040
     ttgtgttcag cattccttcc gggagataag attgtggttg ttggtaacaa gaacggagaa    194100
     ctcgaggtgt ttgacatcgc atcctcgaca ttgctcgaca ccatcaaagc ccacgacgga    194160
     cccgtgtggt cacttcatgt gcacccagat ggcaagtcta tggtcagtgg aagtgcagac    194220
     aagacagcca agttttggaa tttccaggtt gtccaggagg agatcccggg aaccaagcgt    194280
     accacccccc gcctcaagct ggcacacaca agaacgctga aggtcaacga cgatatcctc    194340
     aaccttcgct tctctccgga tgcacgactt ctggcggttt ctctcttaga caacaccgtg    194400
     aaggtcttct tcgtcgactc gctgaagcta ttcctcaacc tttacgggca caagcttccg    194460
     gttttgaaca tggatatttc ctatgacagc aagctaattg ttacttgctc ggctgataag    194520
     accgttcgac tctggggttt ggactttggt gactgccaca aggccctctt ggcccacgat    194580
     gacagtatta tggcagtggc attcgttcct cacaacaagg atggaaacgg tcacaacttc    194640
     ttcagtgcaa gcaaggaccg taacatcaaa tactgggacg gtgacaagtt cgaacaaatc    194700
     cagcgccttg ttggtcacca cggcgagatc tgggcacttg ccatgagcca cactggtgat    194760
     ttcatcgtca gtgccagtca cgacaagagc atccgcatct ggcagcaaac agatgagccg    194820
     ttgttcctgg aggaagaacg tgagaaggag atggaagagg cttacgacag cacacttacc    194880
     gcatccctcg agcaggagga cggtgaagac ggcgagaagg ctgaggccgt cgatgcgggc    194940
     aagcagacga ccggcactct catggccgga gaaaagatca tggaagctct ggaactaggc    195000
     ctcgaggatc tcgaagtcgt acgcgactgg cgcagggtca aggccgtcaa ccccaacgct    195060
     gccccgcccg atcgtaaccc cgtctacctg gctctcaaca acgtctccgc cgagcagcac    195120
     gttctgaaca ccgtccagaa gatccccgcc gctgccctcc aggacgctct cttggttcta    195180
     ccattctcca aactctccgc tctcttcacc ttcctcaaca tctgggccga tcgcgaatgg    195240
     aacgtgcccc tcacctgccg cgtgttattc ttcatcctga agacgcacca ccgccagatc    195300
     gttgccagca agatgatgcg tcctatgctc gacagcattc gggcatccct tcgtcgggtc    195360
     cttgcccgtc agaaggacga gatgggcttc aacctttccg cgctgcagtt cattggcaac    195420
     cagatccgtg agcagagtac cacggactac gttgatgagg agacttggga ggagcagcag    195480
     gcctccaagg gcacgggcaa gaagcgccag tttgtcagcg ttgcctaagt ttacctagga    195540
     ttaggtttgt gtacaagcat gtctattggc gttatgatca ttttcgacct tgttaccttg    195600
     gaggtcttct ctatactggt ttccatataa aagttttata tccttaggag ttgaagaaaa    195660
     tataaggaat gtatgatagt tcaatttcga agtcaaatat aatcttttcc ctgggatgtc    195720
     tactgaattt tcataaatat aagtgtatag caaagtataa ttcattcaat tggtctagct    195780
     attatattct cccacgggca acaatccaag cagtcgacga tatgaaaaaa aaaaaaaaaa    195840
     agaaaagaaa agatgtcaga aatctgcatt gcaaaaatca ttagcgattt attccaaagc    195900
     aacgacgcgt cgccttttcc caagatcaca accaagaaaa gaaacaacaa gcatccaaag    195960
     actctactca ggagaaccat tataagcatc gacgacaggg ctttcagcct ctgccatacc    196020
     tcttccggct cttcctatta aaaattccgg ttctaatgcg aatctcatca tgatagagtc    196080
     tgtttggtgc gatgcttgtt gttccttcac tggtcctgtc agggggggtt tagtaccaca    196140
     tacctattag tgggttcttc cagcatgaac cgaagatcaa tctcatttct tggtctcggt    196200
     ccacactgga cttttgctgt tggttggagc tggagaagaa gaaagagttc agttgggagt    196260
     tttgtgagaa aatttggccc ggtggagctc cgttagtcat gttggtcacg tgctgatgtt    196320
     ttttatgggg ctctactgta cccctgggta atcgatttcg ggatttgtat aaaattggta    196380
     tggaaattca atattcaatc aaggttcatt gtcatactgg tatatgtttc ataatggtca    196440
     taatcccctg tttcaaggca tgtggtggtg aactatctcg agatatgatc aagaggacgg    196500
     cttcattgtc ccacaacaag aacaagtcca ccactgggtc tccataaagc tactgcacga    196560
     gatgcagacc catccaagag gcttcttgtc tgcaccccgg tccaaggatt tcagggtatc    196620
     aagtgcacgg gttcggttct tgaaaacaaa tggatccccg ggattcgttt gcttctcttc    196680
     ctttcgatca atagataaag gccttttctt tgggttttgt gactccaaat gcactggttg    196740
     ggtggaatct tggccggggg tggacgtaga tagcgtattg gttggaggtg gtcgttctgc    196800
     tgcacaaaca tcacaacaca ggaaggtaga cgggttctcg agcgtgcaca ttgggcagat    196860
     ccacggtgtt tcgtaagagc tgttatccgc tgtgagatca acagctttat tgcgatccaa    196920
     tgacggagct tcttttggaa gcacaggcaa agattcagag atagcaggcg ggatgtcgga    196980
     agcagtaggt ggcggtgatg attctgctcg aggtcccgcc gggttttctt gacttggggg    197040
     gacatatgac gactcgtatt tctccctttc ttcttcctgt atcagctcta taaaggcctc    197100
     catgatagca cgctcgtttg catcgtcttc ctcagcctgg gtcctgaaac catgcgaggc    197160
     ttcttccgca agctcggtgc ttcgatcagt accggatgcg cagccctgag ttacttcgat    197220
     tcgccgctgc gcagcgtcag cccggagctt gcgtatatct gtccctcgga gcacgcgagt    197280
     gccgccaagc tttttgccgg aatttttagc aagaactctc cgctgttcag cagctgcacg    197340
     agcctgacgt cgggcttcat ccagcgggat tctttggccg cctaggcgct ttccttgaga    197400
     caagaatccc tctccagtgt agccttttcg ggctagttcc tcatgctcat cacgaagttg    197460
     attccacaaa gcatgaaact gctggttgtg aggaccgatc acattgtggg acagtctaga    197520
     tttcatcaga atttgcgcat attttggggt atttagatac aaattcactc actcatgaag    197580
     catagtatct ataacctgct cgatggggag aaattgccgt tgatcggagg gataccgtaa    197640
     tcttaaacag atcttttggc ccgagttgac attcagcccc agcagatttc gctgctgggg    197700
     atagaactca cagagtgcgc ccactttcca ggcgcgctgc cgcatgatcg gtttgaccag    197760
     cgatgcgact ttgcgcagga tcaagagggc ctctgcctct cgggggcgtt tcttttcgtg    197820
     gcggtattcc gagatcagag ggtctagctc ccgcattttc gtgattttag atcaaaaact    197880
     tcgatggtac ggtaaaaaaa aggatgccgc aagtatgaag atgttactgc cttctttggg    197940
     atggcctcct ccgagacgag ggatgtaagc aggcagattt cacatcagaa catgaccaaa    198000
     tggtagcact acacagatag tggtgcaggt agccaggaac agtcaagggg acatggccag    198060
     tgatggaaat tccagaattt atccaagttt gggacatcca tggatggcct tctccagggc    198120
     tgcccagcat agttagttga ctaactaact aacctaacgt aagcaaggca cacgttgaac    198180
     gcccgatatt tcaggctata ttgaagatca cgtggcttcc acatagtcgt ggtgcaatga    198240
     tgcttttcca atcatgtacg atggtagtag atatgattag aatagaatta ggactgatct    198300
     ccggggctat gcccaggtaa tactaagagc cgtcaaagcg atgattattc ctcaatcttg    198360
     tctatgcagt tgcatcatct tggcccagat atatattcat agcatctcaa catagtacag    198420
     cagttgagtt gttgaaaatc atattttggt gattttccac taattctgat taaagaaggt    198480
     ttccaaaaat caacagtaac aacccaaagg acataattag tccagtatac tccaccaccc    198540
     ttaacagttt tatacaaagc gctgctcatg tgacctttcc gataacactc tcggtgttat    198600
     cagcatccat ccatcttatc gaactttcgc tcttcttttt ctttccagct tgttcttaaa    198660
     gtaaacaaga tgacgagcga cgaccagttc ttttttgact acgtgagtgt tatggaagga    198720
     gacaaagaaa taccttcggt gctgatactt cctcacccag ctcgcggcta taccccatga    198780
     cgtaaggcgg tattccctcg aagtcgcaga ctcgatcgac cgacaagttg atcatgccgc    198840
     gcacgcgatc aaggatatgc tggcccagca gtcatggcta ccaccaactg ttcgtccggc    198900
     tcgtgtttct cccagaaacc ggccatctca aggcctgaca gaccggattc aaagctggat    198960
     gggtcggaat cgcgcattca cggcagccat cctcgcattt atcggaaccg gtgttgtctt    199020
     atactatgga aacaagaagt tgcacggaaa acggagaaag gcccgaaggg cgagcaacgg    199080
     tgcaaggaaa gagattgttg gtatgtgtca taatgtccgc attcgatctg cgctgggatc    199140
     tgggtgctaa ttttgtgatt atagttgttg ccggttcgcc gcatgagccg atgacaaggg    199200
     ctattgccat ggatttggaa cgtcgagggt atattgtata tgtgactgta tcttccgcgg    199260
     atgaagagca tatcgtcaag gctgagaacc gtgttgacgt caaggctctc tggttggacc    199320
     ttacaaccgt gagtgctgtt cgtgtatctc ttgtacggac caaactaaca ttgtgcacta    199380
     gacatcctcc tcaccgtccg aaatccatcc ttcgttgcaa gagcttcgct ccttgatcac    199440
     tcaaccacag tcgcctatcg ccggagtgcc tccgcacacc tgccaactga gcggccttat    199500
     cgtggtcccg tccccgaact atagctcagg ccctgtcgcg accatcccgc catcttcgtg    199560
     ggccgacacg gtcaacaccc gtctcctctc gcctatcctc acagtgcagg cattcctccc    199620
     cctgctgacc ctccgcagca ataatagcac tattgtgttt gcctatccct ccatatcatc    199680
     ctccctttcc gctccatttg ctggaccgga agtcgccaca gcccgagcaa tctcaggctt    199740
     cgcagcctcg cttcgccaag agcttcgtct tctcgaacaa ggcaatgttg acgtcgtcga    199800
     gttgcagctg ggaaacattg acttggggcc cacatataga agcggccaga accagatcgc    199860
     aggcacagaa gttcttgcat ggagtaccca gcagcgagcc ctttatgcct cacagtatct    199920
     gtccagcgtt gaacagcgac cagttgcctc tgctggtcct agcacagtcc gcggatcccc    199980
     ggcgcggaac ctccactacg ctattttgga tgctttggag cccacctcgc gcgatatgtt    200040
     cggccggaaa gtgtccaaga aatctgtcct gtatgtgggc cggggagccc ggtcgtacag    200100
     cctaatcggg gcctgggttc caagcggact cgtggcgctg atgatggggt accgcagtgg    200160
     gaatgggatg aactcggaga ccccgagtgg cagcggaagt gaaaccggtt gggagagagt    200220
     ttaagctctg gcacatctcc agggcgcttc catatttaat atatcaaaag cctcgcttga    200280
     ataatgctct tctgtacata atatcattgg aaatactctt cgctcttaat gcactgttct    200340
     gcttgatttg attttatcaa tccaacgtat cgtttaacct catagaggca attgttagat    200400
     taggagttac ttagggtatg atcggtatca tgaagcgtca tcccatccct aaccgcctag    200460
     gcaatttcca ccagaagaag taaaccgacc catcacctcc ccataaaccg gcatactctt    200520
     catctcattc aattgctcac caccacacgt cccggcaaaa gcatcgtgcg cgcgtagcgg    200580
     atcccttctc gcccgcttaa tcttaccgtg tgtcaggcgg cggcgcaaat ggatcagggc    200640
     ccaggaaacg aggaagagaa ccagaaccgc agccaagatg ccaaaacagt attccatcac    200700
     aagaatgctc ttctttccat ggtcaccgac gtcgaggaac gagtacgggt accagccctc    200760
     ggttgcatga gttatgtatg caacgcagag atagagcagg agcatgagga gtaggaacgg    200820
     gattgcaata aatgggtgcg gcgctgtggc tgggagtacg atttccagca gggcgtagac    200880
     ggagttcagg cagtgtaggg agatctggtg aaccggtggg ttagcttgaa ctgtggcttt    200940
     cattaattgt cttttgcctc tgcatcagcg gattagagga gtgttgccgg gaaattggaa    201000
     aggagggctt gtgatatttc gatgccggtg ctcgggtgct tccttaggat tgagcttact    201060
     gactgagccc ggtttctttg gcgggatatc gaaaagaaag gaataggaag atgatacgta    201120
     cattttgcca gccggtgaat atcttccagg ggggagcgaa gagcagagcc cagtagacaa    201180
     tcgtaacgag aaacgggtac gtcgtgactg tcacatacaa caggctgtgt agtacgcgga    201240
     aggctcgcgg ccaacggtcg aggagaaacg agtgccccgt tcgtgcatag caggctgtat    201300
     ggatagcggc gaagagcatg tagaagccaa taccccagta actcagccag gtgaagtagc    201360
     tgaaggagtg accaatcgaa gcgcggttat cgtgagtgcc ataccaaccc cagaagatga    201420
     agatggtgac gaaaatgtac agtgagatta gaccgcgaag acagacgagg atggcaggag    201480
     gtaagatcca agacgtctcg aagtggtgct cgtcatcggt aatcgggtcg actccgaaga    201540
     gactcgttag tgagagtcga ggcatgctgt tgcgtggctt gcgattccgt tgtactcgag    201600
     gatgattgaa gttaaagaag gaaataaaca agaaaagaag atagagatgt atatgtacta    201660
     gctcagacag gcagcaagct ggcatctagg tgatgacatt gaagccggag gtacttctgt    201720
     ctgtttttcc ccacgatata gactgacctc gcaagcggtt ctacgccttt agcggtcaga    201780
     ttaggaggac cactgtgtgc aggaagtatt gctctcagtt tcaacttaga tccattctgt    201840
     ccccaccagc gctgatcatt cacaccaaaa gagtttgaag gcttgtgatt gaatctgacg    201900
     ttgaatcaga atcagaagtg agtctaactg atagagagca aggccgaaat ctaagattgt    201960
     ccaatatgta tctagagcga gctacgtcgg gcaaaaagta attatagagt tctgggacta    202020
     ctgatgtata ccttcttctt ctcgccttta agggctgttc taggtcctta tgtacatgga    202080
     gatagataca tacgactagg tacataatga atctcatttt aacttgctta gcagctgcca    202140
     ccttcagata gcttaggcat cgtttggctg caaaggagag ctgctgcgtc ccgactccca    202200
     gccattcaca ggctcagatg gccagacatt agaaagaatc tgtgctagtc tctccggaac    202260
     ggatctttca tctgagcctt gaaatcgcga ctggttaata atctcccttt cccttttccc    202320
     aatttcccta atagtcggta cgcccacgtt ttggaaattg tagcgtgtga tcaaaaacga    202380
     acgagagaac caatcaagga gccgatgctc atcattcggg aggaactcaa gaccaaaagg    202440
     cacgacacga aggttctgta ggcggcggga agcttgatta gatgagatca agtgccagat    202500
     ctggagagcg agtttctcat ccattgccgc attcacaaat atcttttgaa gaacggatgt    202560
     ctcgacttca tgcgttgggt ctaccggccg cggtctcgga tcgaaatgaa gatccagtac    202620
     aagactatgg aggtttgaaa agccccccac agccttgtac atttcgcact cttcttgacc    202680
     gccaatggat cttttgattg gaagacggag ttcctcaagc tggggacagg atttggctag    202740
     ctggcttatg ccaaaggcat caagctctgg atatttatac ccagagtcct cctccgtcct    202800
     gcccttgtcc cgaatgcacg gcacaatgat aagacctttt agagaaggac catgtcgctg    202860
     tacgatttgg ttcagagaaa aggcgctgcg aaagccgcga agatggagat aaaccagggg    202920
     attgaatgcc cttattgcag agactccaat atcatcgtca cttttgagat ctggacagcg    202980
     ccaaccgcgt ccatttgtcg agatagacag tcgctcgagg ttgggcaaaa gcccagctaa    203040
     ccgtgcaaga tggatgagtc ggataactca tcaagtctaa gggaccgaag ctgggaaata    203100
     cccgcgatac tggccagctt tagtaggata ttttcgggtg gcccggattc accgatcgaa    203160
     atcgaatgca aggaagatac cggcacgggt tgtgtggaaa ccgcaagatt gtgccattct    203220
     tgcttcagca tagcgactgg gagtcgatgg gccgtggaac ttttccgtaa gagaaggtgc    203280
     ttcaaattgg gagccaaaag aaggaaaggc agcatttcgt caatctctac ccagcggcct    203340
     ttgctatcag atctgctcgg gatttggacg gacaatgtat gcaacccctc gagacgtaga    203400
     agattgatat cgatgccggc gaagtcgtca ttgctcatta tcttcctcac tcgagggcag    203460
     gtttggtttt ttaaacctgg gacgctggag gtcacgttct gcggccagaa aatcttcagc    203520
     tgacatttcg ggtggtgctg tgatatagct tcctgcagag agatgggaaa atcgttccga    203580
     acgagaaatt cgatctctgc tagatggcac aagcgggcaa cgagggcagc aagtggctgc    203640
     cagtctcttt cccattgccg atagttcgac caacctttga ggaggaggac tcctgaggca    203700
     taagataaag taggatctgt caaatggtcc tctagaaagg tgtcttgcgt tgcagggtca    203760
     tcttggccga cacgagtatt tcccaacttg cagccttcca actgccagac gcgatcctgt    203820
     ggtgaattgc ctaaacctgg attgagacat ataacagata aattcctagc gtgtttcacg    203880
     aactgacgcc cctggccacc ctctgttaat tcagagacgg tttttcggag actttgggca    203940
     tcccagaact tgatagaaag gcgttgataa aagagcgggg cggctatttc ataacaagtg    204000
     tgattgagcc gactgaaagc tgagagtgtt gtacgtgaat ccaacccatc agcatgaagc    204060
     taaaggtttt agtgtctcac cagaaaaaga gtgcgcgagg tgacatacac tgagacatat    204120
     ttggcgcaat atttccggtg gaagatgatt cattctgttt aatgggttgc aacctggatg    204180
     tgttaaaata tgagaactat tgaagacaga aaagagattc acgtgggctt tgcttaaagt    204240
     gccattgcca aggccataat accttactaa ctcggtatgg tttattgaaa tttcgtatat    204300
     ttacagacct attttaacaa acgacatata ggggacggtg tcactgatga ccttgtggct    204360
     attaatcttg cgatctccga gggaggaagg tgtcgtgcca actgcggctc gagcaccact    204420
     catccggcgt tcatttactt cccctcgggc acgtatctcg tcagctcttc aattatccag    204480
     tactatatat atctgcaaag agaaactagc taatatagcc agctagaaaa gcgaaggttg    204540
     acaaactagg catcgtcctg tctcaacaca aagtaaaggc acaaaacact aaaagtctag    204600
     aaagatctag caaaaaggat gcagagtcaa taagaattgg aagagctgtt atactacacg    204660
     aaagtagcac ctgcctcgag atgtagcacc acgttcttta tttaaggtcc ttgaaagtct    204720
     tgttcttctt taagaaatcc acccacacga tcggtttatc ctccagaagc cttaaggctc    204780
     tcttccaacg gcttagaacc aaagtatccg tcttcataaa caaggcgcat catctccagg    204840
     aactctaccg ctgcccaatg cgacaccccc gtcgagtctt taaacccctg caggaacatt    204900
     tcgtatggca gactaaagaa gccggccacc ttactagcct ctgggaaggc ctgcttgaac    204960
     ccgtcgacag gagttgtata cttcgtagca cctagtacac gcttccccag cagctggtct    205020
     cgctttcgta caattgcctt gacctagatt ccagagttgc gagcgtcgaa caagggaata    205080
     ggtgcggttt caggcatcgg tagtgcgaac atccaggcat tctctagtag gttctgtcta    205140
     aaagccccac taagagactt tatatacatc cccggtagga aggtggccgg ataccgactt    205200
     atttagtact cctcaatctt agccttgccg tcgaattgat agacgcgctg ttcagggggt    205260
     tgctgtctga ggggatgtat ttgtgcaaag atataagagc tgggaaacat ccaaagagga    205320
     agagtttaaa tcaactagtt ttggtagttt aaatgttgcc aagtgttgcc aagaagcggc    205380
     ttcgaaatcg catcagaaca cgatatcata ctagctccgt gttgatggct aattattgat    205440
     ggctagtgtc tttaggaaag atgttattct tcttcactcg ggggatcaca cacacaggga    205500
     tttgcttgat cattgcgggg ttcaatatgt gcgtcagctc tataagagct gatcttatct    205560
     agaccagtat ctaacttagg gaagtatgtg aatccaagaa agagaaagtg ttggctctat    205620
     ttatagactt gatgtatatt cttgagttcc ccgttggtac ctaggtacct aggtatactt    205680
     ccaaggttca gtccatggac cgagtacctg ggtacctcgg tagggaataa ccttggaagt    205740
     ggcactattc ccaactaggg atagtggtgc ccacggacca cggttcagtt gactcaaaag    205800
     gacgcgtaaa ttgcccattt catcccagac acttcaagtt ataagatgga tggtggtact    205860
     attaagatct aaaagcaatt cagtatataa cagttttgaa tctgatttca ttgggttata    205920
     tatccatccc actagaacct atttaaaccc tttaggagtg tggtaccctc cttgttccaa    205980
     aatataagta ggggatggtt tcacttctct cattgttagg ttgttaatct gaaaggctcg    206040
     actgtcctga attttgtatc tcgctaggca ccagttatgt ttccaggtta tacttatgaa    206100
     ataacacaaa tttcaagttc ttcaacggga aatgatgaaa ccacccgttg tggggagaga    206160
     cggcagagga actcggattc tagaagatag cgggtcaaac aaaaccttca ggtttatgga    206220
     ggagcacatt tacaattatg atatacggag tacacaatat acaacatagt aaaattagag    206280
     aaatcaatag tagacctttt ccaaggtgat agatatctaa tagaatagaa tccaataaca    206340
     ataatatgcg actctttgtt attcttggcg accccctgaa cagtttcccc gttccccctg    206400
     agacgatccc ttgtcaaaac gtcgagaccc agtctgtttt tagtgcacgg gacgcttcta    206460
     tttacttact cttgtcacgg tgttccaagg ttgggatcgt cagttgtcct ccgttgtcct    206520
     ccgtttttct ccttattcct cttgagaaga gacttctaaa ctcactaaac tcactgcact    206580
     cactgaactt ccttccttgc ttcaattttt cgtccgtagg gctgtcattc ctttggctct    206640
     ataatatcgc ccccgcccga gacacccccc ctttgtgtgt gttatccgca actccggcct    206700
     cgtttcggaa acaccaactc cacgactact ccgatgcttc ctgcgcaaat ctcgaaagat    206760
     ccaaccgact tgggataaat gattcaatag ccgacaattt gatattcaca tactcatcat    206820
     ggacatgcga gggaaactgg gcgaatgtcg ctccatatcc cacgataccc tgcggagtgg    206880
     ctccccacgg gtcgcgcatt ttgacggcga agtccctccc gcactttctc ctctcgacgc    206940
     attcgccgct cagagccgat ttcttgcccg acaactcgat gagtctcggc gaggagaccg    207000
     ccgcatgagt cggctgccgc cgtcgagtgt agctcgatcg ctttcgcaag gccgcccggg    207060
     cttctaccgt tccaagtcgt caactgaatc ccgcaccgaa ctaacccggc aacccaccca    207120
     gaagggactc ccggaatatg aagagcccaa gtaccgccct atctccgagc atcctcggtt    207180
     gagctcaatt tcccatgcta gcacagaggc tagctattac gaggatgatg ataataatgc    207240
     gacccctcgg acaacgatgc ttaatactgg ttcggaggcg tatgggatgc cgcgcgccga    207300
     gtcaccagag gatctcgcgc aacgcgtgag tgaagcggaa ggtgcccccg ttggcgtggc    207360
     ggtcgctgag ccgcaaggtt catcgatgga ctcgcccacc tcgcgactgg acatcccacg    207420
     caccttggca ccaccagtgt caccgcggtc gcgcccatcc agcagtgcca aggtggcaca    207480
     ccctgagagt tctgatgatg actatagcag ctccaatgct gggtcgacgt tctccaacgc    207540
     tcgcaagctg tcctctggaa gtgccgtgtc attgccatat tctcccatgt cgacattccc    207600
     tgcccggcca caccctcgat cgccatcgtt gagctcggag acatcaggca cgggagcgaa    207660
     ccagctacct cgcccttctt ttaatttttc tcggccgctg agccggtcaa gtacgagctt    207720
     gtccgctcct ggagctacga cgcctaccga accgatcctt ccctctggat cgaaccatat    207780
     gtaccgccgc agcaagccga ctccgctcct cttgcaaacc gaagatgccg ctgaaacgcc    207840
     agccaacgat ggcgagccgt cgtccgcggt ctcatcttac gtttacgcca agtatgcgct    207900
     cccacgcggg cgcttccttt cacgggattc tgtggtcttt gcaggcttgc agacgcctca    207960
     cttcgagtgg gaggagccct tgtttgagaa aacgcccccc agaaatacag aggagccgcg    208020
     gatggcacgg acgccatctc ctacgcccaa tcgccaattt gagcactcgc cgaagcctca    208080
     ctcaatgtac gaggttccgg cttccaagcc tcggtcaccg accccgacat tccagcctca    208140
     atctccgcct caatccccgc ctcagcctca atccccacct cagcttcaac ctcagacccc    208200
     caagtctcaa caagtcccac aacccctacc tgtacctctc tcaccggcgg aagcggcacg    208260
     gcgcccctct gccgaaagca ctcggcagac gactaatgaa aaggatgaga ctgtctcttc    208320
     tgcgggttcg gccagcacca tgcggcccca aaccgccaat cctcaggtga cggcttctgg    208380
     tctcacggcc gatgaccatg tcgctaaggg cattgaatgt cacgagcgag gatccctgag    208440
     tgagtcgacg tatcacctgc gggttgccgc gaagcaggac catccgacgg gaatgctgct    208500
     ttatgcactg gcgtgtcgac acggctgggg catgcgatcc aatgagaagg agggtgtgcg    208560
     atggttgcgc aaagctgtgg attccgtcgg attggaaatg ttggccgatc cggatgctcc    208620
     gggtgcgtcg aaggcgaagg aattgcaaaa ggcataccgg gttcaatttg ctctgagcat    208680
     ctatgaactg ggtgtcagct acctgaatgg ctggggtatt gagcaggaca agtctcttgc    208740
     tctgcgctgc ttcgagatcg ccgggcaatg gggcgatgtt gacgccatgg ccgaggccgg    208800
     attctgctac gcggagggtg ttggctgtaa aaaggatatg aagaaggcgg cacggtttta    208860
     tcgccaggct gagtccaagg gtatgagcat ggttggaaac agctggtacg tttcttctga    208920
     gtagttatat cccgattgaa cttactaaca agtatacgca ggatctacaa ggacaaatac    208980
     aacgaggtcg agtccgctgg acgctcccgt ggccgaaatg ccggggagaa ggacaagaag    209040
     ccgcgtagca agtcccgcac tcgcagtatt ttccaacgca agaagtccaa cgtatcagag    209100
     gcatagactg tctgtttcat tcactttgtc tcgacgcgtt ctcctgggag aaccatccat    209160
     tttgcatttt gcatcattgg agcgttctga gccgattgtt tttttttttt ttctatttcc    209220
     tttcgacttt ttcgacttac attccttcac tttctcatgt ctattttttt ctattttttt    209280
     ctatttttcc ctttcacatt tgcatctttc gagcctgggc agttatcgag catggactct    209340
     gtccacgtgc ctcgcaggct taatacttca attctccgtg tatacccttt tgttcctttt    209400
     ctttcttctt catttcttcc catcatttgc catttctttt tctattcttt tcttactttg    209460
     gcatctttca ccattttctc ttcttggtca tatttctcgg gtatgatccc ttggacactt    209520
     tttctattgt ctattttttg aattctccta tttctcatat ttcgatgcct gcgactcatg    209580
     aactcatgac agaatcaaga cagcgttgat ctgtatcttt actagcattc gatattctcc    209640
     tcaatatatc agagtaataa gttctagacc cccgcattgt tccccggctt tctcggagca    209700
     ttgacctaaa tggtgtttag attggcctct tgtctccggg gataccctaa aacatattgg    209760
     cattcttttg tcttttgcct tagcggggat ttagcgggga ttagcgggat tagcggggtt    209820
     tgatctgacc agttcgattc ttccctccct ccaaaatctt ctgaatacgg gggagcacac    209880
     cccttgcatc cagggtcgcc ccccttggca gcacgctatc ctgctgctag tctcactgcc    209940
     caccaatgag gaccctgttc atgcaatatt atagtgcaac ggtactccat atgagtatct    210000
     tgtagaaggt cccccaaatc tcgcatagca cttaggaaac gctctggtag gacagatgca    210060
     cccgtcccga cgcatcccgc ttattagtat cctattcgtg tcttagtcca cctcggcttt    210120
     ccttttcttt catgtggtga tgcttagact cccttaactt gaaacagtat acacatgtta    210180
     atcgtatctc cccggaaatc tggagtaccc cagacgctaa agtgatacct gggcctatat    210240
     tctccatatc aaatgagatg ccaaaaataa cccaaaatac ccaaaatacc caaaataacg    210300
     ggaaatgaga agaagggtct actcttacct aggtactttg cacgacattt cccctttctt    210360
     ttttggcgtt tggtggcttt tcctgtataa catgtgatgc tggaatatac caggcgctgt    210420
     tcattttagt tcactatggt ggatctttaa tataaaagta cggactacta ccctccttta    210480
     gtgcttgtac cactttcgtt tccctctctt tttccttcga agctcttctc ttgtaggtgt    210540
     tcgactcggt atgtactttg gccctagaac cctcttacag tcccctaaca caagtcacag    210600
     tggcaagatg tcgaccacaa agccctcatt cgtcgaggag gaatccagcg taaccccgac    210660
     accaaccaag aagagcttcg gtgcacgtct cgccgcccat ttcaagaaat ggtggtgggt    210720
     gcacctgatc atattcatcg cctgtttcct aattatccta ctgccggtgt aagtccatcc    210780
     caattaattt aaatatgaac catgcagacg ccacacgggc cagaaagaaa tatcccactc    210840
     acgccacact gcgtctagtg tctacgtcgc gtatcccaag atcgcacaag atgccgtcaa    210900
     cgactcgacc ctcgatatca gggagatgat catcagcgac ccaacgcctg aatccttcca    210960
     cctcgagcag agacaagtcc tcggctcgga tagcccttat catcccaaga tttacaagtt    211020
     caattctgcg gtctccttgg ccggtgcgga ccctttcgct tatgttgaag ttccagaagt    211080
     gaagtcaaag gatggggtgg agattcactt cgaacagaag gttgatctca cggatgcatc    211140
     tgcgttcgga gattatacta ctgctgttat gttgaatgag gaggtttcgt tgaatatcta    211200
     tggaagacct gatttgaagc agggtggtct acctaaggtt actgttgatt ataacaagac    211260
     cgttgtaatg aagggtatgt ttcctcttct tggtttcttc attccatcag tctagaggga    211320
     tcatggctta ctaaactgaa tgaaacaggc ctgaaccaac tcaagggctt cgaagtggcc    211380
     gaattctcca tcatgttccc acccgtgaat ggatacggga tgaacggcac ggtcattatt    211440
     cccaatgcct cggtcatgac cattccaatg gtaaataccc ctgcacatct cattgcatat    211500
     ccacaacact aacccaagga atagggcaat gtgacactga aactcgagct agacggtaga    211560
     ccagtgggaa caacctacct gaacaaccta gtcctgaaac caggcaacaa cactgtccca    211620
     atgatgggca aggtcgacca aggcgctatc ataaccctcc tcacatcaga taccaacccc    211680
     tacaaagacg gcgtcctgcc cttcgacatc accgggaccg cgacctcgta caacgggaag    211740
     gaactgccgt actttaccaa ggcgctggct gcgattacac tgcatgtcaa gctggatgtc    211800
     ggggctgcgt tggcgaaggc cgggattaaa cttaccttgt agttggttgt gtggttgtat    211860
     accatttctg tttatgttta tgtttatggt tcatgttcga cgttctactt ttctatattt    211920
     tattaccgta accggtagtt gaattcggtg gttggtatgt gctgtttgga gatttggtga    211980
     ctttgtgtat atttaatacc cttctttttg tttatcagca tgcgccatga atataatttc    212040
     cagtatctct gggacagttt ctaataagaa aaccagaacc gaggatattg agtgagttgt    212100
     actgctggac ctggccccgt gtgggctgga cctagagggc ttcaggaagg cagcctcgtc    212160
     agggttgtta ccctgcaacg ttcccctgaa ccccggaggc tagaagctca aagtgcgggc    212220
     gaggcgctcc tcggccgatg atgcaaagta tctcccgaaa cggacgcttg catcatctga    212280
     ctgctgtcca ccacagtgta gctcaatcgt ccgatcaagg gccgtataaa aggcctttgc    212340
     ctgtatatcg cggggcttct gcagaatgtt gaaaatagcg gttctcgcag gatggaagct    212400
     ggtagaagtc cccagcaaga cacatatccc tccaaagtga tgaagtaatg ttcccaggag    212460
     cgggggaaga tctcatgaca cagctgctcg atccaaaaca gcaatcgctg actaggacat    212520
     tgtgcgacat ggagtcgctt ccattggcaa atttgaactc cttaggaaag cgcttttgtg    212580
     cgaggtctgg gtcgttgcca tgcccaagcg ggtattgcct gcatgtctga agagttgtcg    212640
     attgtgcgtc gcatatcgac gaaaggcgga ggcgaccatg aggccgactg tgaatgcgct    212700
     gctggcaacc ttgatgttta tgtcattttg tctagccatg ctgcgcaaag cagagcgtgt    212760
     cgctggccgc ttagtgccgc agtgtctccg atagtttatg tgtccagaac agggtcacgg    212820
     aattgcataa caggaagcga cgctggctca ctcgcctatg gagctgcgga attcccaact    212880
     acaggaagct ttccctcctt ttcggcttca gtctcggacg attgctccag gactcttgtg    212940
     tagcctcgtg gaactgccat agtcgggtcg tcaaggggtt tcacttaggt agatgcggac    213000
     tgacagcagt gattaattcg cgggtgaggg ttgggcctct ctgcaatgga gttcaggggt    213060
     gtcctctggt acatttcgtt tccagaatct gtgggttctc ggtaggcgct tgggacccga    213120
     aaatacatgc agttttggca tctgttgcag cgtggacaag agcacagaaa cacgcggcct    213180
     ttcttcatga atggaataat gcaggagtcc tgacaatatc gaacgcaggt ctggataata    213240
     tttggagtac aacagctttg ataatggggc agatggagtc ccagccttgt cggagttcac    213300
     gcgaagactc gattaaccgc taagaaggat agcgattatc atcatttctc tcctttggtg    213360
     gtcgttatag agagcgacag cattgtgcat gcgtgctata attatatata gaacctaagt    213420
     ctccctcggt tgcagggtgg ttggttgtta ccatccttga actccagcag ggacggggag    213480
     ctcgagattc ccgctgtcct gtaggtatga caattccttt tcacactcca ggaaatcgct    213540
     taattttagg cgatactaga aagtcaaact gtatgatata cataatgatg aatgccagag    213600
     tggaaaggat gcgagagata aagagaagac tagggagagc gaatttaaat ggcaagggga    213660
     aactacgcaa aggattatgt cattctcttt catacctatg caaaacacct gcaggtaagc    213720
     cacctacctg ggttatgtag ttgtcggaaa ttcaagatgc attctatagg agcctgcata    213780
     ttcacgggcc taaatagttt gaagctcact ctttgtctct ttagttcttg gaagatggta    213840
     agctgcagta cttctctcct caacactaca cgctgtacct gcagcactag catgagttgg    213900
     cctggttaat gaagtcaaaa gaagcaaata gtcttgcatt aattcccttg tatctgagac    213960
     tttgctcaaa gtcttcggca gacaaggttg gactccactt gaggaaagtc ttgcagttgg    214020
     tatagaaggg ttggcgtaga tgcgtgatga agatctgtta tatgtcggag atgatcagcc    214080
     agcatatcgt agagtatttg tcctagatgc tgcatgacct tgcatgagtc acccacagaa    214140
     gtacagacta tattggtctg cgcttcatga taccttgcca gattttaata gttcaattga    214200
     agcgatgaga tgtacaaatt tctggttagc acacataaaa caaagaggcc aggacatcta    214260
     gtaaacacta atattcctga ttgccgaggt gaggttgagt ctcggctgat atcaacaaac    214320
     atacccaagg gaagaagagc agggaagtcc agattccgag tgaaataatg tcatgtacag    214380
     catctgaagt tgccaagagc agctgataac aacttggtct agccgatcat cttcgcttct    214440
     ctgagctttt tcacaacata ctcctcatta gctgaattca cgaggattcc atccgcagcc    214500
     gctaggaatc caccttcagc cttattaact tcgcgatatt tcccctccca actgtatata    214560
     acatccccat ggcgctgctg gtcgttaaaa agaagcgcca cactcttagc gacaacctcc    214620
     ggcccttgaa caccgacacc aagcccctca ataaaagcag catcaatcat cttacttgct    214680
     gtccaagaag gcgcaacagc attaagtcga accttccctt caagttgatg ccctatcccg    214740
     tggataagcc ccagaacacc atgtttggtg accgtgtaat cacccgcact gaagttctga    214800
     aacgaagccg tagaagcatt gaccacgata ctgcccagtt cgccagatgc acgatgtgcc    214860
     gagttcttct ggatgtaata cgcggcaaga cggactgtgg agataacgcc cagaagattg    214920
     acattgatcg tccgtagatc aggcggggta aggtggccgt tttcgtcaag gttgtcgttc    214980
     aggaaatcgg tcgttggccc gatgcctgca ttggcgaaga catggtctat acgaccgaac    215040
     cagtcttcaa cctggagaaa tgcggcaagt tggctttccc acgaacagac gtccagttgt    215100
     ataaacttga ggttctcgga ggtttcgagg tcggatggta aagagttcag gtcgccgatg    215160
     attacagtcg cgccgtgctt aagacataac tctgctgttg ctttaccgat tcctgatgcg    215220
     ccgcctggtt tcattagcat ttctgattca aggtctatga tgatcgaatg agaatatgcg    215280
     taccagtaat gagaactacc ttatccttca ttccctcaag gatagcatcg caaacttgta    215340
     cagccgccat ggtttgagat gttggatagg gcaaatgcta agtcctggag tttgcggggg    215400
     ttatatattt ctggatattt gacaagccga ggttgaagta ggacagatga aactagactg    215460
     catccaatta cgctaagcgc ctaacacgtc tacggggtat taggcgccag gaaaagtcat    215520
     agtatgagat acaatgaatt cacgcgaaca tgatctggga ggcgttaaaa gtaaatcgta    215580
     gggctgtcta gtctttgata ctagaatctt atgcttaaca tggctctcaa cagataactc    215640
     tattattctc tctccatagc ccaaagagtc gcagatgact ttgaccgttt ccaacttcca    215700
     gtctgacttt ccaaacgcct gatgcttggc tggatgcatg gctcttttat attgatcaac    215760
     ggttctatgg agaacaaagc cacctgggac actgggtgtc ttgccgtgaa cttttggttt    215820
     gcgctctatg tatgtgaact gaactacata aacaagggac ttaaggatag ggatttcatt    215880
     gtctggctac tagtctgtat ggatgtcatg tcagggtgtt tatcgagttg acggcgattg    215940
     tcgcatgcaa aaagcaagta tgatagtgtc tgaacatcaa ttcaaattga atataataag    216000
     tgcggacgcc gctcctaaac cgatttatca tgcgctgacc ccatagggct gatgcggatg    216060
     agacatgcca agatcatagc aggttactcg accacgttca ggatgtttcc tattgtgcta    216120
     taatctctcg accattaccc tatctccaaa tactcgacca ttttctccct cgcgcgctca    216180
     acctgatcct gtacatctag atcccaaagc cacttcaaac gttgatcaag tgtttccctc    216240
     agctttaccg gatcatcccg aactccatca caacacagac aaaagatatc tgcattctcc    216300
     ttgctgctag taacaaccct ttggctcctg ggtcgacgaa cctcatcgta tgccttgaaa    216360
     gccgcaacaa catcgtcgac agaactgacc cgagaatcac ccagtagttc cgcgagaaca    216420
     tgcgcatcct caatagcctg accagcgccc gcaccctgat gcggcgtcga agcatgcgcg    216480
     gcatcaccga gaatcgcaat tcgggagcga gcataggttg agatatgcgg atgctcgaag    216540
     atagcccact gggatggatc gggcatatgc tatagaacca aggtaagtaa ttcaacgtct    216600
     agcaaaggca ccaaatcgca aacaaaaaac aagaacatac ctcaacaaga gccttcacat    216660
     atcgccccat atccctcgta tcccgttcaa tatcctccct cctcgcaggc ctcacccaag    216720
     aatcatattc ccacggctgg gaactcaaaa cataaatacc aatattaacc aaacggcccc    216780
     gcataatagg atacgaaagc gcatagacgc ctcgaccgag ataaatcgtc gccacatgcg    216840
     ccctcttctc cccgaccgcc ttaaccatat cccccatctc aagtacagct cggtacccat    216900
     acatgccact atagacgggt ttcgtgcgca gcgattcaac gggcatcatg cactccttaa    216960
     cccttgagcg aataccatca caaccaacga cgacatccgc atcgacgacg tctccatcct    217020
     cgaagcccag taccacgcgg tcatcatgtt caacgacggt gtttactctc ttcccgaaat    217080
     gcacgatatc agatgggatc aggtcaacaa gggcatttag gaaatccgct ctccggagcg    217140
     cggtctggcc ggagggtaag gcttttaggt tcattaggac atttccttct tgtggacctg    217200
     ttgcccagac gagctcgaac caggtttgga ggtattcttc gtagccgggg ctgtctgcgt    217260
     gtgttgttat gagggagttg tagatttgtt ggattgccgg gtggattagg ggcattgcgc    217320
     ggtatgctgc tggacctagg gagattccta gacctattcc tttgaaggat ggggctgctt    217380
     cgtagatttg gactgggact ttgcggaggt gtaggcctgc tgctagggct aggccgccta    217440
     ttccgccgtc tattattgtt attgtgggtt tgcgtgacat cttttgggtt gatggagagt    217500
     tggttgggat agggattggt cattagaggc cttaaatagt tctttgggtt caattctatc    217560
     tgttagtact ttcgcgaaat tgtacattgt cgataaggtt gggaatctta gtatgccatg    217620
     cagccacatg ggcctgtgga gttacgtgac actggtgatt agtacgacaa tgactgtatg    217680
     tccgacgtcg gggagtcaga tcgaggggga taaccttttt gaatacagga cttttgcaat    217740
     ggaagatgac ggattggaca ggcgtcagtg aagtaagtgg gttatcgggc atcccgtggt    217800
     ggcactcgat ctgcactgtt agcgcggggc gtgtaatttg ccgagaagtg cacagcatgg    217860
     acgacggggt ctacatcata gggaaggtat tggtatggat gctgtttaca gggatcgtct    217920
     tgaaggggag aagtatatgt tgacattaaa cctggaaggg tacaagatag tgccaatcgt    217980
     caggaatcgt gcgtttgcat gtgcaactct aatttgtcgt gtctgtctca atccatgaga    218040
     gaagagagcg gacatgtgct cgacatgtag ctcagcgcgg tgaccttggt cgaagtcgcg    218100
     atcctgtcgc ggggattccc ctggttccga agtggcgcat tgacatatgc agaagaaccg    218160
     acaagcctga agtacatcgt accgttcggg cagtctagaa tatagaaggg aaaaaaggtt    218220
     gaacgctaga aagaaggggg gaaaaagttg catctcttgc aacatgggaa aaaaaaaaga    218280
     tttcaaatca tgggagcggt cacaacccgc tgacgctccc actttggagg accgaacgga    218340
     tcatcacggg aatagatatc cgaccgatcc caatcggagt cactgtccgc aatacccgcg    218400
     tgcttatcat ccgacctcag cgccggtgaa atgtcagagt catctagcgc gcgacggaag    218460
     cgcaggaact gccgcgactc cgcggtatga ccgggctgca tcatgcccat gcccgactgc    218520
     atggactcga gtgctgcacg ctgcagatcg cgaatatcat cgcgcagacc accgacttgt    218580
     gtctccaggt ttctgcgcgc tgtttgttca cgacgcagga gcgtgactag cgtactgtac    218640
     tgctcgatcg agacgccgtg gtagtcggac aaggaggtgg ctgatggggc ggggcggagg    218700
     gtgcgcgggg tcattgtgtc tgcgcggatt gtgcttgtgc tggaagggcg ggcggatatg    218760
     gtggggaggg ggcttgggga ttcatcgcgg tcgctcgtgg ataggaatgc ggagggtttg    218820
     ttgcgcatgt gaggggggaa ggagtctgat gaaggggggt gtcgcgggcg ggatagtttt    218880
     tcggtggggt tttcggggct gttagtttgc agtcgggcaa tggcaaattc caggtcgatt    218940
     agtttcactt ctagcgtggt caaccgctct tccagagtga cgctgtcatc ttgctgcatt    219000
     gtgttgacta gacttgcgac attcgacggg aggctgggtt gctctgcgtg ctcttcgacc    219060
     tccatcaagg atggtgcggc ggacattcgg gtcacactgg ttactgttgt tcccgatgag    219120
     ggtcttcccg actgcccact attagagctc tcatctaatg gcggggaccg cgaaccagga    219180
     accgatgctg gcctgggagg ggcggatgat gtgcgttgtg gccaagagac tagggtctct    219240
     ggtaggttat ctgttatttc acgcaaagca tctgtgcttc ttgataggcg gtgggagagc    219300
     aagctgtgtc ttcgctctgg cgcatggctc ctatcctctt gcggatcaga tatcgccgac    219360
     gcgacggcga accgagattc atcatctgaa aagaccacgc tgggaagagt tgcccgtctt    219420
     cggcgtggca tgccaccggg cattgaatca cgcagggttg gagagaatag aggagataac    219480
     ggagacaggt gtgtttctgc gatctggagg ttctccgccg agagtggact acttcggtgt    219540
     gaattcaaat tcagaggagg cggagcagcc aacattgatc tccctttcgt cggtactgat    219600
     ttccgcatgg gggtcgccgg aaaagtagat tcgtacgggt tctcttccag ttcatcggcc    219660
     tgactttgtc ttttgcggtt gaagatcttg cgcatcactg ttttcaaggt gctcccggtg    219720
     cgacgatggg caatagacgg ctgggggtga tgagagtgaa attccattga cggcagcgcc    219780
     gtgtcatcgt tgtctcccat gtaaagtgca gggttcgaag cggagcgctc tccccgggca    219840
     gaggatcgtt gtagactccc aacagactcg ctaccggcgc tcgctatgga ccgtgggggg    219900
     tttctcgaca tggcgatggc gtaaggtcgc aatcaacaaa tgggcaggga agatataaaa    219960
     tatcgacttc attaaaagca atatgggtat atggcgcaaa agagttgaaa aggaaaaaga    220020
     tttcaagcga gtgtcgggaa ataaaatgaa aagggtataa gggtatcaat tcgaataaag    220080
     gctggaattc agttgagact attgaaagct atcaaacgca agttagcaag ttagctgagg    220140
     gaaggtgata caaacggaac gtacgttata atcaacatag tgaagacctt cccgtttgtc    220200
     ctggaaacaa agagaaaaaa aggaatgaaa gtgagaacaa aggggggtag aaaggaaggg    220260
     aagttgggaa gttgggaagt tgggaagttg gagattaggg gagaaacaga ggagagagag    220320
     acagctatta tccccacacc ggttcttcca acaggtttgg aagaaaatga gatatgtgga    220380
     catggaactt tgaaataaaa ggcttatagg tttatagatg tttagaatgg taatcttcta    220440
     ttctactctg cttctacggg aaaataggtg caagtctgaa acacatgaag ataccgagtt    220500
     tcaacttcaa cttgaaatag cccaagtaac ccaattagtc cattccacgt cgtgtcttta    220560
     taagaacccg gaataacccc tcagttcatc tccctacata tgttgtatat tataagtcct    220620
     gtatccaaag gggcaagaat tcaccctatt ctcttttggg aaatgcatct ccgactctta    220680
     tagaaacgat cgacaagttc ggtgtttcaa aataccttaa cccccccatg tcccgaacag    220740
     tttcggcctg agtccggaga gtatttgagt tgttggactt cttttacccc ctgttctccc    220800
     ttgcataggc cgtgcacccg gtattaagat ttaatctatt tctactacgg agtagtatag    220860
     gacatcctgg acgatcggca ttgttctgga acttgttggg acttcttgat ctgcgaaagt    220920
     tggaaaagtc ccaatcatag caaatctcca gcatcaggat atcgtaggtc agcattttct    220980
     tcaaggaagt tcatccagtg cttgaggaag ctactcccac tgttaaaaaa aaaaaagaat    221040
     gtcgatcagt attaaaccct caaacctcaa actcaatggc tcatcccgca cttactgact    221100
     gatcgtctcc gaatctccgc aaatacacaa atgtcgcttg ggccgcgtca tggcaactac    221160
     gtgcagcttc gtcaatatat tgaattcgct gcaggtacaa tacctgcaca gttgcaacag    221220
     tccgcagaaa aaggggggag aagcatacca ttcaatcttc gcttctcacc caggaaaccc    221280
     acttcatgct ccgcattgct gcgcaccagg cttaccacaa cggcttcttt ctcccggccc    221340
     tggaatccat ccacactgcc aagttcaaga ccggcgtatt tctcccgtag catccgtgac    221400
     agtagagcca attgcccgtt gtaaggggtg atcacggcaa tgctctcggg cctgataccc    221460
     gcgtcaatta gattgtccac gtgtctggca accaccatgg cttccatctc gttgcttttg    221520
     ctgtctccaa gcaaggctcc cttttggctg atctcatcct ctgccttctc ggggaaatct    221580
     ccgccttgcg tgtcccagaa taccaggggt tcctgtgtgt cgtctgtgcc ctctacttcg    221640
     tagggtaaat cgatcagtag acgggctttc accgcgtcgc tggccatcaa cttttcctcg    221700
     tagagttcgt cggaggggaa gcgcatgatc ttctcatgca tacggtattg ggtggtcaac    221760
     atgcgtttga tccccggtcc gtgcagggct agtagacgat cgaataatgt gcgttccaga    221820
     gagacacctt tcaatgtctc agtgtcggtg ttgttaccag tcttttcttc ggttcccttg    221880
     gaagtttgat ctttggagtt ctggccggtg gacttgacgg tcggtggtaa ttgcaggtgg    221940
     tcaccggcca ggacaacctt atctgcacct aaaagaggaa tccaacattg tgcttcgaga    222000
     gcttgactcg cctcgtcgat aatcacaaca tcgaacttct ggttcttgag ttggtgacca    222060
     ccggcaccgt gaagagtagc caacaccacg ctactctcgc gcaccagatt gtccacgcat    222120
     ttagactcgc gctctcggaa ctccttccgg agcagcttca aatcgtcata gatcccccgc    222180
     ctttcacgac cagacctggt cttgcgaatg ctagcctgtt tctcgtcaat ttccttgcga    222240
     atatccttca caataccccc agcatcagag gtctgcgtaa gaacttcaag ggaatgctca    222300
     agaacagaag gaagcagacg agccggatgc ccgatgcgca ccacaggtac tttcttggga    222360
     gccagacgtt cgacgatatt atcaacagaa acattggatg gcccgcaaac aagcacgcgc    222420
     tttctccgct gaaccaattg caagatcaat tcaataagcg tatgtgtctt gcccgtccca    222480
     ggcggaccat gaatcaaagc aatatcccgc gaagctagcg cgaactgaat agcctccttc    222540
     tgcgaatcat tgagggaggg atcggtaaac tccacaggcc cacacgcctc ggtatccaac    222600
     tggagcggcg tcgtatgtcc aaacgcaaca cgcataaaat gcgaatattc cgactccgac    222660
     atcttaacca tcttctccat agtctgcctc atcctagccc aaagtcagca aatcaatatc    222720
     cgaaaggatc cccactccaa tcttccagcc aacgtacctt ctatacgtaa catcattagc    222780
     aagcttgata gcccacacct tcttccccca aagctcccca acagcctcgt catcctcctt    222840
     agacatcccc ccaccaccct gccgcccaaa cgcaatccac acagcgcgat caccagtacg    222900
     cgtaacaacg ccctcaaccc ccttctccgc atccttctct ttctccttat ctttatcctt    222960
     cccgaccttc ttccctggcc ccgtaacatc actaacgcgc acaacatccc cgacacggat    223020
     cccatgtgac ccgagacgag gcgtcccatc ggcagcccgg gattcttctg atgcgactgc    223080
     tgggtccggg gcgaactcgc ctacgacgcg tccgccgaga ccggtccggc attgcgagag    223140
     gatgaggcct gttagggcgt agccggttgc ttggagggtt cgacgggttg agggggagac    223200
     tgttgcggct gtgctggcga gttttgaaga ggagacttcg gcggcgtgtt cttcgtggag    223260
     gaggttgagt tgggttgagg cgaagagggg gattgggatt ggggttggag ggggcattat    223320
     gggtggcggg ggttttgcgc gtggttgtat ggagttcggg ggttcggatt tgcgtatagg    223380
     aaggcgctct cgtgaaatgg cactgccgga gttggtgttg acgccttcca caggttgttg    223440
     cttggcgggg ataaagaagc ttcggtcacc ttatgtccgc gggggtgctt cgattggctg    223500
     tggatttgga ggctcctgag ggttccacct ggggtattgc tgtccaggtg tgtacaacct    223560
     ttgacgcaat ataatatatt ataatatatt cctgacatgt gtacgtttga tgaaaatcaa    223620
     aaatcaacaa ccgagagcta atacataaaa catgaaaaca ccatgtccct ccacgcgggg    223680
     cagccaaaat ggtttagagg acccgatgac tcctaagaat ctagggccct gaagatacct    223740
     aactacctac ctaggtatgt acgaactaac tcggggtgac gctggaaatg ccacgaaaaa    223800
     taataagtag aagtaccgga ttagattttc agcatacaaa actcatgtgt cctagctatt    223860
     ttcagtttga cacaagtctt catccagtcc gtacgccaaa cccgagaaag cacccccaaa    223920
     tcgtattgca tagttgataa acaatgatgg tgcgcggtca agagttccaa ggagccgacg    223980
     ttctggtcgg agatgtgtag gcaaagaaag acgcaattca aggattttgg gatggcctgc    224040
     aactcggatg cgacaccctg ggcctctcca tttccgccca cttgtttcat taataccgcc    224100
     tgggacaaga cattggcgat cctttttctc gtggcaatca ggacatatgt accgacgacc    224160
     aggcggggta caggccaagc caatgcactt tgtatgtttc cagacataac acaaggagca    224220
     acaaacagca gcatccattg catccaattg accgcaacac ggaactgatg agtcgaagtg    224280
     ccgcactctg aaatcaccaa actgaggtac tgaagaataa taccaacgtt caaccgccaa    224340
     agaagatctg caaaaggaca aaatgtctcg aggtgttagt gctctgagta tcatatcaaa    224400
     tatttcagga ggcatattta tgccccacct ttccctatga gcaagtgatt ccttccagca    224460
     ggaagaggac aaaacatgtg taagtgcacg gaaaccaggt gaacattgct ctgctgatgt    224520
     attgacaacc agtgggagca cctcggatct ccccacaaac tctggggaaa gctcaacaaa    224580
     ttgaacatgg cgcaatgaaa cgaggattaa tcgagctttc tgagacactc tgctgtaacc    224640
     attgagcaac gtcttagctc gcagaactgc tgcagtcact gatgagttcg tatcaagcgt    224700
     atcacagata acgacaagga aaccgtgaaa ccaaaatata tgtgtttctg gactatccca    224760
     gccaggaaca gatctaaagc cgattggcag ttcaacccga ctatcgatgt cctcgtgtgt    224820
     tatttcaagg tcccatgcag caagacgtag aacagcgata acaagtgtat taagcagtgt    224880
     tgatgggtac tgccataatg tgtgatcgtc gatatagaac ctccattgga agataaagtc    224940
     cgtaaaaaac cgaaattgga gctcattcag cggtgttggt gcatcaaagt tgatttccaa    225000
     atctccagag acaatatgct cggtttgttt cccagatgtc agattcagag ttcgctctaa    225060
     aggtctgctt gctttctgaa gtagagactc aaacgataga tctggagctt cgtgaacttc    225120
     tgcaagttta attcggaaaa ctgatggtca aatcccatca gttttttccc atatagagat    225180
     tgttatggat gcggtatcca ggtcgactgt gtagacataa tccaaaccgg aatgtggtgg    225240
     gcttgggaaa gagacctctt cccaaccatc aggtttgttc tttgcctctt gaagctgttt    225300
     tattttctgg aatgtggctt catcgcctgg agaactggta cgtgcttgag ggtggcaata    225360
     gcgaaaccat ttgcctgcaa cacatggtaa gcacacttga atcgactttg catcagatgt    225420
     gagaatacca ttaatctgca gattccaaag acctctggtg accattttat tgaagtaaaa    225480
     ctcgattgta ctagtgtagc tttgttccga ctgtaaaatt tggcttcatt aacagggacc    225540
     tgagtctggt atttggagga tgcagctatc agcaacccct tataatgaag aagcagcgat    225600
     ggagggcgac tttatagagc acgcacagcg atctaagcgg caatgggacg ctaaacctaa    225660
     acaggaacgc tataccgctt ctatgtagta attcagctca cccaagagta tggtgtacat    225720
     ttggcgtacc tcaaaatgaa aataacatgc tttcctttag acctggatat gataggtacc    225780
     ttgggtaagt accttgtccc ttggacagag cggcagatga aacatcaagc tggactcagt    225840
     acccaacatt tcggccaata gtataatcgg aatgttgacc agaggggtga gggtgctaat    225900
     aatagattat cttggatgta ccatatgcag cttctgtggc atcggtcgag ctgatcacgt    225960
     tcgaggtgtt tcaggttgat gaaggagaat atcgtatcgc taacgaaagg cctcctgtca    226020
     cgtcaggtgt atctaatgat atgcttcagc tgattccaat caaggtgaga aaaagggcgt    226080
     tataggtcca actctggcaa agggcttctc cagacggcga attgagaacg acatccgcga    226140
     ctccacagac aatctcgcgc cttcaaatcc cagcaggtca tctaggatct gaccactgag    226200
     gatgccccct ttttattgat tgttcaaacg gagggtgcaa aaagtggtgt aagtgtgttg    226260
     ttcgatgtca ctgttgaagt aggatgaaga ctgcgtggtt tcaagtgtag gaagaagacg    226320
     gttgaaatga acgaaaaggg catttcgacg tggcctctgg taaagatgcc accgttgctt    226380
     gaccattgta ctcccgtacc gatctaaata catatgtaga ccctgtagtc cttcaaggaa    226440
     atctatttta tacgcaagta cgtcgggtgt cgggtgtgaa ttagttcgta tgtagtattt    226500
     gaatcttagc tcgagatgca cctgtattga caccgtctgg gttaaagccc atagaaaggc    226560
     ggtatgataa agcatcctcc attcgtagtt ggtctttaac tagtagcgtt caaaggaatg    226620
     atgacgctaa cgccttccgt tgttggttct actaagccct gcggcagtcc agtccgttga    226680
     gcgtccgtac atagaatgac attcaaacaa gtcttcatca gcgggaaagc agggagtgcc    226740
     gttgatgtct gtgacaacag atcctttaac tcttcgagtc agaggaggtg gcttcttcgg    226800
     gcggccccat gttagccgca gggttggttg aatgagacat ctcagtgccg ttttggatct    226860
     tgtggcctgt gataggcgac ggccaagcgc tgagaattgt gcctggaggc caacagcggc    226920
     aacgattatt tggcaacgca gccagggatt gcccaatggg gtgtttagcc cgtgcgccgt    226980
     gcgatatttc cgattcaaag tcacagtttc gaaggccggg gtttcttcca cgaagaagaa    227040
     tcatatcggt aaagaattgt atcgagcgag taagctgatg ccgcgctttc ccatccagag    227100
     aagcatgaac catataaatt cgaccaacca gcgcaatctc aagtctcaat caaagagcct    227160
     caatcttaac cttgggctca tcaacctcag gactctgctt aaccttcatc gtcggcttaa    227220
     gccctcgaat ctcactcttg caaagccgca agcgcgccag ctcacaatcc ccacagcgac    227280
     gcttaacagg caaacaaacc gtctgcccaa ggccaacgag taaatgatta atctcatgcc    227340
     acttattacg cggcaaccat gactgaagcg cctccctcgt ctcctcgggg gtcttggtct    227400
     tattccaacc ccagagattg gtaatgcgat gaacatgcac atcgacaccg attcccacgt    227460
     gttcacccca tgccgcgctc atacataggt aagccatttt gggtccgacc ccgggaagcg    227520
     ccatgaggcc ctctggagtc gaaggaatat cgcctccatg ctggtctcgc aagatcagcg    227580
     ctgttgcttt gatgtatttt gttttgttgt tgtggaagcc gaccgtgcgg atgagttcgt    227640
     ttagtcgcgt tgggtccacg gataggatgt tatttaggtt gagggtgctg tcaacagtct    227700
     ttgaatcatc gtcttcttgt ttaatcttga tatcctgagc tggggcggtg ccgtctccga    227760
     gctccgtgtg gagacgttgc atcgctactg ccgtaactgt gtctttcgtc tgggatgaga    227820
     gcatcaacgc gacaagtgtc tggaatcgac ggtctattgg ggatgacgcg cgccagaata    227880
     gctgcgagca gcccattgtg tctactggtg catctgcagc ggggccatct ttcctcatct    227940
     cttgcacaat tccgtacatc ttctcccagt tggacggagg ctcgaccttg accgagccgt    228000
     cgatatcgcg ggtttttcgg gccgggagtc gtctttgttt gggtgccggg gttgatttct    228060
     gatcgggctc atccttcact gtcacctttc gcgatgtgcg aggatttggg ctctgcttga    228120
     ggactcgtgg gattatgggg ctcgcgtttc gcttttggcg cttcaatggc ggttcaagga    228180
     ggtcttcgat gtccgccgtg tcggcctcag agagctcgga gagggaagat tcatcgtcgc    228240
     ttttgacagc agacagactg gatgttgccg aaacatcttc tgactccaat tctgtcttga    228300
     tggtcggaat tgcattcgcc ttgtacgcga aactgttcag agcgctcgca ttggagttac    228360
     gcgtttgtcg tccgataggg gccgacagag cctgtagcac cttagcggtg tccctggaag    228420
     tgcgagaagt gcgcatagcg aatgaacgga aagatctgac cagaaacaga aagtgaccaa    228480
     accagacaag tcagaggcaa tttcacgtga gagtcctcgg gtgatcgatc catggaccgg    228540
     gcaggaattc ccaacctcgg cgatcgcggt gccgaccgac tttccctccg cacttcacaa    228600
     agtaattcat acactccacc acattcgaca tggcttctcg gacacggggt attgacacaa    228660
     gacaacggtt gatgaaagaa ttgaaagcat acaataaaga gggagagaat gaaacattcc    228720
     tctacctacg tcccgttaat gacgaggacc tactacactg ggaggcagta ttgaagggcc    228780
     cagctgcatc accgtacgag ggtaagttca agcccaagtc caagtcccta ccagaaccat    228840
     ttagtcaatc taacgcgaca acaggtggac tttggggcct tgatattcga atcccatcag    228900
     actaccctta cgcgccgccg accatccact tcacgactaa gatcgcgcac ccgaatatcg    228960
     cctggagcac gggcgagatc tgttcctcgt taaacaatga ttggaaacca actgtgaatc    229020
     tctctggcat actcgcggct attcagctac tgttgacggt tccggatccg gattcgccgt    229080
     tgaatcctga catcgcggtc ctaatgcgca acggggattt ggctggttgg gagagtgttg    229140
     tacgatactg gactgaggag gagcggtggc agggagttcg gtggtgattg ttggttccga    229200
     gaaaccagct gcgacatttg gcgatctcgc tcgatacccc ttgaccacac acaaataccg    229260
     ctctgcggat ttcgatcatc tcggataccc tgcatatatt ctatatacga atgaatgacc    229320
     ttcacaatcg atgcgcctat acgtttgacg attgagcgca attttggcat tccgatcatc    229380
     ttgcatacgt accttggcac aacttctaca ttccgatcat cttgtttgtg taccttacat    229440
     ctactctata tactccatac gaagggaatc tgtacaatga gccaaggagt ttgacaattg    229500
     agcacaattt ttgcattatc ttcaaagtga agattcaaca tggactaaag taatcacatg    229560
     gaataatagc gtgtgctgtg cgctgtaaat gtccgagacc gctgtttaaa actgtagaag    229620
     taaaggccaa atgaggcgga ataaggaacg cccgccataa acgcccaaga attaaggaga    229680
     gacatgagta ggtcgtcacg ggtcatgcag aaagatagta caatgacgaa tgtcatgaag    229740
     atgcagaacc gatgcgatgt gtgctgaaaa acgccgattg aaaatgataa agatgcaagc    229800
     aggcgatgag gcgaaagtga tcatccatta cagagccatt gcgaccacga cggcaccacc    229860
     aaccatggcg acaatctcgc gagccatacc agtaggcagg gcggcggcat tggtctgcag    229920
     accgggcttg ccagcagcgg tacccgaggg gctgccggtt gcctctggag tgatgaccgt    229980
     aatggaggtg atggtgctct ggctgccatc gggcatggtg gtcgtgctct tggaggtcga    230040
     agtagtcagg ctggtgtgct cagtggtacg agcagaggta gttgttttat gggtggtggt    230100
     tgaggtagtg gacgaagtgc tcttggtagt cgacagagtc gaaggaacac tggtggtctc    230160
     cgatttagtg gtttgggcgg tcgaggacgt agtagtagca gtggtcggct gaggagtggt    230220
     ctgggtcgag accgtgctgg aggtctcggt agggacagat gcagagctgg tagagctggc    230280
     actggtctca ctggtagagc tagccgaggt ttcggtgggc tgagcgctgg tagtaggctc    230340
     gacactagac tccgagctgg tctcactagt ctcaacagcc gaggaggtgg ccggctcaga    230400
     agttggctcg ggagcagtag tcacagtagg aaccggggcc gcagagctgg cagtagcatt    230460
     gtcctggcgc ttggcaagct tgatcaggct ggcaatggtg ggttcttcac cttgcagagc    230520
     ttcggcggca tcaaggtcag tcgggaagat tccatgacgg aatttggcgg agagagcatg    230580
     cagagcacca tggagcgagg ctgcattgat gtcggcaatt tcttggggag actcacgttg    230640
     cgaggtccct tgcacagcgt ctgctgcgaa aactgcagac agaccaagca gtgtcacaaa    230700
     gagcaattga agaaggctga tacgtagcat gatgggaggt tgaagatcga cagatctgct    230760
     gataaggtgg agagttgtgt agaactgggt agtgtaagat gaagaggaag ataaatagag    230820
     aaggaaaaac aacaaaggtc aaaggtaagt ttccaaggtt ggaaggtgag atctttaaag    230880
     aagaacgaga tggaaggaac caccggcaat gctatctcac cttctttttt ttttttttct    230940
     ttcttttttt ggttttctat gtatttcttg attttttcgc actagcgaca gataaacccg    231000
     agaatcatcg gcgtggctga tttttctttt caccacttaa atgtctcgga tcggccccaa    231060
     aggcttaata cggactaccg actggactac tgactggact attttggatt attttagatc    231120
     ccgaggtcca taatggagta ctcgatggag taaaaggaac tgtgccacaa aataaaacca    231180
     taaaatcaaa aaaaaagaca actcattctc tactatgatt ggcctggtct cagccctggc    231240
     taacaatagc atggaacaag aataagtcgt gttgtcatat atttcgtttt tactccatcg    231300
     ggcaattttc aaggggctat ttcccctggc acttccatgg ttctatattc cacaggattt    231360
     tattatttta tgaattcact tatgacctca gcatgtacct caactgtacg aataacaata    231420
     cccgtatcga gtcggatcca taacctcgcc gaccgaccga ggccgatcaa gaacaccgaa    231480
     ttccatctcc atatcgaccg tgacaagtgt cgcattcggc gggttgagga gcatacttgt    231540
     accgttaagt gcgaaccgac gatggtcctc gtccttcgcc tgccacatac tccacaaccg    231600
     atcgatcata ccgtggtgca gcatgaaagc cgggtcttgc ggcgacgtaa ataggtcttg    231660
     gagggtcgcc ccgaggctga aatgcccgcc gccgtgcaca cccaacaccc ccttgggtcg    231720
     tgcgggccag tagtccatga tagtttggaa atcggacatg ttgggcgccg ccaggagtct    231780
     gtcgacgatg gtctcgttgt cgtagttgct actgacgaaa ttgttcagac ttcggttcaa    231840
     acagcgaggg ttgtagtcaa agcctggggc ggggagtttg gcgaatgaga cgatgttccg    231900
     gtcaaacggt cccatgtgga tttgcatgtc tttgaagggt ccgcatcgca cgcagccgcc    231960
     gcccgttccg cgtggtatgg ttacggcgcc gcccgagagg ctttgttcgc ccgggttgta    232020
     ctccccgtca ccggagaggg agctgtcgct gcaatcgaag agagggctgg cctttaggtt    232080
     ctctgaccat aatggccagt tccaatacct ggttcgggtt actatgggct tggaggtcgt    232140
     aggaaatgaa tggcactcac gggagatgtc cagggtaatc acactcttcc cgcagggctt    232200
     tctcccagag ccagaggaag tgacggtgcc atgggaggaa cagaccacta aggtggacat    232260
     tgagtgtgta gttgatatgg gtgctatggt atgttagtta gtacccggtc cttgcccagg    232320
     tggcgtctcg aaacattggc tttcaaccta cgccacaaaa tcatcgaaac ggttccgcac    232380
     tcctgggtac tcttctcttg gaagatgttg gggcttccct tgcatacata acactgcatt    232440
     agtatagtcg atcctctcag ctcgcttcag ctctccccta tgtgatgtaa gttctctgtt    232500
     ggtcctaaga gaatcagaaa atacacacca ttccttccgt acatcacggt tgtgatttcc    232560
     gcacggtcgc tctggtaggg gaatgtcgat ggtgataccg aatagggaga agttcgctgc    232620
     cgaaaccaaa accccaaagg tgatgaccaa gaaagactga taaaaaccga tcatcctgtc    232680
     aatcccaatt aaaaagggcc cccgatctac ggcggataaa actctcggag aaaatcccta    232740
     tgcctggtcc atgaacactg tttataagta acccccggtc cctcaccacc gagccaataa    232800
     tcctgatagc accccttgta tgatctgtaa atcaacggag tattttagat ttgtctattt    232860
     tggtgagctc ggaacaaaac ctggatatgc gggttccagg cctatcagaa tgtgagctgt    232920
     cactctacga aggtcaaagt gcatcgtaca tgctccgtag gtggcgctgc acttgttccc    232980
     ctgcatgata tggagtgccg gggtttttag tgttcgacca ccgccaaaat ttggttaggt    233040
     tagaattcca tcacgattac cttatttgcc taggtggtgt gtcggagata tatgtgccta    233100
     gtcgaactgt gtctgggttc gatgtgcata tgtacttgga cccgtatttg agcggcgggg    233160
     ggagggatgt tctagtcaat tttgaaatca caggtgcact tgatatggaa ctgtggctcc    233220
     ggcagactta ttatgttaat aggcgcctga ccgacaacat acatcgtacc tgagtaagta    233280
     ctcggttaag gctggggcat tatcacatta tagactctct gtcaactagc ttttttttgc    233340
     tgtcttgtaa aatcaacttg agcggaaaat atcctggacc gaggtacgtt gtagtaggaa    233400
     ctacgccgta ccgcgttaga ccagttctct ccacaattac aatccacata gggtgtgtga    233460
     aacattcttt tctctagtta ctgtattccg tagaaaggac atacgcttgc taagcatatc    233520
     atgttgtaaa cgtcacacta tgatcgcata gttgaacagg aagctaaata gctaatcttg    233580
     cttctaaccg agcttcgtat atacgaacta gagtacgctc tactagataa gcctttgtta    233640
     tctatataga ctctacagcc tttgcatgat ctctctcaca cagtagatct tatcaaacct    233700
     ttcctttcgt acgacaaatc ggtctccgag aaattctcga taaaagcgtg tgatattacc    233760
     gtcccccagg gtaaaggcct aaagcttctg tggacgaatg tataccacta agactgattc    233820
     atgtctccat gtgaccgatg ataagctatc cacttggcgg aacagtagct agcagtccac    233880
     tgttctccat agccaagctc tgtcatctaa cagtaaaacg tgagttgatt tcatagatat    233940
     ttgaacaaca acatacctag ttacaagaga ataataaagg agctagacta ggagctcttt    234000
     ttgaccatcg tattactatc ctagtcgtag tgcactccta cattgttaca gcgttaagaa    234060
     tctataccct gctcaatgtc tcaacccctc attgcagtat ttgtgatgac cacctatatg    234120
     cttctagtcg gaccattttg cgggattttg tgggaattgg taatataagg tcgtgggaag    234180
     agtcattcgt gcttgaattg ctttttctag ggaaatgaag aaaggtagtc atataaatgc    234240
     tacaagcgac tgaaccttga ctactgtgca ctaagtagcg tgagtagtca ttcttagaca    234300
     ttcgactgaa atttataaac aacacactcg gactatcgga gatttcatat ccggagatat    234360
     agccaaaaat gactgtctaa cttgtataaa tctccagaca attactagtc ccgtacatgg    234420
     gttatattca agaaaaggtt cacatgtata cccacccgcc tctgaaacct cctgcggatg    234480
     atcacatccc cagcgccttg agggagatac aacaattgag ttataacctc gattctctcg    234540
     cggtgaacgg tcagcggcta tcagctgcag gggccgtcac gcactgaaat ttggtggttc    234600
     ccgctttttt cctccaatct caccccctgg tcgtatcctt ttgctaatac acaaagaata    234660
     cgagaacaaa gaatactgcc gccctccctc aatgcgaacg aagggcaccg taaggtgctt    234720
     acgtggactg cacgtcatat ctttccaatc cacaccatat aagtgagtgg agggccgctt    234780
     cttctcccca gctctccctc atttgaaaac atctcattca ccaaggttac gtataaccac    234840
     taacacagag gaatgatgtc cacgatccag aaccctggaa cctctctact cgcgcagcta    234900
     gcatccccgc cgaatatatc tctacaatta gtcggaacgc acacgacagg caagcagact    234960
     gaagtcgtcg attttgatct ctgggttgat tgttcaaaga aagcggaaat caagtctgga    235020
     gaattcttga ctggcaacga aagtgagcat cgctcttggg accggtccag tgaatgcagt    235080
     gacagtttct cgaaaacatc atctagctgg ctccaagatt ggcttgctga cagcaacgaa    235140
     ggaagaaggt acggtcacca aatcagttgt ctctgggcta gtaactaatg tatgccaagc    235200
     tggacgatcc gtaaacttgt cagtctgcgc gatgacgact ccgttactat aaaagctcat    235260
     gcggagggcc tcgcacacaa agtcgcgtat ggcggatcca tcactgttaa aattcacaca    235320
     ccacctctcg aggcggatgt tgctgaaaac atcgccgagg ttcgagcaga atggagcttt    235380
     ggctcaccat tcattcccac ggaacaagca tgggatctgt tggtaatgaa tgcaatggtc    235440
     gaccgtagaa ccggatttat ctctcttgat gagccacgac catcccacgg aagatcacca    235500
     tttcgcaggg ccatgaaatc caacaacact tctacggtcg tatcacaggt tcaaaatgag    235560
     gagggcttca agcatacagt acaacaatac tcgaaatggg gatctgacac ttaaaaaaca    235620
     tcattacccg ccttcttctc ataggttttc tgttgctgca atagggagcc cctcatacaa    235680
     ttttcacaca atctcttcgt tcgtaccatg tgttctagta gtacagttta gactgatatg    235740
     gctgcgatat atctctgggt tagaacattt tgtagtttat tatccaagca tgtatctgct    235800
     acgaggcttg ctttccgcgg ttcagaataa gaacgtgtag tttgactgct cgaagctgct    235860
     aatacaatac acgttgcgcc ttctaatctt cccacatttg aattgttatc aatatacaaa    235920
     cccgaataat gcgtcatact cttgagatat tcgccatact cctcctcggg gctgggcttg    235980
     tggctgcttc tgacaaagac ggatgccaca acacgcaagt cttcctactt gtcctcaaat    236040
     tgtatggaaa actaacgacg taatagagcc gatccccatg aaggcctccc caagaacatc    236100
     tgccgctgcc cagatggtaa ggatgagatt accatcatat caatcactag aaggtccagt    236160
     atgttgttcg cgatgctcac cctttctcat aggcagctgt tatagtgata taggcggcgg    236220
     ggtctgcgag ggtctgagca aacaagttgc ttgtatcatt tgatgggttc accagggcag    236280
     gacacaacct tggaaagttc tgggtcaatc aaaaaccaaa gtattgaact agactaagaa    236340
     tgggatagcg tcagttacct accctaccgc ttgccgaagc taaatgtagg ctatcatcca    236400
     atatcaaata attgtatatc tatacaatgt ctactgttac atgaacagat taatagcctt    236460
     tataagacct atcatgatag ggctagttcc tgtccgggtt agttagatac gtagcctgga    236520
     cccgcataga agaatagagt ttgatttaat actaaaagga agagtccaca acaagtccta    236580
     caactacgcc agcaagccaa cgtcactggg caacaggcgt gaaaggtacc gatgtgccaa    236640
     gcagctggct aggcggaata taaacagtgc tgcacagccc tgcccatata ttacaccacc    236700
     tttcagagca cgaatcccgc aacctcgaga tttccatcac tctgccgttg ccgaggcggg    236760
     aagaggttgg tagtgagtcc gtgacgccca cggaacttca gattgtgact ttggtgaaga    236820
     ctttggtgcc aacgccttcg aactgggaag aggactggtc ctgtgttcta ggtcgctgaa    236880
     cgccttatgt atgagccgga tatcggcggt tcgtcctccg aggaactgac aatgctttga    236940
     taattatttc gaagactcgg cattggacat tcacgcctac cttagagggt tggcttcttc    237000
     caaggttctt ctgcagggtt tattcacgct ttatgtaccg gctgactcaa ggcccgttca    237060
     cagttttata tttctttcac cccttggcat ctcagttcac tttttctgtt ttgtttcggt    237120
     gtaaattttc ccacgtgcct cccagccagt cgaatgggca agcgtggtga gtaacagata    237180
     ttacagatat ccgagattca ggccttttca catggcatac agcagaacga tccttggcgg    237240
     cgatgcccgc tgcgggggaa acggtctggg gaactaaccg aggcagatac gtggagaacg    237300
     tggagggcgt gaagcatgcg ggtttaacat tgacgccaga tcccgccagt ccttggaaaa    237360
     agcctttcca cgcaaaatcc accatggatg ccattaaagg ctctctggac caggtcctac    237420
     tccaaaccac agcctcctgg gctcacattg tgggcaagta ctcgcctcag aaaatcgagt    237480
     tcgtgggcac acttgtcgct caggtactta ccttctggct accatccata tgctatatgc    237540
     tcctcgaagt gatagcaccc tccttctccg agcgccacaa aatccaacct gcacccaaac    237600
     agccaacccg tcgcgagatc gcacgctgct ttatggtcgt ggtacagaac cagatcatag    237660
     catctatact tcatctgaca ttgctgtctg cagccagcca tgctggcatg aactctacat    237720
     atcgcatcga gacctcccta ccaggcccag tcgagatcct ccgcgacgtt tttctcagcc    237780
     tgttgatgcg cgaagtgtta ttctactaca gtcaccgaat cctgcatata cccagcctct    237840
     acatccccat ccataagaaa catcaccgat tcactgctcc cattgcgctg gctgctcagt    237900
     tcgcccatcc gattgagcac atattcgcta atacattgcc catctctctg ccgccgcagt    237960
     tgctggggag tcatatcgtg accttttgga tatttttagc ttatgagctt gtcaacacgg    238020
     cgacggttca cagtgggtat gatttctttt ggtacaaggc aagagcgcat gatcttcacc    238080
     atgagaagtt caatttgaat tatggatcgt tggggttgtt ggactgggtg catgggacgg    238140
     ataagttgaa gaagcatcgc actgtatgaa tatcgttatt gatttggtac ctaggtagcc    238200
     ccttgtgtgc aaatcgatct ggatatttgt ttctgggggc tacctgggca atatcggtgc    238260
     ggccaatgat gcaccatgga tttgtcccgt gtatggggtg cgggaacgct ctttccttcc    238320
     tcgcttcgtg acttcctcgt ttccttcagt tccttcagtt ccttccttca catcaatacc    238380
     taaaggtagc cggcacacga cgaactcgga aagtgcagcc ttccaaggtt gttcccatgt    238440
     gagatacccg gaggttccaa ggttccgaag acaatgagat ccatggttcc atggttgctg    238500
     ctcttggcag aagtggtttg ggaaggcggt aaatgattgc aatatagtaa atgtcggcta    238560
     taaatatcct gagacaatcg gctctgaaaa ggaaataaat cgcggtcgca gtttctccca    238620
     gttctggcaa cgttcagctt catctcggcg cccagaacaa cctgtaagct tattccaagc    238680
     cacgtagctg ggctggacca cgggtctggc ggtcgggcct ggggatggag tttataacta    238740
     gttgacaatg gcatacccaa ttaatgagac aatctgaact ttagaatatg gatctctaga    238800
     aatctatttg tcgatctagt caagttatgt tgcgctacgg acaatgtatg aacattcgaa    238860
     acatacaaca taaggcgatg cgttgtccag aagagaaata atagatcatg tgcatacggg    238920
     ggtctgggga ctgttaagtc gagtgtctca ggtctatgta tagagagcgg ttggaagccc    238980
     atgggcaggt gggtttgtgg cgtcaagaca agtgttttag cgaataaaaa agcaaaaagt    239040
     aaacgatcgt attgactttg tgattggatt tctagaatct gggcacgctt gacattgacc    239100
     cccctatagt cttgacccct ttagaccctt agaatcataa tgttggaccc cctaagaccc    239160
     ctgaagtgcg atcgactttg cctagatgga gatgcgtcat cgccaagcga gggttatcca    239220
     ctcagggttt gagggaggca acaggataga tttcatagta catcgtaagt tatgtaggga    239280
     ttgggtgcat tggataaata tagtgataca cgtatgttgt ataacagtag agtacgtata    239340
     tatgtacatt ggacctagag taccatcatc gaataagtta aaaaggaaac agtcccaacc    239400
     cgaaacaaat aaataaatat aaaaatgaat atgaatatca accaatcaat atcaatcatt    239460
     cagggtcacc tccacataaa aatccaccgt aatatgaccc cttgctgatc agaacaagca    239520
     gccaatgtat agccaatgta catcggaccc ttggcgtagc acagcccata ttgtcggagg    239580
     ggtcttggcc tttccaaaac cctttatccc ttgctctctt ttcccttttc tttgacctca    239640
     ctttcgtttc tcagtctgtc attcactctc tttttaatct gagcgcatat tttcccactc    239700
     tcgttcatac caaatttttg ttcgctcttt ttccaatttc atcatgaagt cctccgtcgc    239760
     ctccatggcc acggccatca ccatgggcgc ctccaccgtc ctcggtgccg caaccaacct    239820
     caaggcccgt gaaagcgaca tcacccccat cactgtcaag ggtaatgcct tcttcaaggg    239880
     cgatgagcgc ttctacatgc gcggtgtcga ctaccagccc ggtggttctt ccgacctcgc    239940
     tgatcctatc gctgatgttg agggttgcaa gcgtgacatt aagaacttca aggaactcgg    240000
     cctgaacaca attcgtgtct actccgtcga taactccaag gaccacgacg agtgcatgaa    240060
     cgccctcgct gaagccggta tctaccttgt cctcgacgtc aacaccccca agtactccct    240120
     caaccgtgcc gagcccgaga tgtcctacaa cgatgtctac cttcagtaca tcttcgctac    240180
     catggagaag ttcgccaagt acgacaacac cctggccttc ttctccggta acgaggttat    240240
     caacgacggt ccttcctcca aggccgctcc ttacgtcaag gctgtcaccc gtgacatgcg    240300
     taccttcctc cgcgctcgca agctccgcga ggtccccgtc ggttactccg ccgctgatgt    240360
     cgacaccaac cgcctcgaga tggccgagta catgaactgc ggtaccgacg acgagcgcag    240420
     cgacttcttc gccttcaacg actactcctg gtgcgacccc tcttccttca ccacctccgg    240480
     ctgggaccag aaggtgaaga acttcaccgg ctacggtctt cctctcttcc tctccgagta    240540
     cggctgcaac accaacaagc gcgagtggca ggaggtcaag gctctttact ccaccaagat    240600
     gacccccgtc tactccggtg gtctggtcta cgagtactct gaggccggta acaagtacgg    240660
     tctggccaag atcgacggtg acaaggtcac caccaacaag gattacgatg ctctcaagaa    240720
     ggccttcgaa gctaccgaga acccctccgg caacggcggc tacaactcca ccggcggtgc    240780
     ctccggctgc cccaagatgc agaagcccaa ctgggatgtc gactccgact ctctccccgc    240840
     catgcccaag cctgccaaga agtacctgac cgagggtgcc ggtaagggcg atggcttcgc    240900
     tggcaagggc tcccagaacg ctggtaccaa gtcctctggc actgccaccc agggctccgg    240960
     tgaggtctcc tctgccaccg gcggctctgc tgcttccggc accagctccg agggtgctgc    241020
     cgctagcctc aagcctttcc agttcagctt cgcccccgtt accgtcggcc tggtgactgt    241080
     tgtctccact gtcttcggtg ctagcttcgt cctcctgtaa tgctcctacc ttttattaag    241140
     gggcttcata tctttttcga ttctccctga catgtatctt ttttaactgg ctttcatctt    241200
     ttaccttgtg ataattgtcg cttgggcttt gcaaattggg gcgagatgcg ttctagttgg    241260
     tgtatagctg tccttagtat ctacgtctag tgttcaatga aacggagctg atctgctcat    241320
     atttccggtc tttggtagtc agctgccgta gaagtaatcc aataattcca ctcgcatcat    241380
     cccaacgttc acttgtgttg gatatggcgt gtcggatgat acttcatact ccagtgaatt    241440
     tgttttcggt atcttttcag tatgttttca tggggattgc gggttcataa ggaaaccact    241500
     ctctgctcga atagctagtg ttgccaaagg catacagtgt ttccactgaa tttgcaagtc    241560
     agttagccac tccaacagac gctgagggga tacgtaacta ctaggcgtga cctcgtacgc    241620
     ctcttatacg taagccccta gaattccatt tcaatagtat tgatagtctg aatgctacca    241680
     gtggctcatt ggattcagct tacagacaca tgctctcttg aagatcttgc gtgaattgat    241740
     attctgtctt ttggaggtta tataaaaatc taatcgttaa ggcccaaaac atctactata    241800
     taaatttgat agaaaaaccc aacatctgct ccctgcaacg cccagttctg taaatatata    241860
     agaatcaaag acctacttgc gagcacgacc tgaaccagaa gcctcacctg aaccagaagg    241920
     acgacctgaa ccagaaggac gacctgaacc agaagcctga cccgaaccgg aagcacgact    241980
     tgacccagaa gcacgacttg aaccgatctt atcaatatca aaccgcatat gtagcttgcc    242040
     tcctataaac caggtgagga ttctagagat ctgatgcgtg ccagcgggcc aagctgctag    242100
     aacaagaaaa cccaccgccc ttcccagctg tgtccctagg atgcgccgaa atctcccagt    242160
     gcccttgtcc caagtttggg ttgttggagg cccagatcta tcttcaggac cccccgcgac    242220
     cccgtcactt ttgtagatca tcttcccgac caaggggagg gtctcatcat tcttaacatg    242280
     caacatgaaa acatatcgga gtgtatcgat attgtggtgg tgtttgtaca aagctagagc    242340
     aatctcattc caatggggcc cggactccct gaaaattttc ttagcaatga tagcaccgct    242400
     tatggtataa tgctcgtaag aagacacctt ggtcaatatg tcattctgca gaattgaatg    242460
     acggtaattg gcatctggaa gtccagccga ttcaagaccc aacgtaattt cttccggtgc    242520
     gggacgggac gaggtttccc atatcttaaa gagagccgga gtccgagcag ttgcacgggt    242580
     tagatcgtca acagttagtt tagaaaggag tgctttagat ggactactat tttggttgtc    242640
     ggccatccgg ttttcaaatt ctataccgcg ctcttcgaag gctctgactt cgtccctagt    242700
     aggtgttgat tgtagtatgg ggatcaagtc tgtattaaaa gatgcggaca tagacgcgga    242760
     agccctagtc attcgcatgc gaggagtcct ggggctcgct tcaagctcag gggcacctgt    242820
     accgggatat tgctcggctg gttctggact gggcgtggcc ggattaatct gtagcgagct    242880
     gcgcgctgaa ctcctttcac ttatagttcg gcgagctctc tttaagcctc ttgtgtcttt    242940
     tgatttctca tcgtcgccgg caccatcctc gcctccacgt ctccgttttt gactctcggg    243000
     agtgagagtg gcgggggttt caacaggtgc agtgtcaacc gttgcaccgc tttgcgtagg    243060
     tggtggagtt atttcttcct cattttcatc atcggtggga cggcggcgat gtagaagttt    243120
     cttgaaggca gctcgagtta tggccatcgt gttgggagta taaaatgaaa atatatagac    243180
     agatttggaa atcttggagg gtttctgata ttggtatttg ggaattggta tgcttgaatg    243240
     acttacctag gtgctggacc aagcggatat tatatagtcc aggaccaaag gccatatcag    243300
     agaggatggt tcatgaacaa gtcagtgctt gcatccgatc taagttaaga tgaaaggaac    243360
     agaacaatgg atatatttag agactcgaag accaagggga ttccagatat atgaagacga    243420
     cgcgggtggg ttgaacatgt gattcaacag tagaacaaag ggaattgagg taaaggatgt    243480
     ggatcaaatg gcaaatggcc gagagataaa gacgtcgata cggcgcacat aatgtaacga    243540
     gaactatatt attgaaacaa agcaacgaag cagggtgtga tggttgacta aatatagctt    243600
     gaagccgagt gccgagtatg acaacgaact ggagatgaaa gaagtcgatt ctccaaggaa    243660
     agttcaagtg tgatagaaat ggctgtcccc aaggtcatca aagattcatt ctcattgcca    243720
     ttaaaatcaa gagcgacgtc ttggaagacc tgttctgctg gaaactgcga agtgtggctg    243780
     ccgatgcaac tgcaaacgcc cagcttcctg cattcgccac atctcggtgt ggacgactga    243840
     ccttatcgtc aattgttgag gttacgaaac aagaagctgg gaaaatcaag aagaagaaaa    243900
     ctgctgcaat caatttacta agagaaggcc tttcatagat ggccgagcta acaagcaatc    243960
     aaaacggttg atcccaaaaa gcatcccatc tatgggctcc aacaccaatg aaagcttcaa    244020
     tccacgaagc tgcttgacaa ccatcgcttc ccaagcatca aaatcatctc gggagctcat    244080
     ttgaggggcg attttgtgaa gggtaacgtt atccaggtct gataactggt aggattgatc    244140
     cggccttatt ccctggaccc agtcttagtc tgctggtagc tgctccatat aacggaggat    244200
     ttttagctgc gactggtgct gcatcgactc tctgcacgga tgctggtgag aaattgagag    244260
     aaaaaatgcc ttctgtagta gatgatagct cggaataagc aagggtcata gtgttaggct    244320
     ctacagtatt tagggactag aaaggcagaa ggcagaaggg agttgtgtta ggaagagagg    244380
     aacgagctgg gaaacaagta cctagcaaac acagttcaaa tggatttttc actcccctga    244440
     tagtcagaga ttctactttc tcaagtcaac agccaactcg ggatgtgcgg gatcaaccgt    244500
     gtcacctgga cagggagccc tacttcacaa tacacaaaag gacccaaggc atgtacctag    244560
     atacgtaggt aatatttatg atagaagtag ctaaaccgag ttcatcaagg atatcgtaga    244620
     gcaaagtaag aaaaccccca aaggattgac tgacctctca ttagcttgca ggactttacg    244680
     tagactgaag caggcaataa ccacatctag ttcaagagac atcatcctcc cgaccacacc    244740
     gtagcaacct gaatcacacc agaacagact cacggttacc cacggttacc accccatcct    244800
     gcggaaaacc tccaatcctg cccgacctct ccaagccctc tcaccagacc tacaacatta    244860
     tcagcaaacc cagcctcacc gttgttaacc ctctcccggc gctcgcgctc agtatccgaa    244920
     ctagcaccac gaagaccgag cagctgccgc gtactatgcc cctgcaagcg atccgcatcc    244980
     atcctcgtca aaagattacc ttcgccgtgc cgccgagtcc aagccgcctg cttaacagcc    245040
     ggagcccagt actccgccag agaagactca tcgcgaccga acgggtagca cttagccagc    245100
     ggagagtcgg actccggtac aagcgacgca ttccagcgcg tgtggacgac ttcgtacctc    245160
     ttctccatga agaagataac cggccacgtg ataatccaga gctggaggat gacgacagcc    245220
     caccagacga aactgttcat gcggagtcgg ttgatccagt gcggagagta tattgtgacg    245280
     gacccttggg agatgacgag gctgaagcct atggagccgt ggtagttgag ttcgcggatg    245340
     tgtgaggaga ggacgttacg catagcgttg gagttgaagc cgcggacttc gcggtgcata    245400
     gtgaacctgg gttgattcca ttgagattag cagggtatat cgcacgcgag gaggcagagc    245460
     atacgatttc acaggagcgg ggtcacgaca gaatcgctca caccacatca tcaggttttt    245520
     cgcgtctagc gagctagtat tattttgctc gtcggcatta tttcgggcca ggatggcctc    245580
     ggtgtccccc gacagactaa tagcagcacg cgacttgggc agcgtatatg tgcttgagcg    245640
     aagaatgcct ccccgatacg cgggtgtgac gtcctcatct gtaagaattt ggactttcct    245700
     ccagttcgcc cccatgtggt cgccctccca gccggtcagc atggtctcag ctagatccag    245760
     cgcgaagcag aagtctgtga ctgtgtagta ttcatctttc ttttcgccct tcctcacttc    245820
     ggtgtgggtt ccgtgaatgt agagcagtgg gcgtggcggc agcttcattt gccggctgat    245880
     gacattgtag agcctgtcgc agtcgctcga gagcgctggg tcgagggtga gagagacctt    245940
     gtcgcgaggt ttggcattct cgctgccggg gagaacatag gctgagtcga ttagacggag    246000
     gggtcggatg tttgtgggag gctgggcagg ctggatgggt cggacatact ggtcaggggc    246060
     gataatgggc tcggtgttgt ctgtgtatgg aggaggcgcg tcatcaaatg aatggaggga    246120
     gtgcgacgat gacgcaggcc gaccggcctg gtggaggcgg cccatatttt cggatttttc    246180
     gagagaaaag gaatcaaaat actcaaagtg gcgaatctct aagtactgaa atagactaaa    246240
     gagaacacaa aaggaaagca agaaagtaag aaaacaaaga tgttgagagg tgattttcaa    246300
     ggaggttcta actaagaccc tcctagctaa ctatgacatg accacactac agcctaaact    246360
     tcaacactac ctacctaggt attctacgta ttctctaggg ctatacacca atttccacct    246420
     catccaacat aacacttcat agatccaaat ttaggatcca taagctggcg atcctggcac    246480
     aaaccaggac cccgccagcc ataagtttgg gaaatgtcgt tgacaagatc gcacttgtca    246540
     ttaggagaga cggtacagag accattcgac atacgccacg atgtgggatt atccagagaa    246600
     tccttgtgac agtccgtcca ctcccaatta ccgctctctg gtatagtcca cgaatgacat    246660
     gaaacggctg tgtccttgac cagggtctcg agcttgctcc ccttgccgaa ctgcatgcaa    246720
     tcactgtcct ccaaatactt gttgtggcct tggagcagca catagctccc agtgcaaccg    246780
     atgccatcgt acatcttcag cgaccatccg ttttgtatgt tgacgatacc atccacggtt    246840
     tgtgtcgcgg aagccgggga gctcttggtt gtggaggttt cgcttgttgt agaagacgtg    246900
     gtcttggtag tacttgtgct tgcctcccgc aaacggctcg ccaacatact gatcttgtgg    246960
     gccacgatca ggaatccagt gtcagtgcca acggcagtag tagtagtact agtagaatcg    247020
     gcggctggca tggaagtggt tgcgtgtaga tatgtcaagg gtacatccac caagggtata    247080
     tctgtcgtga agaagtgcgg gttcttgttt tttgttgtcg aggccacatc tttagccgtc    247140
     aacgtgacag gtttggttgt agaggcagcc gatgtcgctt tacttgttgc agatgtagtc    247200
     ttcgcggact tggctttggt ttcaggcgta ggaggcgcgg caggtgcagg tgcagatgag    247260
     ccacagaaat ctggaccagt accgcattga ccccttgtag agcactatag atatggttag    247320
     tctaggccgc gagagcgaaa tcgaatcttg atgaagctta cacattgacc cgcagggcac    247380
     gggtttaaag cggcaatacc tatccccctc aacggacgtg ctgttccagg cacctggggg    247440
     ccacagactg caccagcaat tgcaacaggc attagggggt cgccagcgct aagacaaacc    247500
     tgaccccctt cctgcagttt attgcaaccg taccatgccg tggtattgat gttccaagtc    247560
     tcaatattgg ccacggtgat cttatacccc tcagcaatct tcttacaggt gtcaccatag    247620
     cggatagtgt aagcgtagca gttaccacca ccatccggtg gaatggtatg cgttcctgtc    247680
     gcgcagcata ccggctttcc gcgaggcaga gaggaacagg cagtgtctgg gttgaaggac    247740
     gtgaatgatg ctgccgagat tccacacttg agagccagat cgtcacacgt atcctcattg    247800
     ccgacaagaa tggaaggaca tgtgtaggga taggtgtaga cggcccggcc tgcggtcggt    247860
     ttggactatc ttgggttaga gcctggggga cgacaagtga tgttggaagt tggagaggta    247920
     ggaaccaacc tcgcgtgcag ctacagacaa cgcaactgtt ccatgaatca aaccaagacc    247980
     gcatagagcg aggaagatgc tcatctgaaa agaccccatc tggtgtagaa ttgccggaga    248040
     ggatgatacc ctttgaagaa gtaacgcgcg gatttatata tatctctaaa gaactacatc    248100
     acgaaggtca cgttcgagag caacatcacg gagacaacat ccattgatgc agttagtgaa    248160
     tcatatgaaa cacaaatatg ctctttacag tggcatgcag ggtctgaggg tctcaaaaga    248220
     gccactcaga accagtcttt tctcgaggac aatatgttga ggttgttgta aagaacaagc    248280
     caaagtgcct tctctgccac catcaacaaa ggaggtcgtt gcatccgagg aacccccggt    248340
     acaaatgtga ccccgaatgg cctttgttcg aggaactctc tttcctcttc ggaggctggg    248400
     ctttagattc tctttgaaga agcgatataa tgcaccatac tgccaagggc cttggctacc    248460
     ggggtagtag ataccagcat caagagcacc actttgtggg tttcatatca ccaagacaaa    248520
     ggaagcactc aaagaaataa ctgccagata ctgtcactct cttgaagtca tttctaaatc    248580
     atcatcagat tattgttggc ataggatagt caccataaaa aaaaagcgcg catctcctgg    248640
     accagtccga cggcatatat gtgttgacct tgaatatcgg agaagaatag aaagcttgtt    248700
     gctcgttagt ttagtgtgcg cgaccgagtc aaagaacaaa tatcctggga ttaaaataaa    248760
     caagattggt caagagcttg tcggctttgt gccactattc aagggttgat agggacaggg    248820
     tcccagaaat agcacactgg acttgaacca tcctaaggta gaaaaagtct ggagataccc    248880
     aagactgcaa tatgcgagca tggcagatat atttctctag ggatatgtcc cattcaaagg    248940
     ctaacttttc acatatacca tgcctattca tatgtatgat cgtggaagca gagagggaaa    249000
     tatagcatct tagtttgcta cggactagtc tgtgcgtagt actccataga tcacatgggg    249060
     ctatctcggt atgtacagag tatcattgct tattagggat attggtataa atgaatgcag    249120
     gttgcttttt ctgattgagt ctattcacgc agatgcatcg tgatacaatc tccttactcc    249180
     aactgggtgc gtccagagat tcactgtgga tatagtgtaa aataactgac aagaaggaat    249240
     tctaaatgcc cgctccgaga gatgcagtat ctcttatagt gatgttcttc aggaagccgt    249300
     accccagatg gtaggcttag ctgcgaacca gctaggggca acacatcata atttatggct    249360
     ggatatggcc aatcaccgca gaattcattc attctttctc tctctctctc tctccttctg    249420
     gccctttgca gacatatcaa tctttctagc gacaaggacc cttcctatag tgtccttgtt    249480
     gacatatatg catacatgca atgtgtgcat gtatgcgttt gtctctttgc agactgagca    249540
     tttgcctagt ttgtctcgtg tgtcatctca gaggcttcat ataccgcctc ctttccatag    249600
     atgcatcatc acctctcttc ttcacgattt tccctccatc tctcttgttt cgtggcctca    249660
     ccaggttatg aggccctcaa cctttcccct ttgctagatc aaacaaagat ccaagccttc    249720
     atctgacgag catctccctg cagtggagca ccgttggaga ttttggttga gaatagcaaa    249780
     atggctatat ctctcacttc ttcgtcgaac agagtatctc aaacgggggt actatctgtg    249840
     tgcgacaaaa ttaaaaatcg gtgttatggg cagtgtctca cattgagaac tgtcttcatc    249900
     ttcatcttca tttttgacca gccaaaagct gtgttgatct tcatcttcat ccttatattt    249960
     atattcattt ttatcagcca caatggctga atcctcttcc aaagctgcct tgcagtcaaa    250020
     ccaaagcata taaagcaaga tgccgttgtc aataaccaaa gtgtcgatct tcctcagatg    250080
     ggaagcttca acaaaggccg ttcggacacc tgaccgtcct tttgtagacc gttcaaattt    250140
     gccgaccgcc atcagaccgt tcgtctccga tccagatttc ctcttttgac cgttcgattc    250200
     cttttttcga ccgtcataca cacacaccgg acgctaacat gaacttcttc gtgcggagta    250260
     tggcttatta tcatggcaag ggaattttaa gcgattgaag ttctcgacaa catttagtat    250320
     ggaaacaata atccacaaag gttcgtcgtt tcaaggatac actcttcgaa atacactagc    250380
     gagatgtagt cttaccacct aagatagttc tcaacggctt ctccacaaac cctgcgagac    250440
     ggtatgttat cacgcgcgtt gctgtcccgt ttcgcaaccg atttgtactg acattgccta    250500
     ggtccccgag gggatcgaag gaaatcgggt ggaactgctc gcgtgcctat cttgggctga    250560
     acagttttgg atgaacaccg agggaggttt tggcctgggt gaggaaggcg agtccgagtt    250620
     tctccttccc cgggacctaa tcgacggcgt tgcggcgagt gtgcgacact tggtcgcgtc    250680
     cttcgataac tttaccaaag cacaccgccg tggacatcct cttgccggca caaagctctc    250740
     gcaggtgagt ttcgcttgtg gttcggggtc gtttcattgt tgctgattcg tgtagtcaac    250800
     caaagacgcg tatgctggat gggtatcttc tcgctcgtcc ctggaaagcc ggataaaaca    250860
     acccccgcta ccaagtgttt attcaaaacc tggctcccga tctcaaagat cctaagttta    250920
     tagtgaatgt ttatcatgat ttcactatga caaaaggctc taatcggatt tgggggaggg    250980
     ggaggggggt taaatggggg tttcatttca aagttaccat gctatctggt ttttccattt    251040
     gaagagggtt gtttaatcta tagagatacc taggcatggc aacagtgcgc tggaagctac    251100
     catggccacc agggatgtgc tgcttcattg caccagaaac cctctcgaaa tggaggcttg    251160
     gcccgaggaa gcacgacgca aggaagtttg ataagtggac atcgtcgcca acctttcatc    251220
     tactctaggt attgcttcgt tttcttacat gattggcgtc tctatgagac ctctctacac    251280
     cagattgtgt agttatggag ttttaccaat gctatttcgc attcaggata caccttgaca    251340
     tgatgctaca tatccgtatg tcattttatg gcaaatcttg atatatccat tccagctatg    251400
     tcttcatgca gtttgtggct tttataaacc atgtctagtg taagatcctc gactcataga    251460
     catatgcttc ttatatttca catccatggg agcattgcac ataattccac cgtggccgtc    251520
     gctccttctc ttttctcctc gctctttcct cttccatctt gcatgtttcc taggttgttt    251580
     agcatcgcag tagacgccta gacggctaga cgcgacgcgt cggattctca gttgacctgg    251640
     attcttcgat tttctgctct tctctttttt ttttccatct ttgcgcatcg attccttaga    251700
     attgtatcgt tattcctctc ccttaatcac cacaatggct tctaaccagg atatctcgaa    251760
     ccagggtatc tccaaccagg atgtcacgga ggatttctca gatgccttcg tacaggatgt    251820
     ccccaagcaa gatgtctacc cccacaagcg ggctccttct aaccgggctg cgtggcttac    251880
     tggcagatcg gctcgtcctc tcatggtatg cgcggcaccg tacacacctc catcccccca    251940
     ccaaatcgtt gtcaagaatg gtgctgtggc tatcaatacc gttgaatgta ccaagcagtt    252000
     ggagggcaac atgatggccc cccggatcaa gtaccccttc gtgctcggaa acgattgtgc    252060
     cggtgaagtt gtgcaggttg gagacatggt tagtcgcttc aaggttggtg atcgggttct    252120
     tgctcacgcc ctctccatgg atccggccgt caacaagtcg tctgaaggtg ctttccaaca    252180
     ctacaccgtg atcaatgaca acatggccgc aacgattccc gattggctct ctttcgaaga    252240
     ggcttgcgtt gttccactcg gtttctcaac tgccgcgact gccttgttcc atgaggacta    252300
     cctcaacctc aatcgccctg gtgtcccgct tggtacgggc ccagactggc ttcctgaagt    252360
     ggtcctggtc tggggtggat cgaccagcgt cggttgcaac gccatccagc tagccgcagc    252420
     agctggttac gaggttatcg ccacatgcgc tcccaataac tttcaatata tcactagtct    252480
     tggcgcatct gcggtctttg ataatcgcga cgtcttctcg gttttctcga tcatcgaact    252540
     ttgccatcac aagagagttg ttggcgctat tgctatcgga aagaactcga ctgaaccttg    252600
     catggcgatt ctcgcgcggt cgatcggttc gaagttggtg gcccgcgcca agttcccatt    252660
     cccggaaagc atcccaacca caatcttcca gaaggttcgt tctatggcag cctcaatgcg    252720
     ctcgaacctc aggattaaga tctggacgaa acgctgtggt gtgaaaacca agttcatttc    252780
     cgatacctct gcggcccata ccgagcttgg cgctatggtt tataacgaat tcctccccgg    252840
     agctcttgca gctggggtat ttgtcgccgc tcccaagccg cgtgttgtgg ggaagggtct    252900
     ggaccgaatc cagagtgcta tggactgtca catgaggggt gtgtctgctc agaaggttgt    252960
     tgtctcgctt tgaatttgtc tcgagctgat atcggatagt ccatggtgtc gattgtctca    253020
     ttgtctcctc aaggacctct ctagtgaagc agccgagcaa gtctcccggt gctgctctta    253080
     tttttctcgc ctgaaagtgc acaaagtcta cacgcaggat ctacgggata atcacccgat    253140
     cactgctatc taggtaatgt tactcagtca tggccaatac aatcccattt caatctagcc    253200
     attcaggtgc aggtttcaat gtaagaaagt gaatagtatt gagaatcaag gccatacctg    253260
     tgtttaagtg aatgcattat caagactacc ctggtatccc ccctctgtga tgaaaagtaa    253320
     tgaatggcac ttgattcaaa gagattgacc acttgaatac tacatctgta cacgcatcaa    253380
     tataataccc aggaataata caaaaagaga agtgttcgca aagccaccag ttctcgatac    253440
     gagctaaaaa agattcatta tatccagaaa gaaaggtggc tccggctgac ctgtcacttc    253500
     ggacatagta cacccttgaa cggtcgacag gttgcacaat ttatgcaagg attctgagtc    253560
     cgagtcaagc agctccaagt agctcatagc taaattattc ccaccttgca aaactcgcaa    253620
     tgcctttctc aaatcctcca gcttttgatg gttatcctcc gacgcggaga gacatgtact    253680
     cagttgatcg gcatgtgcct tgagaaactt tgccgagaga tagagtaaca tgggagaaaa    253740
     tgcatgcgcc tgtgcaacag tgtgagacag aaagccactc tcaattcacg ggaggaaagg    253800
     ggatgatggt ctcaccttga aaaagctgga tcgggtgagc ggcttcgcca aacctactat    253860
     ctcgtacgcg gagtagaggg gaaccaaaat gatctcatca ttaatttcca cctgcagggc    253920
     ctccattatg ttgtagaacc atatcacggc ggcattggcg agcatgtttg tgaagaggcg    253980
     catagggtcg tggagttcgg gcgaggatgg gggtagtgag accagcatca gccgctgttg    254040
     taccatttgg tacagccggg tatggcgctt ccaggtatct ccgtcgctcg gagatgtttt    254100
     gccaccatgc gcggctcgct ggaatgcaac gctgtgccag catagcgtga tcaggacgat    254160
     tgtctccgcg aaaggcggta gcattttctg tccggaggtc tcgatctcgt catataagga    254220
     gtccataatg actggtctgc tgtgttggaa atctgactcc gatacgggga ggtatacgca    254280
     gagctgaact agatgtcagt gtcgctcgga gtattctata gaaaaaaatg aaaagggagt    254340
     tgttgcttac tgcttcctcg tgtagactta gaggccactc ttcagagata ttgaggaagc    254400
     ggtctagaca atatgccagc cagtaggtcc gtcgcttttc ctcggcctcg gcccatgctt    254460
     cgggatgtgc catgttcatg ctaacgtcat tgagccgatc aatttcgtgt aatttggcaa    254520
     gttggataat gcgaaaggcg cgtcctgctg taagccaggc tcggcggtag cccatgtagc    254580
     gaaattcgta gtgcgttaga agaagccatg tttgggctgc ctggagacag gccgcactgc    254640
     tagattcaat atctcggtcg agagcttcaa tgccggaccg cgcacgggta tagagagact    254700
     cccgcatgtg ctgtaaatgg gcggacgagg ccgctgcaag tgcccacatt gcaaattgca    254760
     ggcagatgta agagggtggt ttgttgaatc tctgtgacca ggagaagtac cggccttggt    254820
     ggagcattgg cgcgacggga tgtactctgt cgaaatatag ttggtccctt cacttgttgt    254880
     tagatatgtc cggattcgga aagtaagctt tgcgtacaga tctgcctcta tcatatctga    254940
     gctctcatta ttaggtggag tcatcggtat aataggcgag gttattgctg atgcatcaat    255000
     cgagtagggg atatcatgac attcggtctt cgtgacattg gggatatagt cttggggtgg    255060
     actgagcatt tgagcggtct cgtcgttgta tttctcattg ccgtccaata cctccttggg    255120
     accgagattg ccctgatcac aatttatgat gctttcgaga gtggctaaaa atgaaattag    255180
     cagagaatgt gcatagagag cacctaacaa accaatgcgg ttgcgcaaag ccttgagatg    255240
     ccctttctta ggtccccgtg gtgagcgaac ttgattgagg aggcacgctg tgcccgagtc    255300
     ctcgcattgg tcacattgag gtcgtcgcct attgcatcga agcttctttt tgcggcattc    255360
     ctcgcaagcc taggttatca gctctgagag agactttata aattaggtgg ctattgtctc    255420
     accagtcctg gctgttgtcg tgagcccgac atatttgaag agtaaaacag agtcttgatg    255480
     ccctgatact actatatcac caggaagaac aagttcacat cagtcaatga gacaggtatt    255540
     tgtagtgggt atttataggc attgacctag accattgagt gcaatcgagg ctgagtcgct    255600
     caaccatcgg caattataga ttgattgctt gtttcgccag gcacccaccc tagtagaaag    255660
     cttgtttcgt gatcttctac atttgataat ttgtacttgt gcaaagtccg ctcctcttcg    255720
     gcgatgaggc ccgacgagga tctcccgcat atggtgtgat cagcactaca tcctaaatga    255780
     ctctataccc atgactccct cacatctttc aggtaaccaa atggtgtttt gtcaagggta    255840
     aacggctaat gatcttgata gctttgaata aacttccgtc cctgcgtgga ctgcgccgtt    255900
     agccttgtaa tcacgccatt tgggtagtat agataagctg gatggtggta ggatgtgcca    255960
     accggttagc catgtttgtc aattgttgat cagaagttgg acgatctgtc attctggtgt    256020
     tgggtctgtt agccgaattg gttagttgct catcaaggga cagcttcgga ttgttaacat    256080
     agtgtggcag gttgttgttt ggatacgcta agccgactgg ctgttacata tcgttctcaa    256140
     ctgcagcaca tgcagcacgt ggacagtgat ttggaattgg tatttcaaat cacacctacc    256200
     acacgacagg ttaaactgga ggcaagaggt gattctcggt ctagtggagc caagagagtg    256260
     tagcacaaag cagttgtgat aaaccaaaat gtacggggca ttaattgtgt cattggcttg    256320
     tttcaagcat tcttttcaat ctccgacaca aaatcagtat gatatctacg gtgcttgatg    256380
     ggtttggagc atcttccatt tttgaagagc ttataaaacg ctggtacctt tatttggata    256440
     caggctttga taaggcaata aggatctatg gccatgacta cttaggcgta ttagaaaacg    256500
     ggttgggtta cagatagacc aggtagaacc aaaccgccgg aaatctcaca catcgactta    256560
     cacctccccg gcatgatacc ttgaacccga tcaaaaaggt tccttacggc aaacgatgga    256620
     acctaggcct tccatccatc ccctcttggc cataggaaga cgcaattcgg tattgttgca    256680
     gccagaaaca tcaacaaact gtaacttcaa ggaaaagctt gatgtgactt gacctggtcg    256740
     agtgatcata caaacaagaa atagatgtac attgtgcccc tttgccccac attaatattg    256800
     agctcctctg ttattggtta atattccccc gtgagagcca cgcgaggccg tcgcatatac    256860
     tggaggctac actaaccgaa tatggtaggt acagtagtgc agcatacatg ttattatcac    256920
     gccatttcaa cagttgatac tgattagctt ctagactacc atgtgttctg tggttgaatt    256980
     aaccatgaag gtaattgcca agagctgtgg tctgcatcga cacgcatcca cctcccgacc    257040
     tgcgtcatct tgctgccact gttaggacta ggcggggctt atctgagaca cggcaactac    257100
     tcacggcagt aaatattgca acaatccaat gttgataggc taactatctc cccccgggcc    257160
     gaaagaaagg ttacgcgtat ttggaattgt taaacggcta tagtcttgag cccatgtgac    257220
     cttcggcacg gggctctgct ccccattgtg cacctgaaaa gccctggagt gtactgttat    257280
     gatgcttact catcggttgc tattggaatc tcgactaccc agatccggtt tctgcaggat    257340
     ctttgtcgat atggagtgtc gcaatagttg gtgattcggc catcccattg cgatcctcga    257400
     gttcgggcta acggcagtca caaatacggg gcacaaaatg tcccgtagca cgtgcatgtg    257460
     tgcctcgaga caattactaa tgaatgcaat catctcacac ttggtccaga caggaacagg    257520
     ctcgatttat acagcttata cagcttttcc aaaacttcag tcccttcctc aaacacgaaa    257580
     ttcacaattc aagcttgcct gccctggaaa tattgtacag actggatact aatgatcgac    257640
     ggttctcgcc tgttagcgcc gggacgggcc ggactgtggg tctcctaaac tggaatgggc    257700
     ttgatgatgc ggaatccgat ttctattcca aactacgaga gctttccaaa acacaaggcg    257760
     gaaaaggtga tgggaggcat agctccatta tctcaaaatt tacaattgta atacaatata    257820
     ccaccgcgca aggaagcagc atagctggtt gccccgggca acccctgggg atgaagccag    257880
     cagactatct ggcggcagcg ccaggacaaa acacaacggt ccacttgtga ttggctttcg    257940
     agttattgcc tcccatatta aaccatgctt aaaggtacgc ctggcgcttc cgtagagcct    258000
     atgtactggg tttattgatt tgtgattaga ttccaagatt atatttccct acgtgtaggg    258060
     agtggacata ggtagctgcc aggtaggatt cagatagcaa caaagtaggt agtaccttcc    258120
     cgagagacga gaataggtcc cttaccaaaa tataaggttc catggaagga ccccttatag    258180
     ctcaacatcc catattgact tctcactcac accgcacaag caatctatcg tgtgggcttg    258240
     tcattgcaga aatatgtatt cattagctag acacatcatt catatacttt ataacatcgt    258300
     ctaatgctca acaccaatcc gaaggctacc gttaaaatcc ctaaagtcac ccctcaagat    258360
     tccgatgccg tctctcctga cttcctccac taggcccttg actttaggtg cgatactctc    258420
     cggtgcaaat ccaaagtgct catatgtctc ctttgaagga aggctctttc caaagctgtt    258480
     catcgacacc gaagcatcag catagcgctc ccacccgttg gacggatacg cctcgatcac    258540
     aacagtgggc tttccagccc gcgacttcaa gaccgattgt ttgtactccc gcgactgctg    258600
     ctcaaataac ctagtgcaag ggaaggacag gactcgtgcc ctgataccat gctcgttaag    258660
     cagcaattcc ctagtctgca tcgcgaagcc catctcagac ccgactccga tcaagctaac    258720
     atcaaaatca tcgccctcag cctcggcgaa gacgtatgcg cccttgagcg tgccctcgcg    258780
     cgaagagttc ttggggtatt gtgtcagact ctgtcgggag agtgagataa cagtaggcgt    258840
     ctcagtggcc tggatggcag caatgtaggc accggccact tcttctgcgt cgcatggccg    258900
     gatgtaaaga acattaggca tcgcgcggta gagagcggcg acggcaatgg gttggtgtgt    258960
     aggtccgttc tcaccgactc caatgctgtc atgggtggcg atgtggatct gctggaggcc    259020
     ttgaagcgcg gccatgcgta caccggcagc agcgtacaag tggaagacaa agtaggtact    259080
     cgtcatgggg ataaatgtgc ctttgttgaa tgcagaaagt ccgttggaga tggagcacat    259140
     ggcgtgctcg cggataccgt agtggatata gcgaccgctg tagtttccgt tcaggccgca    259200
     agcagtttgg agttcgggct agttttacat taatatcccg cgtcaaccgg agacagaagg    259260
     ctgaatataa agtactcaca gattggaagt caactttgtt tttgtaggcg acattgaccg    259320
     agggagtaag atccgctgtt ccgaccaaga ctgaattgat attcactgca aggttgttgg    259380
     tcactatccc ggctgacttt cgcgtggctg ttggcgcagt aggctggtct tctgtgcggg    259440
     gaatgcattt ggtccagtct tcgggcatct tgcccgcgac acggagcgca aattcagccg    259500
     ccagagcggg atcttcattc tgatacttca ccagggcgtt ttgccatccc gcttcgtgtg    259560
     cgtcaccacg tccagggatg tcactgaaga agtcatagac gtcttgagga atgtggaaat    259620
     gctcgtcagg gttgaggcca aacctcctct tgaagttagc cacttcctcg actccaagtg    259680
     cagctccgtg gatgtcagcg gttccggcct tggcagctcc gtagccaata gtagtgcgaa    259740
     cgttgaggaa ggtgggcttg tcgcttaatt tagcggcaag aagagcgttt gtgatttcta    259800
     gtgtatattg ttagcagagc ttcaccgcca agctgagaga cctccgagac ttaccagcaa    259860
     catccgagtt tccgttgtac acgtctacta cgttaaagcc agtggcccgc atcttggtgt    259920
     tgatatcctc agtgttggcg atatctgcag ttccatcaca cgtaactgag ttattgtcga    259980
     agataacaca gagattgttt agcttccagt gaccagcgag ggacagcgcc tcgagaccga    260040
     caccttcctg caggcaagca tcgcccacca tgcaccatgt catgttattc actagctcat    260100
     ggccgggctt gttgtaagtc gcggcaaggt tcttagtggc catggccagg ccaacagcac    260160
     tggcgagacc ctggccaagg ggcccagttg tgacctctat gccctcattc tcaatttcag    260220
     ggtggccggg acagactgag tcgagcttgc ttgagtggta agacttgagc tgttcgagtg    260280
     tcatgctctt gacgccaaca aggtgcataa agaggtattg ccacagacag gcgtggccta    260340
     tcatgacgtt agtttggtta catgtcgcgt tgcttctgtg gataactgga gggacacaga    260400
     ggacatacca tttgagagaa cgaagcggtc ccggttgaag tagttgcaat tgttcggaga    260460
     atacttcatg acatacttat acagggaaat gccaattgca accatgccca ttggagatct    260520
     gtagacgagg cccagttagc gctgcgccgt gaacaagggg attttcccga agagggcgtc    260580
     gacttaccca gcatggcctt caccatactg ctggcagaga tcagcgatga aagctcggaa    260640
     gacattcatc acccgctcat gcttctccgg gctctctaat ctgagtccag tagcatctcc    260700
     tttgccgatc gctgagaccg cctttactgg caggtactgt gcgggcttct cgaggagttc    260760
     tagcgcaggt gccatggcgt aaggttcggc taactgtgac actaaaaatg actttgagaa    260820
     tagcgcttcg taatgggaag ctgcaaaagg ctagcggaca aagtcgagcg gactgccgat    260880
     tcttatactc aagccatcac tccatatcca tggcgtgccc gacaatccat ggagtgcgcc    260940
     aatactggat cgtggatgtt cggcatcgag acgaagtcat ggatcactcg gatccgatat    261000
     tgtcattgaa ttaacgaaag acgattgaac agagtggcga ctttgcacga acctgttgtt    261060
     gaagaatggt ggtcatagtg gttggggata atccttcgct tcgaggacaa tggccctcgt    261120
     ctcgagaacc cacctgcaac cccgtctcca ataccgtaga aaaaggggtg atcaggattg    261180
     gtcagcttgt cacagcagcc ccagttgcta aacgtacggt cccatgatat gcaggcaatc    261240
     tgataacttg ataatgccgt tatactatcg gcatggcttc cgatgccggt cttgtgggcc    261300
     tgttggcacc tgcattaaca gttcataaag acaaaagcct tcaccatggg atctctgaca    261360
     attatcctcc ggctaatgta ttgctagtgt ctgcttgatg attatgtatt ccactcccga    261420
     tgtttcttgt cctgtatatt ttgtcctttc ggagtacgga tgtatatata ttcaagattc    261480
     cgcaaagctg gattgcgata cacattattg gcacgataat acccatctac aaccatgttt    261540
     cctttgtaaa tatatatggc atactagtat cagtgcgtgt atgtagccat cataaagaac    261600
     acatgatcat acagcgagtg gttatatccc gaaccctgga aactcctcag ttcattcttc    261660
     ttcttttctg ccaaagctca cgggttccga ttgtaccgga gaaaaagaga tttggatttt    261720
     gaggctaaat acaaaaaaaa ggaggaggga attccaatgt gattgaacgg tcggatttcc    261780
     cccaaccccc aagtgggtca ggctaaggcg gggtaatgaa ttccggggag atatgtttta    261840
     acgaccttgg cagcatcgag acgaaaccca cgaaggtatc ctcgatgcct gttactaacg    261900
     caaaagaatc agaaggccat gccacgggaa cccggcgtcg tcgtgttagg ctatctcggg    261960
     ctcgcggatt gagaaccaaa accggatggt gagtggatac tgctgttcgc aatgcccccc    262020
     taagcgaata tcaacctcgc tcacacgtac atcagcctca catgcagaga gagacgcgtg    262080
     aagtgtgacg acggtaagcc cacttgcgta cggtgctcca agtcaaaccg ttcctgtcgg    262140
     tacgcccagg ttggtgacca gggacatgcg actggaccca gggccgagtt tgagtctcta    262200
     agggctcagt cggatctaag ggaggagagg aacgaagact cacgttctgg gagaagcgat    262260
     accaatgttg cagatgtcat ccagggggac ctgcatagtt cccaggggca acagccgagc    262320
     tctggtccag caccctactt ccaagatacc tgcccagccc ctgctgaagc tttcgccccg    262380
     ctccagaata acggctcgag tgagacgcca ctgaatgact gcttggataa tgatcaaaga    262440
     ttatccagta ttgactcgag cttcttgggt tctccacttt cacttagcca gatacccctg    262500
     ctcaacatat cccccggtga atggttcgat ctggtagcgc gggatgccat caacaacatc    262560
     caaaggctta acgattcttc gacgggcgat ccgcgatgga agtttcccga aattgccctc    262620
     tcgcgtagac agtccccagc acctgaatgt cctgagactc agtccgagca agccgagagg    262680
     caccctgatc cacaacgact cggcctggaa cgtcgagatg gcggaatcga atccccttta    262740
     ttagactacc accaattacc ccagccttgg aacacgacga gtaggataga gttgtcgaca    262800
     ctcgacctca agttctttcg atacttcatc gatattgttg ggccaattct ggacttgttt    262860
     gatcccgctc ggcatttcac taatgtcgtg ccgcatcttg cactacgaaa cacggggctt    262920
     ttgaggtccc tcctggcagt cggggctaag catatgtctc ttggcctcat gcctgggcgg    262980
     ggtgaacgtg catcaggcga gcatgcgact caaaatgcga atactccagc ctcgctagct    263040
     gcagtcaccc acctgccgtc agagtcagat cctgctccag tacacatagc tacacagtat    263100
     tactacgaaa cgcttcaata tctctcgcaa accttactct acccacccta tgcggaatcc    263160
     cgtgagattt tggcaacagc caccatgatc agcatgtatg agatgtttga tgccgacaac    263220
     gcctcgacca gtggcgactg ggaacaacac ttgcggggct ccttctggat acagcggtct    263280
     caggacaatg atggcgagtc cgttgacggc ttgagacgag ccgtatggtg ggcatggctc    263340
     cggcaggata tttgggcggc tttccagaca ggacggccaa ccctcacctt ctggcgtgct    263400
     aggaaaaagc tcgaggagct cgactcggat gagctcgcaa caaggatagt ctacatctgt    263460
     ggcaagtgtg tagaatatgc cgcatcggat gggatgtcgg cgaataagga cccaagacac    263520
     agaacgcacc agggtgaccg acttctccgc gcactcgacg actggcataa tgtcctccct    263580
     gcttcttacc agccggtcac tgtcgccacg gattctggct caaatactgt gttcccgtct    263640
     atatggattc acccgcctaa ccacgcaggg gctatgcaga tgtaccattt tgcaagagct    263700
     actgtgctgc tgaaccaacc ctcaatgggg ggcctgaatg cctactgcct ccgggagaaa    263760
     cagctcagtg aaagtgtcaa ggtggtttgc ggcatcgcta atgcttgcca agaacatgaa    263820
     cctgcaatag cctttgttaa cgtacaggct ttgtttggag gtaaatgtct ctcctgattt    263880
     tgtttccgtc cctactgaca agaccgaagt tggccagttc gttcggtcgt ctgaaatgca    263940
     gcgcgagttg ctccggatct tagagagaat gctgaggatc agcaaattcc ccggtaaagg    264000
     acttgttgct aaactccaaa cggcctggca ggtgtaaatt gtaacacaaa agttggcgaa    264060
     ccagagacaa ggcaaggttc tccggactaa attagttcca aagggagcta tgtattctat    264120
     aaggatatta attgagctga ttccaacacg gacctttcat ggaccgagac taaatacaaa    264180
     aaggactatc gttcattctc aattgaaccc cacgtcggct cgttatccgt agatcatgtc    264240
     tttcattgtt attatggacc tcctccctca ccacgctccg acaataccag caaccggaat    264300
     gtcgattcca gtagtgtaag atgcaccgtc agagagcaga taaacgtagg caccgccaag    264360
     ctccttgggg tcagccaatc tgggcatgcc gccatagtat tgcatcttga ggttccagtc    264420
     cggtgcctga ttcacaaagt aggtcatagc agttttaata aagcccggtg agatagaatt    264480
     gacacgaatg ccatgtttgg cccactccat cgcgagcgta tgcgtcatat tccgcacagc    264540
     acccttagta gctccgtaag gagctgaggg agccgcacgg ttgggacgat aagatgtcat    264600
     ggaagcagtg aagacaatgg atcccttgat tcccagctca atgaagcggc gggccacagt    264660
     cgtggcgcag aagtaggcac caaacacgtt gagattgaac agttggtcca actgggcgcg    264720
     gctgaaatcg agcgcgggct ggtgcttcgt cattccggcg tttgcgatga agccgtggat    264780
     ggcgcctcgt gcggagatga cagcatcgat tgcggtgttg acgctctctt cggaggtgac    264840
     gtcgcagtgg acgtaagata agcgcttagg gttggcattt tgcagggcga cgaattcctc    264900
     gccgggttcg aacacgtcga gactgaagat ggctgctgcc tcgttggcca ggcagacctc    264960
     tgcaatggcc agaccaatac ctcggttggc gccggtgatg gcaatgacct tgtccttcag    265020
     ggtgattctc cagtcatggt ctggacctgg ctgtgtgtca aggaaggcgg gggctggggc    265080
     tgcgacttcg gcgacgggag cgcctgtggt ggtgtcttgg atacttggag gcattattga    265140
     ggatgtattt gttttccgta agaatttagg gacaagtgga agaattgata agccattgga    265200
     atgggacagc acctttttaa gtctgtcatg gccttctgct cagccaagcg accccggtat    265260
     cgcctaaaca cataccgaag agctcggtat attgaagtcg cgtaggtgta tcgattgaag    265320
     cggcagttca aagatcccca cgcattatgg aggactgcta ccccgggccg acgcacggtc    265380
     attgtccgcg agaataaatt aagcgatcat gtcctccagg gcttcgaagc gaggcccctg    265440
     tccaaccccc atgcgatgcc tagaccgatc gagatcgacc ctcgcatcga ggcgcggggg    265500
     ggtcctaaac ccacgtggag ctgagcccca gacagttgag cttcatacga agcttgttgg    265560
     gccttggaaa tggtcagaaa tcaaatataa cgagaaggaa aaaccaggaa gcagaatatt    265620
     atggagacag tacctaccta aggtgttgaa ctaatgcaag ctgacctgtc tgtcggctct    265680
     ttcctttgca acttgtgcct caggcagaac tcagaacggg cctctcgggc ggctctttcc    265740
     caatccaaca taaactctct ctccttcctt tgttccctac cggcatattt cctacatcca    265800
     tagtgcccaa ggcctttttt cctgattctg acattagcta catatgtatg tagttaatcc    265860
     caccgggttt ggcgagggct acacttgtct gcttattcaa tgtctgtgct ggaatacatg    265920
     ctgatcattg cggtatgtat tgactcccca tggggtaaat tcccttctgc ggagttggaa    265980
     aatattagac cctcccggtg gcatgattgg tgctggatga gaagctccac gctgacctcg    266040
     atacgatcac cacacacgcc aatcggatag agttccccgg ctgtggagag cgggaattcg    266100
     gagcttggaa agttgtgggg gtggatatgg gaaaaatgag catgacggat gagcgaatgt    266160
     tgggattccc ccaggtccaa agccctagct ttgtatatcc gggattgggg gtagaacata    266220
     tacattccat aaggagatcc atgtccaacc tggcatttta ttctttactc ctccaaactt    266280
     cggctcttcc caacaagcca tcatggaccg cgacttcgag agccaactga aagatgtctc    266340
     ctcccatgag attgagaatg tgaatatcgc cgagtctgtc tcgtacagcc cagaagagga    266400
     gaaggcgttg gtgaggaaga ttgacctcac cctcctgccg actatctggg tcatgtacct    266460
     cttgtcctat ctggacagga ccaagtgagt gacaacacgt taaagctaga ggacttatgc    266520
     tctgtcaggg tgctaacggt cgttttgtat acagcatcgg caatgcgaag atctctggta    266580
     tggaagtaga tctcagcttg tcatccaatg aatattcgat tgccctggtt gtcttcttcg    266640
     tcggatacgt ggttttcgag gtgcctagca agtacgacaa tgctatcctt ggtattctgc    266700
     atcagatcat aaccgctaac cgccctctcc ctgcagtctt gccctgggcc gatcccgacc    266760
     ctctattttt ctcccatcaa tcatgattct atggggtgca ttgacttgtg tgatggctgc    266820
     tatcaacgat ttcacccacc tggtcgttct tcgagtcatt cttggatgtg tggaggccgg    266880
     ctttgcaccc ggtgtgatac ttctcctgtc atcatggtac aaacaaactg aacagtccaa    266940
     gagattcggt gtgttcatat ctgcggccgt cctgtcaggc gcctttggtg gcctgatcgc    267000
     tgccggtatt gttgatggcc ttgagggcgt tcatggtatc cgtggttggc ggtggctgtt    267060
     cattattgaa ggcgcggcca cggtcggttt tgctatcatt tccctcttca ttcttcctga    267120
     tttcccaggt acatcgcgac gtctctctga tcgcgagaga cagatcgctg tggcgcgcct    267180
     ggctactcag aatgttactg ctaccaccga ggataccgag aagctaagca attggggtgc    267240
     ttgtaaagtc gcttgccgag accttcgcac ctggacgttc gtgattggat atatggttcg    267300
     aactgccctt tttcgccctt gtcttgaaca tcactaataa ggccatcctg tataggtcat    267360
     cgtcggttca agtaccctga cgtacttcta ccctaccctc gtgcaaggac ttttcggaga    267420
     cgcatccacc aagaagatca atttattgac tgtaccaatc tatggcgtgg cgtttatcgc    267480
     caccggtgtc acatcctact tcagtgacaa agttcccaac tggcgtggcg tcattattgc    267540
     tagctggctg acattttccc tggtatgttc gattattgtc tgtgttgtgt acaatttcac    267600
     agctcgatac gttctcctgg ttctcatggc atccggcctt tgggccacca atggaggtac    267660
     actggcctac gcctcctctg cctttggtgg gatgcacccc caggcccgag gtgttgcttt    267720
     ggctatggtg aatgcactgg gtaatctggc acagatctac ggatcggtac gtatcttagc    267780
     aaaacattat ccctattagg caacacagct aactggtaac gtacagtacc tgttcccaga    267840
     aaaggatggc cctaagtata tcatgggatt ctctgtcatt tccgcgatgc tagcggtggg    267900
     cgttattgac tttttgttct tgcatgtttg gttccgtcgc cgccagcgca acctgtgatg    267960
     atactccatt gttggatgtt gaaaggagat ctagtctcct ggattatgag tacacgggtc    268020
     attcgtataa ccacagtgaa cattgctaga ggcggatcct gaaatatatc caatgttgca    268080
     catgagtctg taggtctctc agaatatagc tatgacattc taactgaaaa tcaatccatc    268140
     gtgttggccg tcattttgca tattattgag catgaaatac ccgctagtaa ttcagatatt    268200
     aaaggaagtt tactggtgac ggtctaggaa cctccgtaga agagacaaat gtttccaagg    268260
     cttgatgttc ggccggtgta agacacatct ggtagtaacg tattttggaa tcaacctgac    268320
     cacccactac ctgagccatg tatttcttaa gttggcacaa gctattgcct cactctgggc    268380
     ctcgcccgcg ttaacctgac gaccagattt tatctcgtta attgtgccag tatggctgga    268440
     tgatcgcttc ggggtggaat tgcaccgaat atatagcgcc attgaataac agttttccaa    268500
     ggttggaagt atgataatca tgctagcgtt accatctagc tatgacaaca acaacttcac    268560
     cctttggcaa tctgactggt gtctcgtgga agatcgcggt aaagctgagg gtcgtttggt    268620
     ggatactttg tgaaggcctc acccggcgag cctttgcagt aaacaagaaa taagtaagaa    268680
     aatttaacca gttctaaccc ccgagacaga cctgtaaaca acctacacat gtggccatta    268740
     agcgagctct gaatctgaaa acgaacatag ttatccgtaa gaaggcgtaa ataacctggt    268800
     atttcctata tacagctgta aattactata ttgcctgtgt atctttgatc tcatacttcg    268860
     cttaatggcc acatattctc gcttacggac cacattggtt cgaccgattc gatccaagcc    268920
     gagtcgttgc ggatcagggt gcctcccggc ttgctcggtc aggacattca ggtgctgggg    268980
     actgtctacg cgagagggca atttcgggaa acttccatcg cggatcgccg gtcgaagaat    269040
     cgttcagcct ttggatgttg ttgatggcaa cccgtgctac atcaagccaa ccatgaaata    269100
     gagaacgagg cagaagtgcg gaagaggacg tcaagcaata tttcctttac ttgcgttgga    269160
     cttcccagat actgcgtgcg attgtccgaa gctcactctc cttgattata atatccttct    269220
     cgacggggga agatgtaggt cgttctagga attgctcgaa tgggataatc aacggggcgt    269280
     tcgaaacggt aattttcctt ttcgttttcc cacccttggt catctggatc cgttgcaccc    269340
     tgtttatttc cccgttggct gtgtcccatt catacctatc cagcgttatc tgggcctttt    269400
     ttcgattcaa cttgggcgtc aaggcgatgt tcgcgttgcc tcgcgctgga tccaaccaaa    269460
     aggtagcgtc ggcctcaagt ttgggttgcg attccgagac cccaacttct aggacgatgg    269520
     tcggcctatg gcgacgatcg gagttcagcc tccttggacc ccagccatgg tcagggactt    269580
     tgccttggct atatgcttcc acttttgtga acttctgtat gacgtctcga agtcccatat    269640
     cgtctagctg gcgcatgatt gtgtacccaa actcctcgat cgcttgcgca tgttcttggg    269700
     tttgcatctt gattatgaga agattttcct ctgtattgaa agagtcgaaa gtaaaggaat    269760
     tatcttcgat gtcaggatcg aggaaatctc ttttgagggt atcagcatcg atatcaaaga    269820
     ggatgtactg tgatgtgtca tgtttcgaac gctggaaacg atcaaattca agatctctag    269880
     ttcgaaggaa gtgctccttc ccttgatatc gatacctctt agtcgacaga gggatatccc    269940
     tgaggaagct acgcccaaca tgatgttcgg ggttagaacg actttcagtc attttatttt    270000
     ctttgtgaag gcacagacga tagaagatgt acatggccag gaatagttac acctatacct    270060
     acatatgtag tccaggatag gtggcttatc tcattatgag cgcattgcgg taggctacgg    270120
     gaaatgtcca cgggtgtcat cttgcgtttg cccagctgta caactgaaac ccgccaatcg    270180
     gcttagatta taaagcgccg gggtctaata tagcatgcag gcagagactt ctccccagat    270240
     atcttcacct aagcagatgt tgaggctacg atgcagatgc agatactagc agcggggaaa    270300
     atcaggaaga agaaactgat gttaaatcta tgaaaagaag gctgtttata aagcctgatc    270360
     taacaaagaa atggcaaact agcaaaggct cggtctccat gacataaaga gacatccgat    270420
     ctatagggat tctccaacag cagaccatac gcatgtaggt gcccgtacac aatatacatt    270480
     gagtggagcc tttatatctc acacacggcg ttacttaggt gtatagtaag aactcggatc    270540
     caatactgaa ggatcagagt tcagtctgaa tacatacaat actggttgca gaagcattcg    270600
     cagcctggag tattatagac ctctgtcact ctgatcatac acccaagacc ccttctcaat    270660
     aggttcaata gatacttcgt gaaggcctcg cccaacgagc ctttgtagta aacaagaata    270720
     agtaagaaaa tttaaccggt tctgacccca gagaccggcc tgcaatcaac ctacacatgt    270780
     ggccattaag cgagcccgtg gccattaagc gagtactgag tctgaaaaca aacatagtta    270840
     tccgtaagag gactgtaaag taacctggta tttgtgatat ttggctgtac attaccgtat    270900
     ttgactgcgt atcatcgatc gcatacctcg cttaatggcc atatattctc gcttacggac    270960
     cgcattggtt cattcgattc gatccaacct caacttagca taccagagat actacctagg    271020
     tagaacttac ttaccatgga atagccacta catatgtatc aagatagcat ggcaaattca    271080
     ctattttgct ataccccagt ttttggggct taaaaggcct cacgtacccg catagctaaa    271140
     accatctttc aacacaatgg aaataaaaag ggctgctatc ctgatcatct ccgacgaagc    271200
     ctcagaggat tctagtttgg accgtgcggc tagagctctt gcgcctgtcc tggctaagga    271260
     ggaaaagtgg gaactctccg caattcgcat agttccgaac aactatctcc agatccagca    271320
     agcagtttgc gactggacta gtggccccaa ttggcaccat ctagttctgc ttagtgctgc    271380
     gacaggctca gcagccaaag acaatactct cgaggtgagt ggaccgttgg gacctttgct    271440
     ggccaaccgg ctctctggtg tgctaagaat atcatattag gccgtcactt ccttgattca    271500
     ccgacatgct ccgggtctag tgtgagtgca catgattgca tctgtggact tggacttatt    271560
     ctaactacgt aatgacttgt ctagccagga catgatcgcc gactctctga aatttactcc    271620
     atgtgagaat cagtcctccc ctttgattat atacatccca gctcattcac ttccagtcgc    271680
     aaagttggag agacctgttg gtgtttgcga caaaactttg attgtcagtt taccagggtc    271740
     acccaaaggc gccatggaga accttgaagc tgttatgaac ctcctccctc gtgtcatccc    271800
     gcagaaccct cgtctaccac aacctcgact tcaaccctat cacgattacc accatgccca    271860
     tggccatccc atccgcaaag cacacatgtc tccacaagac cgtccccgat ccaaatccaa    271920
     cagacccgcc atgggcctca atcagcgcta ccgcccttgt gccaatccta tgctttcggt    271980
     agaggaagca ttacgcgtga tccgcgagca aacccctgca cccattgtgg tcgaaacccc    272040
     tatcaccact tccatcatcg gctccgtcat tgccgaagat gtctatgcca gcgagatggt    272100
     accggcgtac cccaccagcc ttgttgatgg ctacgccatc attgccgaag aaggcaaaac    272160
     caccaatgcc ttttttcata gagctacgat caccctcccc aacagaagcg gagccttcga    272220
     gcccctacat ccaggaacca ttgctagaat taccgccggc gcgtccctcc ctcccaatgc    272280
     caacgccgtg gttatgttcg atgacacagc gtcctcaacc ctagatggcc aagacggaga    272340
     aattgtcgaa atcctggccg acgatatcgt cccaggtgaa aatatccgcg agcccggcag    272400
     cgacgttgcc ctcaactcaa aggtccttgc tcggggcgac cttatctccc cagtcggtgg    272460
     cgaaataggt ctgctggctg ccacaggtac gcgaactgtc aaagtattca agaagtgccg    272520
     ggtgggcgtt ctcagtatcg gtggtgatct tgtggagcat tcgaacccgt ctaccctcgt    272580
     cagaggccag atccgcgact ctaaccgtcc atccctccta tcttgcctag attcctgggg    272640
     ctttgagacc gtggaccttg gcctggcccg tgagactgca gcaggcgagg tcgaacacac    272700
     ccttcgtgac tccctgtacg gtgtagaccg tgcattctcc ggtgtggacg tgctcgtagt    272760
     cactggcagc atgtccctgg gcaagctaga cttcactcct atcattgaga gtacgctcgg    272820
     tggcaccatt cactttgacc gcgtctctat gaaacccggc ataaccacca ccttcgcgac    272880
     tgtacccttc aaggccacca cagccgatgc agctaccgaa aagatccggc agaaacacgc    272940
     ctcaaagctg atgttttcgc tcccgggaga cccagcctcg acgctagcta ccctcaacct    273000
     tttcgtccta ccttccctcc agaagtttgc gggcctaggc gagtcttccc aggctatcgc    273060
     taccaagccg gggagtacgc cgcaacttgg tcttcctcgg gttgctgtcg tcttgacaca    273120
     ccacttcccc ctcgacccca agcgcaccga gtaccaccgt gctgtcgtga cgggctctcg    273180
     ctcggacggc cgactatatg ctacgagcac tggcgttaat tctgtaggca gtcttgccaa    273240
     ggccaatgct ctagttatac tccgtgcggg gcggggtgtt gggatcaaag gtgaaatcgt    273300
     ggaggcgctt atgatgggcc ctgtctatgc ctccgatacc cgcattattt gctaagactg    273360
     cgcccatctt acaatgaaat gacctgtgta aatggaggca gcattattct gagttttacg    273420
     cttcttcatg tatctactgc ggttttgggg aactaaggtc atccatgacc ctcaaagatt    273480
     gtacatagcg tgagaattgg ctacttttgc caagttacag aatgtggcaa ccgatgtaag    273540
     tctcttaata ccaatgcagc cgtggactct ataagccaag catgactcaa tgcaagtatt    273600
     tcaaggaaaa aaaataacgc atgatcttaa tcaaacaagt ccaccatcat gaaatccaag    273660
     taatgcgtat aatgggatct tttatttggt acacatcacc atctgcattg tgctcgatct    273720
     caaagttgat gcgagggtta agggatcgca actgaaagaa cccttaatgg agaaggacca    273780
     tgagacccat ataacacaag gcggacgggc agagaggaag aggaggaccg agacagagag    273840
     caactatctg tctgcataat attgaggatc tgtcctagct agagggcgta tttatccaac    273900
     tgccaacctt ctaaggaaac gatcacattt ccttccccta cacaaatacg ccttctacaa    273960
     cagtatccga ccttgcagta acgatgaaac tcataatagc tggcgcaacc agcctcctag    274020
     gcaccgagat cgtgagacaa agcctgcaaa ttcgcgccat cacccaagtc atttctttag    274080
     ctctccagcc ggtacagctc gacaaaagta tcgacacatc gaagttgaag aacattgtca    274140
     tccgagacta cagcgaatac cctgatgacg tgaaggcaga gcttgctggg gccgacgctt    274200
     gtatttggta agttttaagg cagcaccctc attgccttac aagactgact acaaccctct    274260
     cttggtacct ataggactgt cgctgtcacg cccttacgta ccggcaaggt tgaactcaag    274320
     cgtgtatgcc aggattacac caagctcgga ttcaagacca tatgcgaggc tggaccggca    274380
     cgtccctttc gctttatgta cttgagtgcg gagggaatac ctcgagaccc aacaaagacc    274440
     ccagtaatca tgccagatta ccacattatg cgagtaatga gttaaacacc caccacgtgt    274500
     tcttgatctt atgctaatct cgtgttttgg taagccagtg caatacagag ctcatggtcc    274560
     tcaaattccc taccgagaaa gaaggtgttg aggtttgcat cgcccggccc ggtgtgattg    274620
     ctaactcgtc gacttggtca agagctttgg tggccaacct ttttcgtatc gtcaatctct    274680
     ttggtcagcc ccttccatat gtacaacgga gccagcttgc agcggcactg ttgagccagg    274740
     ttatggatgg gttcgagaag caaacacttt cgaatgccga tctcgttcga attggacaaa    274800
     gggagatgaa ctctcgcagc atccctcagc cttcatgaat attcctaagg aaagtcataa    274860
     gattcagaca ccactttatg cttttcatct tggttactgg aaaacctgag gacttgatat    274920
     caggttacca aggatccgaa ttggatcctc agatgcaaca ggtgtgacaa gtgtgctcct    274980
     ttgccaggag gatggaggga aactcaaagg gaaattcaag atgcgttgag aatagggaaa    275040
     aaacttggca gtcccagagc agtatacttc agggatatag gctgtatgca gcggtcgtgg    275100
     tagactggct gtgcctgcaa gctgacctct gctcttttgc gattcgagaa tatcaccatg    275160
     cacccactga tcaggaggtg ttggtggcaa ctaacacgac atatggccgg cctcgctcaa    275220
     acgagagtaa ttggtgtcga gttgcagaat gtctaatcga agcgagtggt ttctgcgatg    275280
     catttattcc tcgtatagag acatacccag agcatacatg aaccagtaga ggtgttcgac    275340
     acactgttta ctgtttacag gtggccaaat ccagatccaa tagcatttgg ggcaaatttc    275400
     tcccaaaggc taggccatct tgacaatatc agacttcatt ttattgtaag ctgtcgaaca    275460
     tcgactacgg actgtacctg tctgacctag gtcaaattga cctagaccaa atatcaagac    275520
     ccattataac aattccaatc gacggaaaca tttctatatt tgacatccca accgagaggc    275580
     aacgtccatg tgcgcaacca caaaatgcca tgaatagtca tgatgacgaa gtacaattcc    275640
     cccagcataa aactatggcc acacgttcaa acaccgtcaa attttcccaa acaccatcag    275700
     tgtacattgt tcaatccata aatccataaa tccataactg gaattcaaaa atcccatcaa    275760
     aatggccaac cgctccgatc cccaaaacga gcagaacggc aactcagaaa tgaaagatcc    275820
     cgtccaaccc ggatcctcgt cctccgacat cgacgaaaga atgagtacgc agcttgcctt    275880
     gaaccgttcc gcgcatactt ccgtgccttt atcttttcca tacctgctga caacaagccc    275940
     agcccgggat tacgagaagg ccattgatga aaccaacgtt atcagcgaag atcgccttcg    276000
     tcgcgcgata ccccagtcct ccacatcgta ccatgaaccc accgaggata cgtttgacat    276060
     ttcttggcgg ccggatccat cgggtcatcc gcggaggacg ttttaggtgt ataggggtat    276120
     agttggttct ttgagaatag ggaatgaact aatctttcat tcacttcaga tctggtagta    276180
     tcgacttgcg gagcgtagat ggctggatgg cgattaggag attcgaaact atgctaattg    276240
     taagatccta gtgagatggg tgatggctta gcctccatat cgggattggc gggagtggga    276300
     gaatgtttag tccacgttaa accctactgg tcaagcgacg ctgaccccgg attccggacc    276360
     agggtcatca tgcaggcagg cgggtacata catgcgaatt tcgagatcgc ctgcatagcg    276420
     ggagatctac gatctcgcac gggccttcta cgcggcatta atgtggggga atcgggagag    276480
     acgaatatgt aaatcgtgta aacgtgaggt tatctcgcgg aaattcaagt aaatgctata    276540
     tgtacatgag tcatgtcgaa cgccgtccca atttgtgcaa tccacctcaa agctttcctt    276600
     gggcctcctt ggccgccttg gcgtgacgct cgaaagagga cacgggcgga gcggagttgg    276660
     ggttggggtg gtgcttcttg agggccatct tgacattgta ttccaagtcg agagtggcct    276720
     tggggtcgtt ggtcttgggc ttgaagtcca cgacgagatc atccttgacc gcgaagacgg    276780
     agtcgatggc gagatggggg tcgtcgctgg ggtagatctg gttgatgaca gtggcgtatt    276840
     cggggtgggt gatcatgagg tggatgtgag cgggacgcat gggcgagcgg tccatgagtt    276900
     tgagaaggac accggcgggg ccgtcggtgg gcagggagta gggagtgggg tggtagcagt    276960
     accagttgaa ttctcccttc tcgtttgatc ggaacttgcc gcggaggttg ttgtcggact    277020
     gggtggggtc ctggaaatcg tattggccgt tggctgaggc ttgccagatg tcgaggacgg    277080
     cgccgacgat cggcttgccg gtctccatgt ccctaaggac accgtgcata aaagtgacac    277140
     ggccatgggg attagggtcc tggatgatgc tgtcgccgag agcgcggaag ggggcgttgg    277200
     gagaccagaa ggggccgaga atgacgttgg aggtagggga gacaccgtcc tcggtgacga    277260
     tcttgttggc gatctcatcg acgagactat gaaatcagtt agcttccatt tttgttttct    277320
     cggttttctc catttttatt tttctttgcg caaataaaaa taaaaataaa gtcagatgcg    277380
     aaacttacga ctcgaggccg atcacgtcac agatacggtg gccttcattg cggataggag    277440
     tgctaatctg gccgatagag ttgatgaact caacgccgag catccactcg gcagaggtca    277500
     gttcaacctc ccgagcgaaa tcatgaatgt gcttaataag agaacccaag accacgcgag    277560
     cgcgctcggg ggtgttgggg cccatgccat tgatgacaga gggggtgaag ttggggtcga    277620
     actggcgtgt gggagacata gtgtatgatt ttgaagatag ttaaaaatta aagaggtcaa    277680
     ctcagggcga cctttccagg tctatataca tggcgaacgg catatcgttc ggctggtgat    277740
     ggatgtgggg aaatcgcaac ggtgccaacc gcgcagaaat cccgttgcca cctgccgaat    277800
     gttgtgatcg cgtgaatccc agatggtccc atactggcat cggtcagccc tcaacagccg    277860
     agtggcggct cgtcccctaa tataccagcg cggggtggcc ggggtagctc ttatccgcgg    277920
     gtaagccccg ggaggtgcat atccgttttc accgcctttt gattggttcg gcttttgctt    277980
     tggctgaact tccggatcac gtgccattat gtaataacct tggaagacat ccggggccac    278040
     ggatttcccg tatattcttg ggtatactgt acgtgaccac gatgatagca ggtttaccat    278100
     gatgagcagc tcaacaatga cataaagtat attacttgtt cttttaggac atggtggtgg    278160
     ttgtttgttt ccgaccctga gcgagcatag aatcgtcttc tagcgttatg catctctatg    278220
     cggctcttcg agtgaaatgc ggttttggat gcaatggtgt tcgtatatgt taaattccca    278280
     gtatgactaa tatttgattt gatattgaac attatcactg gacatcgacc ggtgtgtaca    278340
     tgtatgtatg tctacatact tttcctacgg ttgcacctta ctcttttaga gaccattact    278400
     gtcttcttct tgaagacgcc agcgcggaaa tggtccactt ggtaaataac gaggctaagt    278460
     ccaatttaag aagttccagt tcgcgtccaa aatcataagc taatcataaa gcgatgcaac    278520
     agaaacagaa acacttcttc tcactacaat caccaagcca aaaccgcttt ctgagctcca    278580
     caggccaaag aagcacaaat ctgctcatcc ttctcactaa cccctgcatt gcatgacatt    278640
     ttcggtttcg ccggccagat ctcccgcccc tcggatttct cacgctcaaa gtgctgcgtg    278700
     atgacgtcgc ggaccgtgct ctggaagaac agtggcgcct tctcatactt ggggtgaagc    278760
     tcaccactgg taaaaacatt tcggtcgaga ttcttctgag cgttgttgca gaggactttg    278820
     tcttcaccca tgacgcgcgc gtacatgtca ctgataagct tgaagtcggc atcggaggag    278880
     tttcggtttc ggtagatttc gtaggccatc ttcgagcttt ttgcgcttga ggggaggaat    278940
     ttctggacca tgataaagtg tggcctgtgt atgttagagg atcttctata agaaggttga    279000
     aactgggaac acttacgaga caaccatggc ggacataggg aagtagtagg tacttgctgt    279060
     atagaggccc ttctcgattt gctctggcgt agactcgcaa tggtgttgga tgtgtccatc    279120
     tttcagatcg ctgtcgaaag attccatgtt gaggaatgca ggaatatcgg cgtgtgtcgt    279180
     agggcagtgg tagcattcgt tgaaattatc agccagaatc ttccagttat agtcaccctc    279240
     gagggcataa tcgtggtcga aatcgtagtt atcgaaattg taggctttat accgttcttg    279300
     cttgtcgacg tcccggaaat gttcctccca cgacacttct gggacttcat tcgcatccat    279360
     gtttacccag ataaagccat tgacgtcgac cttaagatgg attctgaaaa gtccgttctg    279420
     ctctttgtcg aagtcgctga gctcttggta gttcgtagct ttcgcaagtt tgccattcag    279480
     tccgtaagac cagccatggt atcggcaagc gaggattttg gaatttccgg aaccctcttt    279540
     ctcgactaca gggtacgcac ggtgtctgca cacgttgtgg aatgcgttga tgtcgccctg    279600
     tcggtcacga gtgatgatga agtcgaaacc tgcaagctcg tagcggagcc agtcgccagt    279660
     gttcttcaac cgcatgctgt gggtgatgaa gagccacctc ttcgaaaata tggctcgacg    279720
     ctccaactca tacatctctg gtgaagtgta ccatgatgca ggcaaggcac ggactgggga    279780
     agctttagtg tcttctttgg aggcaggggc attaaagcca aagtagttga gcattgaagc    279840
     catgaagaag taataagaag gtacaatgga gaatgccttg tagtctttgt tggctcaact    279900
     ggtcataatc aggattcctt tttatatgct tgaaagaact tgatattgaa ctggtagcca    279960
     tgtctatact ccgatcatat ggacggcctg gatccaattt ggtagggcaa acccatcgcg    280020
     aggcgggtgg atgttccaag aacagatatc gaacccgcca atccgccacc acagtactac    280080
     aatgtgtact aaaaacaggt tgatttaacg ccatgatgta ttattgagtc aaaacgttat    280140
     caaacccgac atttactcag gcgcacactc gggcagatat ctcgtagtcc atgctatagc    280200
     gggtttgcta gagctggtca tgcatacttc gaacgccggt cgggttctac ggccaattga    280260
     agttcgcata aataagctgc atgggaacta ttgttgagct atattattgc cgatggaatc    280320
     acgaggactc gggtttctca aattgtggag atgagtgact cttacagaaa acaacattct    280380
     tgaccagtat ggagggccgc gcatcgttct gggttcctta tcttgtttgg tgtttgacag    280440
     aacgaaaaat gagaatcttc cgtcttgtct agatttagag tccgaacgga ttgttttagg    280500
     ataagtgggg ggctatagaa gatcgaggtg atacatatag cccatagaac aatgtggctg    280560
     gaaggacacg tcgcaagact ttgtatcacc tacatatagt ttgcaaatgt tcgagtattg    280620
     ttattgtaaa cgagagaatc tagaacatat accaggtcat agcaaacatt gaacacagga    280680
     gttgtccctc ccgaggccgt gatgcaactg tctttccgtt ttaggctcac ccctcgccgc    280740
     ttttgctcca gcagacccct ctcaccaacc acgtcagtga gcattatgtg actaaagaga    280800
     caaccattaa tcgtcctatt catcgtcacg tttttctctc ttttagtcgt attcacataa    280860
     atcgtctttg gcggaaagta agtttcaggg ccagcagaca aaacatacac tgtactgtca    280920
     cgatctactg gtgatttcca tggaactagc tttggataat gcgatgttga atcttcattc    280980
     cagcatcaaa ggtctcgctt cttcgcctca cgcagttcgg ctcgctcttt cactagattc    281040
     gaaatcgcat tgccggtatc gcctcctaac ttcgcgaatc cctggatcac accctcacgg    281100
     tccccgggcc gcatttcctg gctcatcttg aacttcccct gaagcttggt gattcgaatc    281160
     tcaatcccaa caatgttctt cttcagcaag tcagtgtacg acttaggcgc ctcggacacc    281220
     tcccacggct ctggtgactc gccaccagtg taccccatga ttgatttttc cgtatgctgc    281280
     gagagatcat gcagttgttt ggcgaggaat tcgccagtct cggatgtttt ggaatcatag    281340
     tatagcgaca tcttgccgta ggcctggacg gcggagtaat tccatgtggg cacgaccttc    281400
     cctgtatctg gctttgtctc gacgtagaat ttcggagtca cgtaatggtc gtgtttgcca    281460
     ttgaagagca ctaggacgtc gtcgtcgagt tcaaggacgt tcgggggctt gttatccacg    281520
     gcctccatca tcgtcttcac ttgaggattc tgcttggcga tgtgtgcgcg gagataggga    281580
     tctgttttgc ccgtttcctc tgggaaatcc accacaaatg gggcatgggt gcactgcagg    281640
     aagtcttgct gggaggagtt catgccggtg attaaaaccc cgagtgggtt ttgccggatg    281700
     aaatggagca aggcctcttt gtctttctcc tcatgggcgc tttggaagaa cattttgaat    281760
     agcagctgga aggtaggagt cagagtatgg agttggagga cgaaaaggcg tgaagacaat    281820
     tgtgtaggaa caaaatgact caaatcaagc ccaccgaatc tcacattatc gtatcggtga    281880
     tttgttatca gtggccaagg attcgtccgc taaaggcatg tccaaccggc acctgcagag    281940
     tcccgggaag gtgcaggcac ttttgacatt tccccaccgg attataaaat gcccgagaaa    282000
     aggcctttgc gaattcacgt atgattctga ttacatccat tattgatagt tgaagaacct    282060
     gatattcatg ccagaaaaga aaaacagtgt tgtcctggat tgtagcagtc taactccttt    282120
     tggctagcat cattcacagg gaccagatta ggtatagcgt aacataccta cattggcata    282180
     tgccgagctg ctattggcta cccctgttgg tgatccactt tactcaatct aggtacaaaa    282240
     tacagaacat aaggccatac tttaatttgt ttcattcgct cgagccacag aggatctttc    282300
     tgctgacaat atcaaagtca atttacccaa tagtgtctat gaaggcgata tctgcgcctg    282360
     tgtttgactt gatcatgctc actttacgag acttaaagac ttacaactat tctttttttg    282420
     tcaagcatcc tgcgatagtt gcggggatcg gaagaaacat acggaagtga tgaatgtttc    282480
     cagtgaggtg caactcatac gatttaagct atcgggaagt ggcgatatgg aagggatgca    282540
     tgaatgtagc tatttccagc ccgtgtctct tgcttgtggt ttgtctatac agatagtttc    282600
     tgtcactttc acatacgagc agcagtgagt ttacttatat actttccaaa atggtgcgaa    282660
     gaacgtcgat tttaggatct ttagtgtggt ggataccgtg ggagcttgcc tggtgcaaag    282720
     tcaactctag acgcgctatg gtcttctggg gggctagccg aattgggtag atctaagaag    282780
     cccgggtccg ctatatacct taatctatca gaactgactt accctagtcg tacctttgcc    282840
     aggtctttct ttttaatgga ccaatctgcc ttggtttaag aaattgtcag cacgagcaac    282900
     gcataactga gaggcaaggt ccagcctcat cagttatgat tctcaaagta gggaacgaaa    282960
     cataagtccc gatgatagaa ggaagattga aaccatcgat ctgccaggtt catgcgttga    283020
     cattggggct gtctggtatt atgatgtgac attaaaaacc acccaccacc cagggcaagt    283080
     agcactgctg aggaggttgc ccctggctgc agagtatgta tgttgtgttg agatatgaga    283140
     gttaaaatat aggtcttgag acactatcag caaatgtggg ttaggtatca accgagtcca    283200
     attttgtaac agaatcattc attcgatata taagataggg cggtaaaatg agggtataga    283260
     tttgaacgcc gtaacaaatt gccaaaaaac aaaggacatc atagaagcct taaagggtcc    283320
     agaaccaaga ctccatcgct ccaaagcaga agccacatgc gtaaaaacat aaagaccggt    283380
     ttttgattgt cagcaggtcg tcagacctcc ccgcatataa cgaccgaatc ccactgactt    283440
     agtcaatggg attaaagtag aatatcaatc aactagagaa aacgcgagga tgttctggca    283500
     tgcgggtcca cgttcagaaa catgaacgca gctcgatcgg cacatcttct tatagtcgac    283560
     atcataattc gtcgagttca tcttcgccat tcgtcatgga gaattacatt gatgcaagac    283620
     tagcagatcc tgcagccgca gatccccagc gcagttttcg gagtccgccg cgaaccgctt    283680
     cttggccaca ccctaccgaa gggcgagggc caggaacacc atctcccatc attcccacct    283740
     cagctcgccc gacctcacgg ccgatcatat aacccgcgga aaagctgatt gcggagaata    283800
     gaacgacgac cccggcgctg atgacccatg tcatgattgt ggggctgaca gtcgctgctg    283860
     gatctgtcat gctcacgcga cgactcttct tcgaggcagt accacggtct ttaggggaac    283920
     ttgaacgacg ctttgctttg gcgacagccg ggtcagatga taccgctggt gctcttgcgt    283980
     gtctctgtgg tgctcctatt gacggacctg attctggata ccgcggcgag gatgaggtca    284040
     cttcatcgct gctctcctct cccatagcaa ctgaagcacc tactagtcgg aatgaagctg    284100
     gttgaccggc ttcagaggga gcagctgggg ttggtgacgg tcgattgtca ttctttggaa    284160
     ggcctctggc ggcagccgca catgaaagaa gtgttgatag gctggcacga agggcagcat    284220
     cgtggtcggc atgatgggaa ggggaaatca tattgtaagg gctgtgttgg tattgagctc    284280
     tccgcgatga ttgtggacta gggtaagatc ctcttcgaga ggcacggtga ctagaggtag    284340
     acgggacatt gggttgagaa cgccgcgcgg tccatccggg ttctgacctt gcaggtgggt    284400
     gtgtgaatat gtttggttga ggtacgaaag gtgacgggct gatgcccatc cccaaggcag    284460
     tagaagtatc atcttcatca tcgctagggg cagcatccga acctgaggag ggaggtgcag    284520
     agcgcgcaga taatgcagcc gggagcgttg ggcggattat atcttcattc gagctgctga    284580
     gaacacgatc agactcactc tcgctctcct cgtattcctc ctgactgcta ttggcttggc    284640
     tggcatcgcg cgatgcatag tccacctggg ctgtggtgat agcagcaaga tgttgtagac    284700
     ggcgtcgccg attgcggcgc tggtgcgctc tcccttcgcc atactcgacc tgtaagccag    284760
     tggtgattat atcttcattc gtagcagcag aggagaagga ggaagaggac ggttgcgagg    284820
     acacgtcaat ccaagaatct atgtagtatc gtagtgagta cattatggag acctgacagc    284880
     aattttgtat gcatattgaa agtgcaccgg caggggaggt accagtcgga ttataaaaag    284940
     gaccacatac cctctgatct catgggcacc gcaccagatg gctggggctg accgttatct    285000
     cgaagcggct gatggccatc acgcgtcatc cgacttgcgg ctctaggctc gcgcgcctga    285060
     cccagcaggt cgcagtgatt tggttgcata gccagaaggt tgaaggaata tgaaagcaga    285120
     atatgcgagg agacggtgtc tgaacagaaa tatagaagag aggggatcag gccactctgg    285180
     agtacaagag agcggtcaac gtggaggggg aggtgatctt atcaaatgtg gagtcgacga    285240
     tcactgatgc ccaaaacact tcatactcct tcccgcacac aggaaccagg agttaaaaag    285300
     agttaaaagg aactaaaata gatagattaa tattggcaaa cggaaaagaa gacaaaagga    285360
     agatgaagag agccctaggt ggaaagattc gaaatgatga ggtgatcagc agaccgaaca    285420
     ggtgatttgc agcccgtgac gaggcaaaag ggcgaaagat gatgtgaggg gttgccagtg    285480
     accaatggag aatatcgaag ttcttattgt agaatatgag gattccaaaa gctcgcagag    285540
     accacctttc atcaagactg ggatggaaga agcagaaatc aatgaatcaa cgtccttacc    285600
     tatagctagt aggcaaaaca aaggatgcgg ggaaggcggc ttccagtggc aatatactga    285660
     cccatagttt cacaacacaa gatggaaaaa gcggatgaag ttgaagattg accagaatga    285720
     aaattgaaat gacgtatcaa attaaagata cctgagctaa gatcatatta cacataatta    285780
     aacacgaact tttttctctc aaagagaacc tgaaacccat ggacaccaat atgttgcgga    285840
     aatcaaacgt atgcagtgaa gaacatcaag tttagaaggt gaccttggta cccttgtact    285900
     cagggatgga gcccttaccc ttgttaaggg caccaccacg gccgccacgg tcaccgaagc    285960
     caccgcggcc accgcgacca ccaccaccac gtccaccgaa accaccacca ccgcgaccgc    286020
     cgaagccacc acggccaccg ccgcgaccac caccacggcc gccgaagcca ccacggtcac    286080
     caccggcagg acggggagta gagaagtcga gacggacggc acggccctcg agctcgtggc    286140
     cgttgagagc accgtgggca gccttggcct catcgatgga agagaactga acgtaaccga    286200
     agcccttggg acggccggtc tcctgctcag tggggagacg gattccgaga acggagccgt    286260
     gggcgccgaa gacctcgtgg agagcatcct cagtagcgct gaagggaagg ttgccaacga    286320
     agagagtgtc gctctcgggg ctggtctggt caccgtagga acgagcacgg tcctgggtac    286380
     gatcctgctg ggggttggcc tgacggggag cggcgtagtc gaggttgatg gtgcggccat    286440
     caagatcagt acccttcttg gcctccatgg ccttggcggc atcggcagcg ctggtgtact    286500
     caacgtagcc gaaaccacgg gagcggccag actcgcggtc ggtaacgatg cggacaccgg    286560
     agagctcacc gaactcggag aactcacgct ggagccactc ctcgtcgacg ttccaggaca    286620
     ggttaccaat gaacaggttg gcggaagcac cctcgggagc atcctcggtc ttggacttct    286680
     tggcagcggc ggcaggctct tcatcagcct tgcgcttctt ggagacaggg gtttcctcag    286740
     agtcagagtc agagtcagag ctgtcagagt cggaaccaga ctcggagtcg gaagaggcct    286800
     tcttggcctc ggactcggac tcagactcag agtcggaaga atcggaagac tcagccttag    286860
     cagcgacctt cttctcggcc ttcttaggag cgggcttctc ctcctcggac tcggactcgg    286920
     agtcagagtc agagtcggaa gagtcggaag actcagcctt agcagcagcc ttcttctcgg    286980
     tcttcttagg ggcgggcttc tcctcctcgg actcagactc agagtcggaa gagtcggaag    287040
     agtcggaaga ctcagcctta gcagcgacct tcttctcgac cttcttctcg gtcttcttct    287100
     cggtcttctt aggagcgggc ttctcctcct cagactcaga ctcggagctt gagctggagg    287160
     aagcatcctt catatcctca tcggactcag actcggactc ggaggagctg ggagtaggct    287220
     ccttcttctt gttcttcttg gaggccttct ccttggaggc gaccttgctg gcaatagcct    287280
     tgctcttggc agcgggggac tgggaagcct tggtgacacc ggcatccttg accttgttca    287340
     aggccttgct ggccttgttg gccttatcgg cacccttggt agatgtcttg gacatattga    287400
     actgcaggaa caaaaaaatg ttagctattg ctcctgaata taattgaggg aactcaggga    287460
     gagggcttgg gaggctggct tgtagcttgg gtagggtggc acatactgta gtgacaagtg    287520
     aaattcttgt agtatgtgcg gcaaagccca cgatccctca aagcacccgt gtattggatg    287580
     tgtaaaatgg aacaacagcc ctcagaagaa ctgccagagt gaactaaatc acagctggac    287640
     gttaacccac tacccacgga cggacaagtt ttcaagccca caagcaatag acagccaata    287700
     ctgtctagaa tatgtaaccc acgaggaaga tgtcccacag agcccacaga atagatgtat    287760
     gtcaagccca cagccctcag agtgataaga agcccacaga gtatccgaac gaacttacga    287820
     gatagaaccc acgcgactgc gttagttagt gtgtagaaat ctcttggata gagatgatat    287880
     aagtaaagca acctgaaaca gactgctttt ggaaggggaa taaaataaaa gtagagagga    287940
     tgggaagaag aagagaaagg aaaaagcgaa gagctggggg accatcagct ctgataagga    288000
     aaattttctg aaaaaaaaaa ttcggaggct ggcagaacca ttccgcctgc ctttagtggt    288060
     tagaccaggc acttagcccc tagactatgt gggtacctgt ccagtgactg ttgacgactc    288120
     acaatcgcat gtcgattggc ggtgtcctct gcttttgcta cgttgtacct actacatcaa    288180
     ttcttctact atcactgctt ctcgttcata ctgttcgact cttctttggc tcaacattcg    288240
     atgggacgat aagttgtcct tcggccttta tcgtgatggc ccctccgaca ccctcttccc    288300
     accgccctcg caagaagaga aagattgcga cctcccccag ctccaacaat aatttgatct    288360
     tggatctagg cgaggggaag caatccccag catttccact ggtctcattt ttgtgggctg    288420
     ctcgcgccgg tgtctctcaa tggctgattc tcccacttgt cctcatggca gttggcctgt    288480
     tccgatgggc tgtgagctta tggggctact ccggtatgcg acattgtctc tctttggagg    288540
     tagttacaac aactaatacc ttctaggctt ccgtgtcccg ccgatgcacg gtgatttcga    288600
     ggcgcaacgc cattggatgg aaattaccac acatttgcct ttggcgaagt ggcacatata    288660
     cgatctgcag tactggggtc tcgattatcc accattgacc gcatatcaca gctggttact    288720
     cggaaagatg tatgtttcat tatctaccat tagtcgtaga atctccatgg cctcctgctg    288780
     acatggcggc ttgtacagtg gctccgcctt tgatccaagt tggtttgccc tagacgcctc    288840
     ccgaggattc gaggacccac gtttgaaagt atacatgcgc gccaccgtcg ttgtctctga    288900
     atacttcgtg ttcatcccgg ccgtggtcaa tttccttcgc cgctacactc ggatgcaggg    288960
     tgttcatgcg tggtccgcct caatcgctct ggtggcagtc ctccttcagc cagcgaatat    289020
     cctcatcgac catggccatt tccaatacaa cacagtgatg ctgggattgg tggttgcgag    289080
     cttggacgct atcttggcgg ggcgtatgct ctgggcttgc attttcttcg ttggtgcact    289140
     gggattcaag cagatggcgt tatactatgc accagtcatg ttcgcctatc ttctcggggt    289200
     ctgcacattc cctcggatta atatcccccg ccttatcagc atagcccttg tcacattagc    289260
     ttcttttgct ttgctgttgg cccctgttat ggtcggtgcc tccaatgccg aagctcgaaa    289320
     ggcatttgca tcttctccgt tgccgcctat gttgcacgca cttcctatcc agatgaacaa    289380
     ggactccgtt acgtatgggc tattgttcca actaacgcaa atcattcacc gggtgttccc    289440
     ctttgcgcgg gggctcttcg aagacaaagt tgcgaacgct tggtgcgcca tccacacttt    289500
     ctacaagctc acccgctttg atgctacgtt attacagcga gcatcgctcg gggccacatt    289560
     ggcgtcaatc attgttccct gtgctatcat attccgccac cccagggcct cacttcttct    289620
     tcccgctctc tctgccgtct cctggggatt tttcttgttc tctttccagg ttcatgaaaa    289680
     gagtgtgctg ctgcctctgc taccaatgac tctgctactt gctggtaacg gtgggctgag    289740
     caaagaaaca cgtgcctggg tgggctgggc caacatgctt ggctcatgga ccatgtaccc    289800
     cctccttaag cgcgatgagc tccgcgttcc ttacatagtc atgactttac tttgggccta    289860
     tattctcggt ttgccaccca cttctttcga gacttaccga agtcggccat ccgtggaaga    289920
     ctccaatacc cacttcgagc ccagcactct tacaaccctc ctacacttcg gattccattt    289980
     ggccatgatt gcctggcatg tccttgaggc gttcgtggct cctccgcccg gaaagccaga    290040
     tctttgggtg gtcttaaatg ccctgatcgg agctggtggt ttcgggattg cctatctgtg    290100
     gtgtatgtgg aaactatata cacaatgtcg ccagatcagt cggcaggtga ctgaggagga    290160
     aagccagaaa aagaagcagt gatcctttgc ctaggtggat ggctctatga tgttcagtga    290220
     taccccagat tatgtgatga tccaaaatga ggcaaagggc tactagctta tttcattaat    290280
     acgattgatt cgatttggaa ttcattattc aagagttgag acgttgtatt gggaaacacc    290340
     cctatcatct ggagtgccaa actctagatt ccaatatatg acacgagcaa aaatgctcta    290400
     aaaacagacg atatccaaag aaaacaaaaa gaaactcccg ccgatgaatg ctatggtaca    290460
     atgttgtata gtgatagtac agccgagcca aggtcagaga gcgagcctag accttgaagc    290520
     caaatccagc catgcacgtt ttgtactgct cgatcgtgga cttgcactcc tgctcagggc    290580
     tgtcggactt ggagaagagc atgcagtcgt cgcgagcggt cttctcgggt ttgcagacgc    290640
     agcagggcta gaatgaaagg cagggtcaat cgtttgcgct tgttggttcg gcggtatcgg    290700
     tccatacctt gggcttctcg gactgagcgg gcggagcggg cgcttgctcg ggggcagcgg    290760
     cgcttttctc tgtaaagaat tgtgtaagcg ggagtcagga aactctctct gatatgtagg    290820
     actgccgcat tgcgcaagta ttcggcccag gtaagtggaa aggtatatgg gtacttacca    290880
     tttgaggaac cgaagagcca ggacattgtg atggatatgc aggattgctt ggcgaatatt    290940
     ttaagtaaac gaaggacaga aagagggtgt tgtatacggc gttgtgaaca agttcttaca    291000
     ggtgacctcc agggccgaca ccatcggaca ttattaatgg cgcgtacagc ggtactggtc    291060
     tctatgctac accgtagtta tttttatttt attttttttt tttgttatca acaaacttgc    291120
     ctctacgggg tcgcctcctt ttctgctaca ctacagacta tttcggtttt tcctttctgt    291180
     cctcgggtct actttggtct cctcgttgct tggatattgt ctgccattgg cttaacgggc    291240
     acactattct attttatttc tttttcttat ctcaatatcc cacttcaaca actaccccgc    291300
     catggcccct cccaagatct tctccctcga gggcaaagtc ctcaagctcg acagtgcaga    291360
     ggacatgaat gcgcacattc agcccctgat tgacaacacc gaccacactg aaatccgtct    291420
     cggtggaaac accctgggca ttgacgcctc caagcgcctg gccgaggtcc tgcagactca    291480
     aaagtgcctc gaagctgcct acctcgacga catcttcacc ggtcgcctcc tgacggagat    291540
     ccccacagct ttgaattcgc tccttaacgc catcctcaag atcccaaccg tccacaccgt    291600
     gaacctgaac gacaatgctt tcggtctccg aactcaggcc ccgcttatcg aattcctctc    291660
     gcggcacgtg cccctccgcc acctcatttt gaacaacaat ggactcggcc ccgctgccgg    291720
     atctcaggtg gccgatgcgc tgtcaaagct ggctgagcgt aaggaggaag ctcgcaactg    291780
     tggcgaggaa gttgcgctgc tggagagtgt tgtctgcgga cggaaccgct tggagaacag    291840
     cagtatggag gcgtgggctc gggcctacaa ggcccatgca gcaggcctga agtcggttaa    291900
     gatgacgcag aacggcatcc gatcggaggg tatctcccac ttgttgaccc agggtctcta    291960
     ccacgcgcag tccctggaag tcctggatct gcaggacaac actttcacca atgttggctc    292020
     cactgctctt tcaaatgtct tgtccggctg gccatctctg cgcgagcttg gtgttggtga    292080
     ctgtctgctc tctgcccgtg gtggtgtgaa ggttgccaag gctttggcgg agaacaagaa    292140
     ccagaagctc cagacactgc gtctgcagta caacgagatg aaggcggaag ctgtcaaggg    292200
     cttcactcac gcagccaaga ctgcgcttcc cagcctccgt cgcgtcgagc tcaacggaaa    292260
     catcttctcc gaggaagacc ctaacatcat tgagctgcgt gagctcttgg aggctcgaca    292320
     ggaggagcac ggtacagatg cagaccccga gggtacttgg ggtgttgatg agttggatga    292380
     actcgaggag gaagattcgg aagaagagga ggaagaggaa gaagaggagg aagaggagga    292440
     agaggccaag gctgagaagg accttaggga cgccgacctt gtcgaggaag agaaggttgc    292500
     tcagaaagat gacaaggacg tcgatgacct ggccgatgtt ctcggcaagg cggctattta    292560
     aacctttgaa gctgttggac aattgtcact tccagaagta cctgccttcc atcacgggcc    292620
     ggatcatgga tccaatgcca cgttgatgtc accaatagcc gagaaacccg cgacctcgtt    292680
     gccctccggg cgatgcatgg tccctttatg tgtccacagc cactcacaag cttcgggtat    292740
     gaggatctga ctgacgacgc ttacgcttta ccttcaaaaa gacccccatt tgttataccc    292800
     ccaatccaca gtgatgaaat cctagctctg cacataatat cctttgcttt gatccatatt    292860
     ctgtttgcat agccctggtc tctccgcatc tcttcggagg atacacaacc atatagatgg    292920
     aatacatatc tggacaagca ggaccattca aatcgtcatg tttaggaaaa gtggtcacca    292980
     acaatcaagt aggtgtatat gtaaagctgc atatgtagtg accagattga agcggcaaac    293040
     gaaaacttgc ggaatggaaa tattcagccg agcaacgaag ggagccactc gaagcatagc    293100
     caagatgagc aggtagctcg ggtgcatacc attgaggatg cattggatgg agttcgggga    293160
     aacttatcgg tgtgctcaaa gtttggagcg atcggtgaat tggccatttc gggaagatga    293220
     gtttcccaga tgttgatctc tgctgcggaa cagatcaatc acacttgtgc tggagtcgca    293280
     gagccatttc ctttttttgg cagtcaagcg ggtgacgaga gcaattttgc ggtagctacc    293340
     aatgaattct ttgaattcgt gtactgagaa tttgttgtta accccggatg ttgcaattgc    293400
     tcactgggcc tcgggcactt tgtacagcga aatatgatag atcatccaaa tagtgacggt    293460
     caagatttgg agctgtaaaa gccaggattg tctgcaaatg attgctacga tagaaagctg    293520
     attggcggcc atagcaaagc taacagcccg agttctggta cggagtagat tgaagctaca    293580
     tatgtatgta tggagctcgg taaagtgcgc atactgatgc atactaatgt accggatata    293640
     tgtagcatgt ctgcagtcat taatctgtta aaccagttga ccctatacta gtgtaccgac    293700
     tgtaaataca tgtgtacatg tatgtatacg aaacaggccg tttcaggcta gaagtaatga    293760
     aaccgaaatt ccagtacttt cgtgtaatta ggtagattcc gttgacttac cagagagagc    293820
     tggcaagtac taaagtacta gaaagggcag ttctggccca aggccgcccc aaactcgttg    293880
     ccaccacaaa gacgcagttt ctgtctgaag tcaggcatgc acttgtgaag gttagatttt    293940
     tctacttgaa aaactacacg attctatcct aagtctggaa ggacctacta caaatactag    294000
     gggtcaaggc aattgatgca atggcattga acagcttcct aggtagcagc ttgatagtat    294060
     taggtaggat tgaggctagg caccttgctg caaaggttat atttcaagtt gtaccaattg    294120
     tttccagtac ttgataagat ttactcggtg tctatatgcc cttcattcga tatcctccac    294180
     tgctctagat ccccttccaa attcggctcg actaaaaatt gctccgggac tttttgctgt    294240
     aacaaagctt gcgcaaaatc ttcgtagggg atcaagtccg gcaaaatcag attctgtctc    294300
     caacgacgca atcccccacg aatgcggtac taagtaaagt atgaagcgag agtcctccat    294360
     tttctcaatc gttccaaatt gcggctcata accaaaagtg attggttagg ggttggtttt    294420
     atcgtcacaa gagactgccc aaactgactt atattgatat aaaagcctgc ctcgacgaat    294480
     atgctagcag aggtcagagt ttgggcagac ggcttctaga aaggggaaaa tggaatttaa    294540
     ggtcggcatc gaaaagccta gtatagttaa taattattat ctaatctaga aacggattaa    294600
     tataaactga ccgtctaggt gataggggac ttttagtata attaactcta acaattcctc    294660
     ctctttatct agagactgct agagggcgtt attaacggaa gaaatgtgtt tagagtcgat    294720
     gccggtaacc gaagctatat agttaaaatg tatcagatag gaatgaatat ctcgtaagac    294780
     ggctctagat atacgttaga gacgatataa aaaatgagga tttctttctc accgattaag    294840
     gatatgtaga aggatatgtt cacgttcacc ctctgatata tagcttaaag gtcgaggtct    294900
     tccgccacgc acccgaaaag gctactttat agagaaagtg tacgattcgg agaagtcgtt    294960
     aagaactata tcgtagatat cattaggaag tcgaaagtgg aagttataga cgtcgctata    295020
     ggttatacta attcgatata agtatctagg cgacgaagtc ggtcttttag taaggaatga    295080
     taccactctt actcgaataa gcttagagta atcaccttag gagtggtgaa aaacctttta    295140
     gatagtgtcc ttaggatctt aataacttca ctaagaacac gttataaacg taagtccggt    295200
     cttattacct ctactataac cgctcgttcg tggtgatacc tagaagaaaa tcgagatttt    295260
     agcatatcgg tgatcactcc gtggaattgc gggaaataga ttctttcacg cgcggaatag    295320
     tatatattaa tatggctata tacccgagcc tcccgattga atctatcgaa ctcgtatata    295380
     gcatcgttta tcgtttcgat agttagtggt atactaatat gataaagtcg tatcttagta    295440
     tcttacctag aatagcaagg aaactagtat atgattaatc ggagcacgag tataatgatt    295500
     gtccccactt acgactttgg cgatatattt tctgtgtccc ctaatacgaa gccaaaacac    295560
     ctatatagtg ttggtatccg atactctgaa tttgtcggcc ttggttccta gttcccagtt    295620
     gtcgtcttca ccacagaagg gtcggaatat ttggccctca agttcccttg ttttcagtat    295680
     gtccggataa ctgccagaga agaataggtt catccaagta tctccttcct ctataatagg    295740
     cgttctggtt aaggaaataa tttatagaga tgatcctgca ctcgctttga agctgcatgt    295800
     agatatcctg aagctctggc tgaagccttg agacggcaac aagaggggaa ggatgtggat    295860
     gtttccaagg tgcatgccac tgcacgtgtc tcacaggctg tacccacgtg tctaggtagt    295920
     ctatttttga tagggatctg aggggcctaa ggcctctagt agtcatacgg agcgaagtag    295980
     gcgtaagctc tctccgaccc gacatacatt caattcttct tcccttcttc tttatacgcc    296040
     cgctgcctat ctccactgcc acgcctaatt gtctgctcgc gtcgaggtaa tacccacgcc    296100
     ccgaaacgta tgctacacca tgcctagcac tatatccagc actatacctc gcaccatatc    296160
     cagcgccata cctcgcaccg tactccgcac ggtacccaac accgaaccca acaccgtatc    296220
     cagcactatg cccggcacgt atccaccaaa agaagccctc acttctcgac caatgaaaac    296280
     cccccccccc cccccccctt tttttttcta tgttgtatac gcttcctaga aagtggacgt    296340
     cttaggcaac cacttcctat ggagtgcctc aggctcctag tagtaagtaa gccttacaaa    296400
     ctacctacct aggtaggtac ttacctaggt aggacgatat ccctccctac ttactataag    296460
     acaccgccct cggtatctcc tatatctata taaagctacc taggtatata ctcgtctaaa    296520
     ttaggtaatt tctctacctc ctatagatat aaaatttcga caataaagcc tattatacta    296580
     tatatctcct agaaataaga accgtgggtc ctgattatga gtttcaacct tcataactct    296640
     ctgttggccc ctgattcaac taataaatag cttgcatgaa cactaaacgc tcatttcttt    296700
     tgcccctctt ggtcgctctc gtggacacaa gtcagtagaa aaaggaatag cgacgcattt    296760
     attttgaaaa gggagattat tttgcttttc gcatgtccga ggtccatatt ataggctcca    296820
     cacagtggtc cactttgttc aatatcaacc agtcaacgta aaagccgcaa aggagtgtta    296880
     tggagcaaaa acttggccta tttaagcgct aaaattacct agtacgtaga taggaaccaa    296940
     ttaattattc gcatgatagg cctgattcat aaaattttca caaagatata tttttccgcc    297000
     aactccgaga ggtagatgta acattgggga agctaaccgg aggctaagaa aaataaaatt    297060
     acgatccgta tgtcatccta tcagtgggcg atctagacga taatcggtct ttgtcggagg    297120
     accttgttac acaattttct ttttttttac cttgtcctgc atctctctca gtctccacgc    297180
     acctttccta ctcttcagtc gtatactgtt ttcatcgatc ctataggaat caactatcgc    297240
     acagcatgct gctgaccatt atcagcctgt ccgtatttct tcctaaagca agaaaatgaa    297300
     gttaccaggc taacagagaa atagcatcat ccttgctttt gtcttcatct ccttcatccc    297360
     tcatatatgt aatgcttggc taggcaagag cgctagagac atttcattgc tctacctcct    297420
     gttcaatgtt atttgttcca cggagcatgt acttttcgtc ttcttttaca actagaatat    297480
     ggggacctgt gggattgacg ccgaaaatga ccgcttttga ggccagaacg gctgaacggc    297540
     tgcctttcca cccgtaactt tggatgcccc agccgctcct tgaccgccca ctgtcctgta    297600
     acaccactat tctgcacccg cccagcactt ttagtcatcc tccggtcctg atgtagacgc    297660
     tggacttaca cagttgttcc cctcgtttcc actggcgacc aaaacgacgt cgaaaatggc    297720
     tccccttcag ctaaatttaa gtcccctccc ttttcgtcca gtccatttga gcgcctataa    297780
     gatgctttgc cttccctccc ttccggtgtc cttgcacctg ccattctctc atcctcgttg    297840
     cccacgcctc gagccgacct cggcgttgtc gtttcccaca atgcaaactt tccaccctgg    297900
     ttcttgtatc tgatctccta catggcacct acgcctgtac atccggctca aactgatggg    297960
     caccaatact ggaccgatcc cattctttgc gaggaaactc gagccagact ggaacatttt    298020
     cgcagtctta gatggctccc tccaaacttt aagccaaaga ccttagaagg catcgctgtc    298080
     gtcgaacgtt attgccggaa gtgagtgctc acttggtcgg gaaaagtctt gtggctggga    298140
     ataacacatg agaataggta ttgcattcaa tcgaacgaag attatgtgga cttccttctt    298200
     ttagaggacc agacgatcta cacgaacttt tttgattgga tgttcaaaac atcacgaaag    298260
     aaactactta ttcattcata tgatgaatac tggcgccgcc tttgtcaata cttcgagcta    298320
     ttcgcccgtc gccgcgtcgg tgaggatgcc cgtcaacaga tgcgacgagt aagttatatc    298380
     ctgtatgtcc ctaaacagag tatgcttaca ttgaagtttc tcgcaggtgt ttccccagcc    298440
     gagcgcaaaa ttccccgacg aacaaaggac aaaaatactc cagatgtgga tgcttttggt    298500
     gtgatttacc ggcatcactg ggcccattcg agattttttc gtcacgggag catgattgtt    298560
     cagtttgcta cagtccagct ctggtccgcc attacaggta cgcgacctgg tgtcttgctt    298620
     cctcaagaca catcgcctgg taatccagtt ttgggtaaac gcaaacggga tgacaccttc    298680
     cagagtgacc ttccaaagca catttccttg aaagatcttc cagactcggt ctgctatcgc    298740
     gatatcgaac ttttctacct gaaagacctt caaggtaaac gtgatgtcct ccgtgccatc    298800
     atcgagtttc gcaatctcaa aggtcgaccg gaaggcgacc tacagtgact ggacacaagt    298860
     ttctgcatcg tcgggccaca cctccctgat tatataatat actgtcagtc aaaaacctgc    298920
     atgaattcat acgtcaagtg attagggttc gaaagagcac cttttatgtc tccgacatag    298980
     gtgataactt tcgttgagat tgggggacgt gaaaacacag tgattgaaat gctagtgtca    299040
     caattgacgg accaatctgt gccacaataa ccgagacgtc tcctaagata ccgccctcat    299100
     gaatagggga cacatttatt ggatactctt cactgttgag gcttgtcacg tcaaattgat    299160
     atccgatccg agtccaagga ccattccaat acagcgaggc cattcggtcg ttatcgcggt    299220
     gtaaatccaa attggcttcc actcccaatc tgtaagctca cactatgaag attatgcgga    299280
     tcattctgga tattttcggg accgaaaact tcatcagaac aattaagtac agtattatca    299340
     ctagacgaga gcgtcggcaa ccccaagcta taggtcccaa catcaaaact ggtgtaggga    299400
     ggttgtatgt cggtagcagt gcgaagggtg gggtcatacg tgccactcgg aaagtctgtc    299460
     cagtcatctg agagagtacc gagaccagcc gagtcataca catcaacagg gagattcaac    299520
     aaattttctt catgtgtctg ctgggaagcc acattggttg tactcgtggt actcgtggag    299580
     agcactggcg acaatgccgc aggagtgacg tccgtcttag ccaactcagc aggaatctta    299640
     tcaaagctgg gtaagaccga aggaaggaat gcggaggttc cgtccgagtt ccctagatca    299700
     ggcaaaggta ccataggaaa ggagccaaac tgtggaacac cttgttgaag ataagaatgt    299760
     tgcgatatgt tccagaactg tggcgaagga tctccaggcc aggctaggtt cgcatttgac    299820
     aggacacttt ggcgctttgt tgaattgccg aagccactgt aggaggtttc attattcaaa    299880
     agtgcagcct gcgccgggaa aagtctgttt ccagagtgaa agccgttgtc ggatgacgaa    299940
     caaacaacgt tcgatagtaa agcagggtac ggcatcccgg aggctgacaa catgtcgttg    300000
     ggttcagcgt taagcttatt actattatcc tggggaaagt aagcgtaacc cctagcttgt    300060
     cgatccgacg gggtcctcac gagcttcgac atggaagcag gctgggaccg aggccgttcc    300120
     acccttgggg caggatttgg agtacgctct ttctttagcg cacagatgca gcgctgtcca    300180
     tgaatgcagc cacatcgttg atgattattc cctatcgaat tttatgaata tcgagttgag    300240
     ttattgccgc tggggtgctc acttctgagg tgttgctcac cagcgtattg aaagttgtcc    300300
     tcatcgtaaa cgttcttacc acactcgcac tttatgtgag tagtgtgtga ctcgcgtaga    300360
     ccgcgacagt gagcacattg agtgattggt cgcccttttt tcccgatacg aatcaaaggc    300420
     cggtcaattc aaagatcagt tttcggttca ctggataagt tgcacgcaca ttccatcttc    300480
     gacttaccat ggtggtgaca attgctgacg cggtgacccc gcacgcaagc ttcacaagcc    300540
     catttttctc catcaagcaa cattgcggcg ctcagtgacg agaggctata cgcacaccac    300600
     aagtttgaat gttttcaaga gtgggtattg gttggccaca cttctgccaa gttgtacttt    300660
     gcgggattcg gcaggtacga aaagtttgcc tacagttcag caaacatggc aatgtagggc    300720
     agtttcacaa tacgcgaagc gacgtcacaa aacttgttcc tgcatatagg ttgtaatcgt    300780
     cagtgtcata gttatcgttg gtcaggtatc agtacttcaa aagggatagt cacctattgc    300840
     cccttactcc gatgatgtcc tagtagtgca cttgtacact ccgctgtctt tacgcacgaa    300900
     ttacttactc ggttcgatgt ggcaagacca tgtagtgcac gatgattgtg ctgtccagaa    300960
     ttcctgataa gcgctagcgt tcgagcaact gtatgacgta attttacgca ctaatgtaaa    301020
     tatggctggc tgtctttctg attggttcaa gcaccgagat ggattatgtt ctagctttta    301080
     ggttgtttta tagatactac agccagctat gtaatataag tagtagttaa aaacggtagc    301140
     ttatcactcg tatccacagc ttaaggctcc tcgatcagtc cggacttata gtgttcagtt    301200
     ttagacctta taactgcccg cgagccaccg acataatgat ccgctagcgc aatggcaaga    301260
     cacgggccag ttaacccaag gaagcgaggg tacattcaga attaatatac acgtccgatc    301320
     agtgccattc gccactggac atagctttcc acatgcccgg gtcattaatc atggatacca    301380
     aggagctcca tatttgggtt acctattgat tagctcaaac aaaatatctg cgccttcgtt    301440
     attgatgcgc gcttagtgcg tagaattacg tcgtagcggt cgcggtcatt ctcagctttg    301500
     atggtaaact caaatataaa cccacctagg tactttggcc aatcatcaag aaccttcccg    301560
     tttgcctact tgctctctat gcgcgattag tgcgtaaaat acataataca tttactccgg    301620
     tactcccttt ctccaccctg gagtactggg ccctcgcaaa acgtgatacc atcctcaata    301680
     cgtccgtcac tgatcaccag gttgtccacg aggagaacgt tgagtccctt tcaatggctg    301740
     aggacgacag taattgggta ttcgaggaag tcattggcta gtgcactttt agatttggtg    301800
     ctggttcccg aaactcttca tcgataagca ccgccacgct aaaatacgcc aaagtaccac    301860
     agtcccatgt cttggcagtt ccagaaaccg ccgaagagag aaaagtgata gacataaata    301920
     ggaattagtg ggaagaatgg tatcaatcga caattacagg gaacgcatgt acaaccattt    301980
     tgccggaagc gttcagcagt gatgaagcaa atctgccgag ctttgctcct gcggcaaatt    302040
     gacttcgaaa atagccattg gggaaccgga tttcactctt tacaggattt cagatgatag    302100
     gagattaaac cagtttagtt aggaaggctg ctgttgtacg catattccta taatgcatca    302160
     agtatctaat gaacccgtaa acatgcgctg ccagtagagc atacttcact tatattgtgc    302220
     gtggatagaa gcagatctag ccaagaaaac ataaagacgg agagttgcaa tcagcggcac    302280
     actatgaaaa cacgaccagt gcattcagca cagtaccgag agcgactaaa attccaaaaa    302340
     agtttgcaat atatgacggt gcagtcccgg atatggctgg tgtagttgga tctgagttat    302400
     taccttgccg gatcaaacta tcgagctgat cttcgccctc tactaagacc agcgccattc    302460
     cagactatat agacaaacgt aagcgattgc ccgccaatgg agagagtgaa aaggggagtt    302520
     gacagaccac aatatgccac tggatatggc aatgaagtat ccatgcgccc gggttatcgg    302580
     tgatatagct attgcatgat tagccattag gcttgacaaa tttttgcttg caggttaggt    302640
     ttaaactcac cgaattgcta gccatcctga tggtggtaaa ttcgcggtat ccctgtacgg    302700
     agggtcgtcg aggttaataa gggacgacgg cgcttctgcg accgactggt aagggaatga    302760
     gccactgcca gaacctagaa cccagaattt atggccatga aggtgcattg gatggcccat    302820
     ctaatacatg tcagcgactg tacgtgcgcg gtaaaaagta gcgtaggggg tcacaccgta    302880
     tccatcgagg aatttgccac attcataacg atatcgacgg tcgaattcgt cggtaaatgg    302940
     agggtggtgt tcgaattcca tccatctgac ctgttaccgt agatgattgg gatcgttggt    303000
     tcagtatacg gatactggtc cacaacccag gtgacaatgc cggtctgatt gatattgaag    303060
     aaccgagtga catcggcaac tgtagtggga ggtctattac cctcaaacgg tgccagacgt    303120
     gattctacca gttcattggc cccttgtgta gcggatccgt tagtcaacat ccaaacagac    303180
     attggatcaa ccgagatatc ctgtgtatcg tttccggtgg tctacccagt gtgttaatag    303240
     cagcgatgtg ggattagaag ctttgatcca ctgacattat aggacactat tgcctggcct    303300
     tccaagacct gctgcatatc accattcgga taagtagcga atcgaaggta gtagttgccg    303360
     gcaggctggt caagctttat catcacagaa tatcgttggc cgagagcgat ttcaagaacc    303420
     tgtcaaggtt agaggaaggt agtttaataa ccatggaaag acgatatctt accttaacct    303480
     cctgcagggt cacatagagt ccgtctgcag catagacatg cattgaatga ctgtcaagag    303540
     agaccttaag gttgctaaca gctccagaat tcacaaggtt gagggcaagc catccttgag    303600
     atacatttgc gttgaccact aactgttgtg atgttgtgtt cacacatgtc tctgatggca    303660
     gcgagttgat atcgtatccc tgcctgaaca tcataggtgg catgcagccc cgagggccca    303720
     acctcattga ctcgcccatg gtgtcggact cgcccatggt gtctgagctg ggcatagtca    303780
     tcccgcccgt tgtggacatg gttgactctg acgggttggt tgtgctcatt ggaggcatgg    303840
     acatctggcc gtgggggttg tcatcggcgg gatcttccat tcttctcgcc atcgttggca    303900
     tttgcattac cgatgtggcc attgtcgcag tagggttgtg gtgtgtggca ttgacttcgt    303960
     ccgtcaggcc caaccccggg cctgcatcga gcatatactt tggcaggcat tctacccttc    304020
     ccaggccatt ggccagaata ctgtcaacac agttggggaa ggcacctgtt tcgaggtacc    304080
     ggctaaagat tgtgtccgac agatcgtgtg tccagtcatt caggaggata gataccgcat    304140
     ccctctcagc ctgtagcagc tgttcacgct caactctgct tgcagccatg tcttcaaacg    304200
     gtcgacgacg agagggtgct ggtcggatca tgagtgggcc ccgtatagca tcgttgtagt    304260
     atgcgcggaa atgcgaatga taccagtaga acccatactc gtctttcacg gaaaatctgt    304320
     acgtaaaatt tcctccaggt ggtatttggt gctacagacc caggttagtg acgactgtct    304380
     tcagtgcttg aagggtgata gaaggtagta gtgcgcacct gtgttactcc tgggacccca    304440
     tccatgtctg gcgttccacg ctgtagtatc cctggattaa tgtgcttagt taagccgcca    304500
     cgtatactct gacgataaca taccatgcca atggatagta gtgctaactg gcaactcatt    304560
     gcgaacgaac acctccacat catccccttc gtcaacttca atcatcggac cgggctgctg    304620
     tccattgatt acgtagactt cacggaagta cccatctatc ggtaactaag attagcgtct    304680
     gacgaaggca aggaatcaat ctgcaaacct gggctgcgct gggcgctatg aacggtgaag    304740
     ttgaacgttc gtagggaacc aagagcagct tgtactgcaa gaagggtgca tattgcgcgg    304800
     agctggaatg caaagcctgg catttggtgg aaaaagataa ttatgaagag ttcgatgtct    304860
     ctgagggtga tcaaatgttc ttgcaatcgt aggaagcaaa ggcagaggat tatacggtca    304920
     aggacattca ttctatgcgg tgttttcgcg gattttagcg cctcttggcg aagtttaata    304980
     tggaatccat agtctctagc cctttgtcca atcatatgcc tacctatgag cctgcctctc    305040
     ttttaccgac gtccacctcc ttgaccaagc cttcatagac tcttgccaaa aaaaaaaaaa    305100
     aaaacctcga gtaactcatc cttcttgcga agcgaggacc ttggtggacg atggcatatt    305160
     taaaagagga ctaaagacag ttattataaa attttctatc aactctttct ggtgcactgt    305220
     cgcaaacaag tccgatttca gtgcgcgtat cactgcagaa ttttctttca agtcattcaa    305280
     tcccatcttt gcccgtgttg gaacttaatc ctcaaaatat ttccttatca ggatggacgc    305340
     ggaactgtta cgctctctcc tccagcggga taccggcgac attactgata cctgtgaaac    305400
     cggaaatgag tataacggtc gactgagcct ccgtgtttca tctattttcg tcatcatggc    305460
     tggctcgatg atagcagcag ttttccctgt gctagtgata cgttcgaggg cagtgggtgc    305520
     taagtgggag cgaatcacac actgggcctt ttttatagcc aaatattttg gctctggtgt    305580
     catccttgca actgctttta ttcatttgct tgctccagcg gaagaggctc taagggatga    305640
     ctgcttgact ggtcctatct cggggtatcc ctgggtggag ggcatcattc tcatgaccat    305700
     tgttaccatg ttcttggtgg aattgatgat tatgcgccat tcatatctcg acttgagtca    305760
     acagaacgac atcgtccata acggaagtcg gtgccttcgc ggcgttgata actttggtgg    305820
     ttgggatcag gctaagagtc acctgccgat tgaagacaat ttgagccgtc cccaggagca    305880
     ccaagaggca gagatggctg aaggcaactt cgcattcgtg gatgactatg cagcccagct    305940
     tatcggggtt ttcattttgg aatttggaat tatcttccat tcgatattca taggcctgac    306000
     actcgcagtt gcgggctctg aattcaccac gctctatatc gttctcacct tccaccagac    306060
     attcgaggga ctaggtctgg gatctcgcct cgccatgatt ccatggccga cttccagggg    306120
     gtggacgcct tacgttctgg gcgtagttta tggtctgact acccccattg ccatcgcagt    306180
     tggcttggga gtgcgcaata cctacccacc tagtggtcgg acgacactga taatcaacgg    306240
     cgtttttgat gctatctcgg caggcatcct tatttacact ggccttattg aattaatagc    306300
     gcgcgagttc ctgttcagct catatatgcg tcgggcttct ccttgcaccg tttgttcggc    306360
     atttgttttg ctctgccttg gtgcaggact catggcactg ctcggcaaat gggcttaact    306420
     atatgtcaag aaacaaggtg ttacattgat tacccggtct ttttacggct gaaacatgtg    306480
     actgattgac tatgcgtttt gtttattaat tatgtccaac caaattgtca aacccgggca    306540
     gtgtcatttt agttagagaa tcttaccact gtgaatgtta ccagtacgct cgccttacct    306600
     tgatttctgt cactatattt tagattactg agggaatttg gcgttaagcc aatgatgaga    306660
     ggaacctaga gaggcaagaa ttgagagtcg agaaccttcg aacatatcca atttcccccc    306720
     ctccncccnc cctccctcct ttttttttca acttcagtct ttttcattct ttcatcgcct    306780
     caggagtgcg gagcgcgtgt aatgcgatgt tttcgcgggt tttagtggct tggcaaatgc    306840
     ttggccagtc acgaccttcg ccgccaagac atcgtgtcgc caaggaactc aaaagaacgc    306900
     aaaaatctct cacattggac caattccccg cgaagggctg gctgatactc attcgtcgct    306960
     gtttcacaac gatggacttc gttctattct acagagacga ggataacagg gaactccata    307020
     tgtttgctgt gtttgcggac tccaatcaat ggggggataa agagttgggg cctgttaagg    307080
     agttgtctta atcgcatatt atggttacgc aaaaatcaac cttaaatcag ccacgtcttt    307140
     tcgcgcccag tgggaggctt ttgattgagt ggtcgccatc ctgccagatt tgcacagcct    307200
     caaaacgcct tcccactatc catcattatc gaaggacctg catttcacat ctctgtccgc    307260
     ctgcctacta cgccgatctc gtctgcaccc gtgctcgctg ctacatgagt gatctgttcg    307320
     acccgactcc ctctgcgact ccgacgggta gtgtggccgg cgaaagtggt ggtcgtgtat    307380
     ccgagagcat caaggatacc atgttctaca tttaagatat ttccaaccat tgggtgggtg    307440
     gttggcatat cttggctttt ttgagaactt agtatttctc gggcgcttgg gatgcctgat    307500
     tcctactttg ctgcaactgg gtgcgccctg cttggtccgt gactgggcgt gggtctggtt    307560
     cttcttgaag ttttcggttt tccttttcct tgatcttgcg gccttggatg ccgctattct    307620
     tgcgaccgct tttgttgcca cccactggaa gggccagggc cgaggttttg gatctggttg    307680
     ttctgaacct cgaacttcaa agtattctta acttcacgag tgccctcgac cacaagatag    307740
     cggggaactt gtggttctcc ggaaggctga ttggacacgg gtatttggcg gttttggaac    307800
     tgcaacccct cgagccttct agcttcttcc gttatgtgtg catcgaaagg ccagagcgag    307860
     cggaacagta acgtaaatcg gaacggcaag gaagcacaca tggcatcatc tggccacgac    307920
     acgccggaat ttccacttac gttacacgcg gggtcgtggt gtcgtggtga tgacgtctat    307980
     accttcgagg aatacggata gctgggcaat taaaaccatc ggatgatagt tgcccggtac    308040
     gttgtctaac tcatgttatt ttatctactt ccatttaata tagggtttcc agatcttcaa    308100
     ccactcttgc aaagcctcct ggaatcaggt aggtactccg acctaacgat atcatgcgaa    308160
     ggccgtaagt tcgcagtaca ccgcgccata gtctgttgcc agtcatcatt tttcgatgct    308220
     gagtcaaagg aggattcaag gtaaatagtg tccgtctaag ccaaggttgg cggccatgag    308280
     taacattgtc gtaaggaggc tgcttcatcg caaatcgacc tacctgatga tgagttagca    308340
     accattcaac gagttggtta cttttcttta tattcgagat tatgatgaca cgggcattcc    308400
     agacattgag gacaaaaagt ctgtttcggg cgaagttaaa gattcccacg cagttttgtg    308460
     gaacaacctc ggagttttta tggcagcgga caaatttgac attgcgcccc taaaacagct    308520
     tgcaagaact cgtctcatca actgaattga caaaaatgcc cagagacatc catttgttgt    308580
     gcgagagatc tgggtcactc ttccacctct cgagactgag cttcgggatg ccataatcaa    308640
     ggcaatttca tgccacgccc aagaatacct gaacaatgat gagagtatcg caattctgac    308700
     ggatttgccg gcaattgcta ttgcggttct taaaaaaaag ttgatgagaa tgttcttctc    308760
     gaacttcaac tgcagaggat gccagtgcga gggaggtatt gataatgata ccgtaatgta    308820
     gtgcgtacta cagcgttaaa ttcgtttgtt tccatagaga gttcgatgat atcatactcc    308880
     gcctcattcc ctaatacgta aactggagta tcgtggttag ctggttagtc tacatctacg    308940
     aacttgtgtt cttagcttga gtagcaataa acatatgctg tggtggaaag actcccaggg    309000
     ccaacatatg agttcccagg agttaacgga tctccagacc atcagctacg ttcctgggaa    309060
     tagatgctgc gttcctggaa tagatgctgc tttctgtgag ggtctcacgt atacataggg    309120
     gtggatagtg tctcaagatg agtaatcgat attaggaaca actatagttg actctagata    309180
     caagacgtag tgcgaggaag caaaagaaag gtagcttcct cgcgttcagg ggaactcata    309240
     tacaccatgt gggtcccgcg cagatcatat ctccatccgt tccgtgtgct tgatgtatat    309300
     ccttgacact ttcgtggaac tagactggga tctatgaaac cccataccaa tcgatcgatc    309360
     aattgatcca tagtctgtcc cagccttttg gaaacattcc cagctacact cggacaacag    309420
     caagactatc gttttatggg tatggctcca tgaccgtgtg tataataatt gagcacgtgg    309480
     aactgaacaa ggatgggaat tatagaagat gagaattcgt gaagcctcag gcagcaaggc    309540
     tactggaaga ccagaccagg acagtggttt tgaatgagct tgttctaaac cgcgaacttg    309600
     aaagtatcct tgaactccaa gtagaccctc ggccacacga tagtggggaa cttgtggttc    309660
     tccggaaggc taattggaca cgggtatttg gcggtttgaa actgcgaccc ctcgagcctt    309720
     ctgattcaga ttttctgcca tcaaggcttg ttattattgt ctcgtgtgta catactgaac    309780
     aaagcaggta agttatcaaa tccaggaaga ccgcttctca ataacgtaaa aagggaaaca    309840
     ttaaatagcc tgttgatatt atgaacctag acatgctcac tactcttcgg cgtcgggcgc    309900
     tgtcgttgtc tccaaaacct atcgtattat gggtctgttc ttttacgtcc atgaatgctg    309960
     ctgtagatag gaaggctaaa attgctataa ggggttttct aatgcgacga gtatatatca    310020
     aacagaactt atctccagtt gaagaagttg gaaaatggag cactatcacg gaaaatatta    310080
     tccagatccg aggttgattc ttaagcaaag acaaaataga gtacttcaat ttgacagaac    310140
     acctgcaagc ctcccaatta atcggtatca atgtccgatc ccgtatcttc tttggtgtag    310200
     taattccgtt cagtgctgag gcgatgaacc tcttctgcat gcctgcgaag atgcatctca    310260
     tgtagtagat cttcgtcaca catatgacac cttcgatcct gcaagtgctt ctctcgaaag    310320
     tgtcgtagag tcgacttata ttcgctatat ttctgcgtgc ggcgatgaat gggaagttcg    310380
     gtgtcaccat aacattgaaa acatcgccga ggcttctttg cctttttgat gtagtttccg    310440
     gctttcacaa gaagaatatc ctgctgcgaa ggctccggag agctgcaact cttcttggct    310500
     ggctctggta acacgctggt ctgttcttca tcgaacccgt cacttggtgc agcccgttta    310560
     cgtcgcccac gcaatggtcc accttcaagg aaaccacagt atcgggagat cgtagccacg    310620
     gcagcgttcc ttctttgcca ctccgcctcc agggattgag aggtaggcca tgtgaataat    310680
     ttctctagaa gatcaatctg ctccggtagc atctggtctt cgacttgaag taccttcttc    310740
     gcctcttcgt catcaacagc agcccctgag agctgtcgct caatgtctat gatggcctgt    310800
     ttgcggtcga actcatggcg caccttccgt ctcagtgctc tttccaaccg gccgaatgta    310860
     ttagaggttt cgcgtttcaa tttctctaat cgcgattgca tcgctgcact gggatcgcat    310920
     ttgcactcct cggcttgctc tttcattcgc cgagtggcct cgacatattc tggatgttcg    310980
     cgaagggacg ctcgttgctc cgaagtaaga tgccgagggc gtctcttgtc aatccaccta    311040
     ctcatccggg tgatcgcgcg catcagagac ttgttagatt cgcggccgtt cataacgttc    311100
     tgcatatcgg tgtcgatgtg tcgtggaaga taatgattca agaaagtgcg ggtgtcagcg    311160
     tgtttcatga tcagattttg ctgtgcttcg ctgaccacgc tgctttcgtt taacatcttt    311220
     ccccctccat agcgaaaacg atgggcgaac attgactgaa ggaggccgtg aatctcccct    311280
     agatttctca gacgcccaga catggcgcca tcggtcatcg gctggttcca ttgaagaact    311340
     ggacgtccat tgattacgtc tgtcttgcag aagacataat agccttcgac ttcgcgcttc    311400
     aatggtagtt ccatctgttg tcggccacct tggacgaaca gctttcgaag gcgctccatg    311460
     gaggaaagcg tagggacttc gaaggcttgg agccaaagaa gtataccgaa tatgaatgta    311520
     tgagggctga agacaagcga cggatcgttg atgatttcag ggaaaggaaa attgttacta    311580
     agaagtagtg ttaatattgg gatcatcatt gcccgggttc aacgcacgat acatacattt    311640
     gggaagttcc gagaaatcgc tttgtatgct ccgatttgat ctccaccaaa agtacgggag    311700
     ggcccccgtc cggattatct tgtacggaga aacgtagatg gtggaactgt agcgaaagaa    311760
     gagcatgcag acggttcacg gtataaatac cgagcatgtt gaagagacag agctggattc    311820
     gctcgtatcc aaaatgaaat cgtctttcct gagttcggag aatcgtctcg ttcaattcag    311880
     tcaagtcttg gacgtacacc ggctccttgc cccgttcttg tgtatcgagg tcgaatttat    311940
     cgacgagttt ccgaatgccc tagaacccag tcagctcaga gcgtcagact aagaggatta    312000
     acttaccgca ttgatctctt cgctatcttc ggcagttatc ctggtccgtg taattctccg    312060
     atagtaaccc cgaaatcctt tccaatcagc tttcagggcg ctcgctttcg atgttccctt    312120
     cagatgacga ccgccttcgc catacttcag cttcatgcag tagttgaaaa aacgatgcac    312180
     gtcattagga gtaacctcgc gcagtgcctc cactgggtca tcccatttca acagcgcacc    312240
     agcctgagca gccttcactc ggcagtacct acgcctcaca tcagtactcg cctccccatt    312300
     gtgtaggtct gaataaatgc tcacttgtcc cagcgctttt ctattcgtcg accccgaacc    312360
     ttggtttgtt ctgagcgccc ataatcaagt ggtacgtttg caatgtcctc gtccgtgtcg    312420
     tcatcagggt catcgctgaa atcgggcaga acaccagcgt ccgctggacg acgcacgggt    312480
     cgttttggac gggtggaagg cctgctacaa ttgtcaggaa gacaggtggg ttccggagtt    312540
     gtcagctcgg ttgaatttga ggcttgccca gaatcggagt catcggtcgc atcgatatca    312600
     ggctggaaag acaccccgga agtgtcactg tcggtcgcag aggatagatc tgcaacgtcg    312660
     ctcatgctgc gtctggggaa actaagatgt gcgcgaagcc gctccaggca ggtagacaaa    312720
     tcaacgggga tgacgaacga ctgtgaggca cgcgctgagg gaaggactgg caaaggatag    312780
     gtgagaggag ggctgggtag gagagtgagg agggtctgtt ggcagcttta tagtcatgga    312840
     ccccattgcc ccagcgacca atgagcctgg gatggagtgt gccatttttg gcgacctcac    312900
     aaaacggagg tgtcatggta gcgctcaagg agcaggcccg gaggtgggta gaagtcgatg    312960
     gaaagcagga gcggggctcg agggcagggg aaggggagcc acgcgcccag gtaccaacat    313020
     gacccgaaca agaacgtgac ggtgcacgtt acaaggggcg ggcgaggagc gcgtggctct    313080
     gggatcgaaa gtgcgtgtgc ggaagaactg tgccgaggag gccactttcg gccccctttg    313140
     aggccagaaa tggccgcctc tgcacaaatg ttttttgtta agaggtaaga tttatttatc    313200
     ttagtccgac tatattaact agattctcga tcgctttagt cttaaaaaat gtaatactat    313260
     cgctacccta atagataaga gagcggtttt aacccctttt aaagatagga ccgctataaa    313320
     aatatagata aaggaatatt agataaaaat cggcacttta atttagctaa tagtgttaac    313380
     taggctagat atcttattta taataattaa gcttactaga tatacgaaga accctagaga    313440
     aatacatttt taagccttaa aaagggtgtt tcgatacctc gctagcttaa aaaacctagc    313500
     aatttctttc ttcctagtag gctccgagtc taacactaat tctactctct acggattttg    313560
     tgatatagac taggctagtc tatatagcga aaaagggcta tctatatccg gttttatctt    313620
     taagatagct agcggtctaa tttcctagac tagtaagaaa taaccctata ttgctttatt    313680
     aataatagag agcgagtata ttaccgaggc acttactatt taagaagcgc tctagcttat    313740
     ataactactt attgaaattg gtattaaagg ttttttgaaa aagctaattc cgatttatat    313800
     agataacaat agggcaattg ctttagcctt aaatcccgag ttttatatag taataaagta    313860
     tattataatt cgttttcacc ggcttcgcga agaagtcgcc gctagatcta tatacttcgt    313920
     aaaaattcta atagcgtaga tagcggccga taggatgact aaacccctta ctaaaatcat    313980
     atttcgccgc tagctttcct agattggtct ctataaatac cggaaggatt tttgatttcg    314040
     gtttatatat aaaaataggg gttaaatctg tggtttgaaa gcatttattt ttactgattt    314100
     atatctagtt tttttattag gagaagagtg gtttttaact atataggtca gatagttatg    314160
     tgttctgtcg tggggggtgt tggaggtcac gtgacctcct cacatgctcc ctcacacttt    314220
     agctagctca cctgtagata gtttcttctc ttcttcacgt atctatctat tttccagagc    314280
     acactacctt ttctctgtag tctgtctcta tcaagaggta ccggggtgca aatactcatg    314340
     caacaccact gtatgtagga tcttgagaat ataactctga aacgacacgg gtaacaccag    314400
     aacaaattac tcaattcagc aatttcgcat aggcacttaa ggaaatcttc tctctacttg    314460
     ctggtttata tatatatgat gcgtcgcgtc ggtgaatttt cctttctcag aaattcatta    314520
     taaattacct gcatgagtct cagctaacgc cacattatac agtgacacct cttaaatttc    314580
     agcaccctgt cagctactgc cttcctaaaa ggatgcaccg cctacttaaa tagtcatacc    314640
     gcccattatt taatattttt gattggtaga tcacgtttag cagaataagg ggtgttgaaa    314700
     ctaaggaggt gtcactgtaa aactcattct acaccccgta ggagctatcc ccttctgggt    314760
     gtcggtgggg aaacaatggc gatcacgatc tcgataagct tatctcctcc aattggtgcc    314820
     gaaatagatt agaggggctc gagcacggcg gcagaagtgg cgtgggctga gatctttact    314880
     catctggcac cagatgagta tcacgcaatt gaagaatatc tatcaacaga gagaagcaaa    314940
     gatctgtagg caattatgct atttgattac ggataactaa aaatggagat gaacaaagga    315000
     agaagaaaaa gcgcgagaca gctacctcaa aagagagagg acggttctgg cctgaggcac    315060
     actgtcgaca atatcatctc gtcaaactct cggcgagccc ttatgcaatg ctcgagcatg    315120
     taaagggtcg gctagaattc gagtccctgg actcttgaat ctattcgccg cggttagcag    315180
     agaacgaagg ctttcaatta tacaacccat cactcaccaa atgcacaaca ttggcataca    315240
     tgccgcacac gagaacaccg atgccgaaca gaaagacaat cccgttatag gaggctcgtt    315300
     ggaggttgga ccaggagaac cagcttcctt ctttgacaag gacaaaccac attattggag    315360
     gaatgtaaaa gcacagtcct gaaataaaca aggccgcgct gattgataat atggttgaaa    315420
     atacaggtat ggcctgggca actacccacg aaacaaatgt gaggacagcc acgagcgaga    315480
     tccaggttat ccaacccttc ttcgtgttca catagcgtac aacagagtga cgataaacgt    315540
     atgcatgaat atagcgagca ataatgctgg tgtttatgga tccagatata aagatcaccg    315600
     gaagggcaac accaaaagcg atcctcgata tgaggggtcc ggctgagagt agggcagggg    315660
     attgtacatc tttgcccacg aataaataca cgagagaacc gatcagggta taaataataa    315720
     tttcaaccac tcccagtgta tatatcgctt tggtgtagtc ctttggggtg tgcatctcgt    315780
     tcataaatga tggtatcgcc ggggcaaaag aataggcgta aacgatatta ttcattgcaa    315840
     ccatggccgt tgagaagctg acattctcct taggccaagc tgaccaatcc gagccaggta    315900
     aactgatgtt atcccgagtg ctttgtacac ctgttgcaat aattgtgatc ccaatggctg    315960
     tgaagatcga ggcgacatca atgtacccga gtatagcaat atcggcgaat gttggtggaa    316020
     tggcaagtaa aaaaagaatc aaagccgaga ccaacccgaa tatcacggtg caaatgccac    316080
     tttgtgtgat atcagccaag gcaataatgc cagtcaaaca atgtgatccc acattgagta    316140
     gcagttggaa gatgaaaacc accgtgacaa tccagaaccc cttttccccc aggataagtc    316200
     tccctatatc tccatagtgc tcaacttccg ggtatttgag cttcactgtg ccaacctcat    316260
     agctggcgta tgtagcaatt agcccaatcc caacggaaga aataatgcct ccgaccatac    316320
     cgagggtcgc gaatgagctc ggaagactga gactcccaag ggcaactgct tccacaatga    316380
     ggataacgac gagacgtttc caaccaagac gcgaaaatct tttgcgaccc tcaattttct    316440
     tgcgtctttc taactctgtc tggcagtcgt ccggtgaggg gtcgctgtct gtgatgcatt    316500
     ttgacggttg gaccggggcg ctttctttat cacccaacgt agtaggttca tattgggggt    316560
     gggagcagtt ttgttcgatt tcagttttca tggttgactc actgcagggc tagattaaga    316620
     ggaaacaatg aacagtcaaa gttttcagtc tactttgccg catgtgcaca tagcgcaggc    316680
     ctcgtctgca acatattttc gcgtaatgtt gaggggtaac gataacactc tgcagacgcc    316740
     cctgtaatag atatgcagaa gcataccgaa gtggccacat gggtacatcg agtcatctgc    316800
     atgttccgag gggattatca tgaccgatct ataaggaacg atggatgacc ggtaactagt    316860
     ccgtggaagt cactagccaa accaagccag cgtttgttta agccagccac gtaatatgca    316920
     caatgcacca cctaggtagc ggtgaagggt gaatttatgg gtcataagcc aaggtcacat    316980
     tcacctaaaa tgtctacaat ttgtagagct acgttagaat tggaatggcg aagaatgaaa    317040
     gactataaac ggaaaataaa agtgctccaa tgcgaaaggg atacatacgc gtgatgttca    317100
     gtagtggttg tttccgggtg aactcctatc ataataaagc gcttgaagcg caagggaagg    317160
     gccacgagga agatctacca cacaattttc gctgtgcgat caccggtgat catcatcggg    317220
     cttggtgtgg ctgcattgca ttggcgagga gcgaacatgc ctcaacatgg gatcgacttt    317280
     tcgtcgcatt ctagtggtgg aaaacatatc attgacagag aagaacagag acctatagac    317340
     aataatactc ctggctacag ataataacta aaaagtatat acggggaagg gatgaattgg    317400
     gggacgagct atctaaaagg aagagggcaa gacacaccgc cggcagatgt catgcctatg    317460
     ttgcctcgga gtttattcca agttttgctt caaactgctt tgggcataag agacggtgca    317520
     ggatcaggat cgtgtcaaag taacactggt catgatccag gcttgctgga aagatactac    317580
     gatttgacgg aggtggtgat gtattgctcg agcgtggagc tcataagtta ggaaagagag    317640
     atattgagat attgtcattg aaccgcagaa actgcagcca gccttcacag tgtatttttt    317700
     tctatgtata tactggcgat gaacagcccc ccaatgacga ttgataacaa catgaataaa    317760
     ggcgccggga aaatccctat cgtcatgcta tatgtagcat tcaggagtgc tggaatcaca    317820
     attcgagcaa ttgcgtgaag aaagctcaaa acacctaata attgccctga ttgatagtca    317880
     ggcacatgtg ctgtgaggca tgatgtcaac agagggttga tggatatagt agatgcaact    317940
     acgaaagacg atacgacgaa atggctgggc gctcgtgaca gcgagatgcc catgtagcct    318000
     atcatctgta gcactaggtt cacctggata gcacccaact ccccagaatt ggatgcagcc    318060
     gacagatttg gcaccccctc tcttctattc cgtcggcaga accaggccat tatcggcgga    318120
     aatagaacga ccagcaccaa aacgctccat gagtaggaaa tggacatgaa gaagctttgc    318180
     gtggtcggtt gccacttgaa caagaatgcc gggtatgcta attgcagcgg agccagacct    318240
     atcatatttc caaacatgat catgtctatc acagccaaaa tgatcatatt cttatttcga    318300
     aaccatttgg cttcccaggt ggacttgagc gacgtcaggc atacgcggat ataactttcg    318360
     ccagggattt gctccaaggt cactccgtcc aggtccgggc aaccactaga gtctgggttg    318420
     cgcgattccg gcaaggcgaa gaggatgaaa accaagaggg atagatgaga gcctatagca    318480
     agccaataga tcaattggaa gggattcggc atggtcagaa gcaagctggc aatgagaggc    318540
     ccagccgccc cagcaaagga aaacgaagcc tgcaaatagc tgaaccaccg tgcccgggcg    318600
     ctagacggca tgagatcggt gatataggtc tgtgaggtcg aagacgcggc aatcatggtc    318660
     ccgctaagac cttccatggc ataacccacg agaagccagt gcaaatctat cgagtccgga    318720
     tagcgtagga tcaagaccac aaggatctcg tgtagaagag ggcctataac ggtacaggcg    318780
     aggattggct tgcgtccaac gcggtccgat agtgaaccca ggaccggggt cgaaaaggca    318840
     cccaggagac ctgctgtcac ttggccatag atgagaaacc gtgaaagatc ggattgcgca    318900
     tgtgtattgg cgaaacattg ttctagttct ttagaaagat cccggtgacc accaccatgg    318960
     atttggctgg gtgaatagcg ctggtgacat atcaaggcaa aggttgcatt gaactcgggg    319020
     accaccaaaa ctccaaagat aaactcataa attgtgaaaa cgcagacgac ccatgagggt    319080
     gaaggttgtc gaaagcgggc ccagtaatat aaagttcggc tcttctcggt cccttggcca    319140
     tcgggttcgg agaaacaatg ctcggggaga agtggatagc tttcggcatc tgatcggctt    319200
     tggtccttca tgttgtaaag agctgggtag attgagatct gaaaataaag tcgaggggaa    319260
     gaggagttta atattgcgaa ttcaaggcag cgtgaccatg cagtactctt gggtctggag    319320
     gtctggaggt ctggtcacta agtcataaca gttgaatggc atgtgaactc tcagtttcat    319380
     tttctgtttc tgtttaagtt gttatttttt tatttgtttt ttctattttt atttcatttt    319440
     tttccgcgac gcattatgta tagactgtgt atctcgcact gcacatacct aggtatccca    319500
     gacggtaagt tttggagcgg gccgcttcac gggaacgcta atattccaag gttcctgaga    319560
     tatacaccct agataggtat acattcaatc aatgcctata ttgtggcaga gcgataaacc    319620
     gtcctgcctg ctgctactca ttttaccagc ttttagtctc ctttccgcta tgcatttaga    319680
     cgagggccta caccgctttg acacgggttg cattcttttt ttggccctct tcccgacctt    319740
     actatgaggg gagcatacgg tggctggcta aacccagctg tctatgacgt accacaacgg    319800
     ttagaaccga ccttggagag tcgaacctga ccggtgagga ccctagggaa ctttagcctc    319860
     cttagaaacg acgtgctact tcggaaataa cgatgatttc tttcttcttg atagcctaga    319920
     tagccaataa gagcctaacc actagactaa tctacgcgtt ttggatgggg acggtattga    319980
     aacacgctcc tctctttctc tgtcgtgtac atctttgctg gctaatacca aaaataccgt    320040
     ttgttctggc tttacatcgt catattccat tctgctgccc cccctccact gtttcatttc    320100
     tttttccata aactaacgtg ggactttcta ctatcaagga tataactatc gcacgttggt    320160
     cttgccatgg tatcaaacca attaaccagc aaggtttaat aaactctaag aaaatattcc    320220
     aacctcagaa agccctgcag gagggtggga ataagtaatt gcggagcgaa gcgaagcaat    320280
     attagatata agtctccccc aagtcacgtg agggcgattt ctaatagtga gattctataa    320340
     ggatcgtatg gtttttattg gatagtccca acgggacgat acctaggtag gtatatataa    320400
     tataatttcc tcgttattat ccacgctgcc taccgaccta aaattttctt ccacttgcac    320460
     ctccttaaat aattctacct attccaccac aacatagccc gctctcgacg acaggctagg    320520
     tcagaatcgt ataacaacga ctcatagact agagaaggta gctccaacga cagcggcgac    320580
     gagcagtacg ataccgaccc gacagagcct gatttcgacg aggattaata ctagtgatat    320640
     tgcgcaactt tttatagata ataaaaatcc tcccgagtat tacctacagc aactcgtaga    320700
     gttttgacga gtctgtgtat aaaaaggagg attatagcaa aggcaccact gttcttcttg    320760
     acagggtcga gtctcgttgg aaacagtata tctcatttgc ttctccctct ttccatcatt    320820
     tagttaaact ccgtcaggtt ttgtgcttat ctccgcaaag atcctgaaca agaattccgg    320880
     aagctatcca ttgccatctt gcataccttt ctcgactggg ccttgaattt gcgacggggc    320940
     aaaaatggaa gacggttgcc tggaattaaa cgaaaaagct cactggagat gttttggaag    321000
     gtctttcgac tcgtcttcgg aattcctcct acgtagatct ctttcaagta taccaaggct    321060
     gggtcgggac acaccatggt gggtatctca aaagaggttg tcatttaaag taggaccaca    321120
     agatgggaga tgcctaatac ggttgaattt attgtaaata atgggtattg ttgacggcta    321180
     gatgttgtag tccgccaggg gaagaagggc tatggcgcac gtagactgga aacagaggaa    321240
     agggaacaag atctgtattc caagagggat ggggggagaa agaaagagcc ctggagagaa    321300
     gagagagcaa cctgggcatg taaacgctgt aaacggaatg gttccaacat atcagtaacc    321360
     gtactcaacc tcctgcttga cagcgagaat ggcatcccgg tatagagcca tgccggaact    321420
     tcggggatgg aaagttttga tttgccgcgt cggtaaaatc cacgatatat cttgagtggt    321480
     aaagtcgccg ctggctagag ctgtatttgc gactgcaaca tgttgtgcaa gatctccatc    321540
     cggatcggat gcaattgctg acgcaaggtc acaccagtaa acggcgacag gatcggggtc    321600
     aataccgagg gttgtgttac aggtgtttcc atcgggaagg ggaagacttc cgcttgcttg    321660
     cagggtgctc aaatcattgc tatcatcagc agaggcctgg atcgtgtccc cctctgtaat    321720
     gtccggccag ccgcttagga aaaaagaagt gctcttgtga ctggaatccg gctctgccac    321780
     gcccgattca caccagcgac gaccctcaaa acggggatcc acgtcgacga agtgagtgac    321840
     atttctgcca accagcttgt ttgcatcact gaccgcggct tgaatgacat tattgaggga    321900
     tgccaccaaa tcattcatct cattcctcaa actggttgtc agccagacgt cagaatggtc    321960
     caccttatcc catccccaat agcggaacga aactgtattg cactccgttg tatcgggatt    322020
     gaaaaatctt ggatacccag caatgtataa gttgaagtcc tgcagtgagt tagctcaagc    322080
     acacgaatca cggtatggaa ttaggaggta cttacgggat ttgattgggt ccacccaatg    322140
     atccgaaggt aaatggaggt gaatttatac tgtagcccgt ctgcgccagt atccgccatg    322200
     agactcttag cggtgcttat gtagtgagag caccacgcag catcccagcc aatgacagcg    322260
     ttgtaatatc tcagaatgca atgcttcaca atattcgaga aacccaagtc gttgccaccg    322320
     atagtcatgg tggccaagct gtctgttgtc gggttctgcc atccgtgaag tttatcgtat    322380
     agcccagcga ccgtgtctcc tgaacaagcc aagttttggt aatcaaagcc ctctgtgaac    322440
     gaatcatgta acagcttgcc gaaattattc gatccaactc ggcatttgtc gcgagatgtt    322500
     gatcccgtgc ccatcccagc ggcgaaggag tctccgaaat gtacctggcc agtaacagct    322560
     ggaacatcat cgtcaacgtc atcccactgg agatagtcat tgtctgcaac acattctgtt    322620
     gcacgcttgg ccacggggag tgccggcaga gggatggtac gtccggtctt cgcagtgaaa    322680
     tagacacccg ctgccaacaa ttgataattc tctgcattat tcctcgcaag tctttgtgca    322740
     caaagacctt caaccaattt tccatctggt cctgggacgg ggcattcaac tctgtatgct    322800
     ggcttccctg gcttaggggg ctttcgcttg gttacccatt gggcacatga acgatcaaaa    322860
     gtgccacgag caagcttcca gcaggcgtcg aagccatatg cgatatcacg ggtactgccg    322920
     ggtagtcagt attggtagag acaagataac taatacgact cacaatggtt taccaagcat    322980
     cccatatctc gtgtgagtgg attcatgtac aagaacggca gaccttgctc tcgaagcctt    323040
     gcggaggtcc atctgggtgt cctccagcag gtcctcggtg ggccatattt ggggcaatgt    323100
     gctagcgggg tccgggggtt tgaaaaaagg agcgcagaaa gtcatgcgct gttctttgtt    323160
     gttcatgaag gcaacatatc cttgttgaca cagttctgtc aatacagacc ggtcgcagct    323220
     caggaccaag gggaactccg gatcactgcc agcgagtagg ctggcaattc gtttaaacgt    323280
     tttcgtggtg tcggatatga attgagagtc gtccttcgca ttgaagagat tgtcgaggta    323340
     gtctccttgc tggaggttga gggcggagac ctgcgccatc tcaactgcat actggagctc    323400
     aagctcaatc acctgcttct gcgactcatc acactttgaa gcagcggaat catcatagtg    323460
     atagttcatg tttgcgctag atacgccgtc tttcgatatg cagattccag atggacagta    323520
     acctcggctg caggcaaagt cacagaggtt gtcaaagatg tcggaataac cggggcctgc    323580
     cattccggca ccatctgtct gggcgggcgg ctgcacgaga gcccctgttt ttgtacagga    323640
     acatagattg atgggacaat atccataggt gcaagcgtac gaacataatc cggagactgg    323700
     accgggtcca gtgccagcaa cacaggcagg agggaggaag tccgaaactg ttgggaccgg    323760
     catggggtat tttgtcgtgt cacacgtctt ggatggacaa tggccgtagt tacatgcaaa    323820
     gctgcataga ccctggtagt tggcatcttt cccttctgcg ggatagccga ttgttcccgt    323880
     tgcattgggc agtttacgtg caacgcccat ccgctcgcag gtacatgcgc cgacagggca    323940
     atatccgtag gaacaagtga aactgcagag gtcgttgaag tcgtaggcgc ccttgccttc    324000
     gacgcatgcc tggtcagcta ggtcaatcga agtggtgtca gaggaactca ttatccctcc    324060
     agaaacgctt cctacccacg cattgaagtt attgaaatct ccttcacatg tatgggatat    324120
     ctcagggcct accgcactgc caatggtagc atcgcctttg agtaaatcga ctctaacctt    324180
     gccagtggtt gcagcaacgc taccaaacca aacgccagcc tcaagatcac cattcggtac    324240
     ggaatcccaa acgacgatgt catgattatt aacaaatacc gcagagttgc cggtctgaaa    324300
     caaccccata acaaagatgc ggtcttccag agcagaagaa ggttcaaatt caatctgcag    324360
     ctgagaggca gtgttcactg ttgtccctgc gacactgcaa gcagacacaa agttgcggcg    324420
     ataccagaag acaactatat cgtctgtcat ggttgctttt ccaagcttgt acacatcaat    324480
     caaaaaagga agagctttgc gccaggcgtc atggggatga tccatcacgt agttgtatgg    324540
     agcttcacca atatcaaagg cagccatagc gttgtcatgg atcgggccga tatagtgcga    324600
     ttcgccgtaa tcattccagg aaatgatttg aacaaattca ggcattgggt cgagaccgaa    324660
     aagctcttgc caccgatcaa accagagact atcacccttc caaagccagt tcttgttgta    324720
     tcctggcaga ttggtataga accaggggga aatggctatc atatatggtt tcccgtccaa    324780
     atattgtata tatgaggcat cggtgtaggt atccatagta tgattccccc atggccacgc    324840
     cgaccagctg aataatccat cggcaacgcc atttgccaat tctacagctg gcttggcgcc    324900
     gacagaagac cagtccggca taaagaagca atttgtctct gacttgattg taacccagtc    324960
     atctgcacta ccaggccctt caaatgtgga cacgaagggc ctcccgttgt actggaagta    325020
     tgcagagttg gagccatatt tttggatcat gctggtcaca acacctttgt cccaaggtcc    325080
     attgccagca tagtcaaatg agaagaatag tttgaatccc ttcgcattgg cagcagcaaa    325140
     agccatctcc acggaagcgc tattggtgtt gtcttcccat gccatgttga gggcaaacgc    325200
     atcgatgtgg gcatccttgg ctagccccat gtctgactgc cagtcggaag cagtgtaatt    325260
     ctcagaattt gtgacctaga gtagtattag tgtccttctc gctcgtttcg acaggaaagt    325320
     ccagaatgga agtaggtacc atgaaatgtg cgaacacagc tttcgcattc gcctggtgga    325380
     tgacctgaaa ggtcaccccc atagcaagca gtgcaaacca attcattgtc gcaaaaatga    325440
     gggagagatt ggtctgaaaa caggcaacta cgagacaact gctcttttat attaaatcct    325500
     taaagcccca gttggcctcc catcggccga gtgtgtgtca actatccgaa cttgtttcta    325560
     gctccgtttc gaccgcgagc gggtatagct tttagccaat aaatccttct cttccgcaaa    325620
     gagttaaatc ctcgccgaca tcccgacgca aggtgggcag aaaagagatt gcagccaggg    325680
     aggtagcatt gagggtggtc tcgaaatggg actaaatgac aatatccagt ctagcgtcaa    325740
     gcaatttcag agagcattac ccctatgata ttatacgata aatctgagta catttacctt    325800
     gttttccatt gcaggtgcca atacagtgcc tttgtttggc cccgcattag tccacaaacg    325860
     gtataacggc acagatacat agttggattt atcttttgaa tgcctttgca aaagcgtgat    325920
     agctcaacag ctatgcgggc actggatggg caaactataa gcggcattgt gaggcacctc    325980
     aagactaaat gatactagtt cgcttttgat tcgggtatca cgtcgctcgg gttggtctgt    326040
     gcaggaaagg cttagcggcc cactcagttg atgccggcgc ggcgctggtg tcgcttccta    326100
     gccctgatta ggtcggatag aaatctcacc tcttttagtt cgatttagtt agctttccat    326160
     aatgcaacaa aatattgggt atatttgatt aaagtggaac cctcaagctc aagtgtaatc    326220
     tccgggctgt tttcttgatt cgaacaaggc gagtgcaacg tgggggtgag ctcagactcc    326280
     ataaaaaaat ttcaatctcg taccaccttt tagcaaagga gggcgaatcg aacggatccg    326340
     aaattaccag acacttgaat ctggagatag ccaatttgct cttgatcggt ttagatgatt    326400
     ttacttgaac atacctcgac gaatgaaaat tattctagtt cctagcattt aggtcgagac    326460
     caatgagtat ccatttcaaa tcaatcaatg gcagtgaact cgacgaaatt ggacgagggg    326520
     accattatca ccggtcttcc atcattatca gcaggctcga cgacatgatc attcagccaa    326580
     cagggtaatt tcactactgt gttcgcatgt tcctcgcgat cgccccaagt ccaccagtca    326640
     atgcagccac cccagtactg gtaacgatat gtgtcgccaa ccactgtatc agggtgtaaa    326700
     tcggtaaagc caagggaaac acatctaata agactttccc cgggttgaag gctgcggaaa    326760
     aacatagaat ccgtgacgtt gacctcaacg tcaggttcat ctactatcat ccagccctca    326820
     ttccgttcgt catcaaagta actcttccac tgcggagaat cgtcgtccaa cttcttcaac    326880
     ggatcataat tatggcagca tcgttgtagt cgaaagttat cacgagaaaa agggtaatcg    326940
     tgtatgatga ttggctttgc atcaccatag acagcctcgc aatcctcatt tgtcagacca    327000
     tcgtaggtaa tctttaccat gatttgaagc ttttctgttc tcgatattgc cgacgggcct    327060
     tctagaaaca cacttataca gggggttcca gggctgtaaa gggagtacat cagtcataag    327120
     gaagacgata aatcatatca aaaccattct cacattcgtt tggatttttc cacgcaagga    327180
     tcatcaggct cagaaatcga aatgccttcc tcctctacgc aggtaagaga acaacaggct    327240
     cctccgggaa tgatgacacg gggtagccct aggttaaccc caatttcttg ttcccagtgc    327300
     tcgcgcaaag tgccccaagc ccataaggca tattcagccc ccggccagaa cagctcgtat    327360
     ctctcaccgg cgttcaaatg gtcccagaag ggatacggat gacctatatt tcttcggaga    327420
     gtttggccag gaagaagctc ctcagtttca acttcatatc cagtgagtct aaaggtctgg    327480
     agaggtggcg aattgtgctt tccttcaacc ttctttaaac catccgacgt gtgttgaaag    327540
     agcataaagc ctgaaggacc ccatccatca cgtaggatgt tccagcggaa gatacaagga    327600
     ttgctgcagt cgtcttccgc ccgacggatg gtgatgataa cccctatcgg gttatctaga    327660
     gacatcactc tgttgggctc tatctccatg gagagcctag gcgtgttcgg actttgagat    327720
     tcgttagttt tgaacgatgt acaggtaggg aaaatctcac ggtctgtcac gttcaaaata    327780
     tttgatactt gatacgagtt cgggatccat ggcagtttac cccttaaaaa aaaaagaaga    327840
     aaaagaaaaa ggaagagaga gaagagagat gtggggagta tgggtaagcg ggaaagcagg    327900
     gaagaagaga aagatgggaa gagaaagaca gagagaaacc tgctgaacta ataggcgggg    327960
     tggttcggca gagaagctcc tcagtaatct aggcacacat gagataacag attagattta    328020
     ctaaagaagg cgaaatagaa gaaactgaaa ccgtgaccta tataagaatt ctggaataaa    328080
     atagatagag gtcccgaggt cccgaggtca ctaataaggc ttatgtgagc ttagttcaag    328140
     gtgtatcatg ccaaaagcgg ctctctttct ccttcctcca tattctgtcg caaagacaac    328200
     cacagcaaca ccccttgccc cccagcaaaa actgcatcat caacagccac aaacccaacc    328260
     atatggtacc atgcattaac aataataatg atcgggtgtc cgccatctag gtataaatcc    328320
     catggaacag agactctagg gacccagaaa agagccgaga gtataaaagc cgttgtttga    328380
     agcttaagcc cagtcagact ttgagtttgt agggtgctgc gggcttgttt gaatatccct    328440
     ataataatag gtatagttgt aaatactgga aggagaatca cagcatgaag gccttggaag    328500
     agagcgatag cgtcgcgctc atgttcaggg cagttcggac ggtctggagg acagaagatg    328560
     tccgaaactg catctgctat gacaggtact agggatataa tgagaaagcc gatataaatg    328620
     gctactacca aggtcttgcg aaggcgacta gtaggtttgt ggtagaggtt cagccccaac    328680
     ctatacatcc tagtcagtct ttggtcgctt cttgattctt aggaagcgta atgttttgag    328740
     ctcacagaat attaaacaat gcccacacac cgctcacttg gaaaaggttt atccagtcaa    328800
     gtgcattgcg gggatggtga gtccagtagc ctgtctcgac agggagattg atggtgtaaa    328860
     ttctagatca gctgcatcgc caatacagtt acgagacaaa gcattgtatt tcaataagcg    328920
     taagtcctgg tattaagacc cataacaggg atattgatag tcagggatta ttcctaatat    328980
     agactagggt cttttggcgg aaggttagag aatctctcga agagtgtagg tgggtgcgcc    329040
     agtttcggga cgcactgtac agtacatgga ccaatgaccg actgtacagg cctgtgaaaa    329100
     ggtatcctgc atatcgttcg cgaggggaca ggtagagaga acgccggtac caatctgtga    329160
     ctgaatatct cttaattgtt gtggagcgaa aatgacggga cgggccgaga cacgaacccc    329220
     tgaaccgcct gaccgcgacg aacacgaaaa ttcaccaccc cgattactga gaccgaggcg    329280
     ctccaccaga ccgcctaaca attatgccca ggagcaagaa ctcgatatcg aacaaagcaa    329340
     cgcgcgttct cagcagaaga agacccaggg caagccagtg gcccagcgtg aagcggtagc    329400
     ctcggaatca tcaacagaga gcgaggaccc gaacgcgtcg gaactgttga aggaacttgt    329460
     caaactcagg aaggagatca gacagcgaga cgaattacat aaggaagagc ttcaaaaagt    329520
     caaagaagaa tttaccgccc tcaaagaaga gtttagcgcc gcccttgcag aagttcggca    329580
     cgagctacag accctggcag atagacccgc gacccctcaa ccccaccccg agtcgtgctc    329640
     cccgaacaac catgatgcga ttctccgcga gattcaatct ttacgtgagg aaatcagcgc    329700
     ccccgctccc acgagttccc cgtcctatgc agatgtcgcg cgcactcccc caaccagtta    329760
     cccaagcaac atacggaccc tgtcaacgct gaacacgaca ccgaccacct tcaccgaaac    329820
     tttgtactgc acgatagaca cctcgaagat gaccgaaagt gaaaacgaga ggaaatctgc    329880
     aggctcaatc agggccacaa tcgagaaaga ggtccgaacg atggatgatc acactcactg    329940
     gcgctgtcgc gcggttactg tcagtccaag agaccccaac cggattagga tcgtatgtcg    330000
     cgatgaagcc gagcaccagc tggtcaagaa agtggcggaa gaaaagatcg gaacgggagc    330060
     ccgggtgctc cgggacgagc tatacccgct taaggtcgac agcgtcaaga agtctgcagt    330120
     actggatgaa aaccatgaca tgctggtagg agcagccgca gccctaggtg aggaaaatga    330180
     aactacagtc gccaggataa cgtggcttag cagtaaggag gccgcgaagc catataggtc    330240
     aatggtcgtg tacctcacca agggtagtga cgcgcggagg ctattagccg acggatactt    330300
     ccacgttgga ggggaatccg ggacaaccag cgtctttaaa tatcggccac gaccgatgca    330360
     atgttacaac tgctaggaga ttggttataa ggcattccaa tataagaaga cccagaaatg    330420
     cgcaaaatgc gccacggagg gccatcatta tagtcgctgt gatcaagagg tcccaaagtg    330480
     tgttccatac ggtgggccac atgaatcgtt tagcaagaat tgccggaagc tctacccacc    330540
     acgccatgaa taagaaactt cgaatgatcc aattgaatgt gaggaagtag ggtgccgtgt    330600
     atgaaagctt aatgaacgac gaacaaacta aggacgtagt ggtgttagcg atttaggaac    330660
     cctaggcgag gaggatttag ggacgactct tgaccacccc gataggacac cacaaatgga    330720
     cgaagatagt tccctccacc tagagggaag gtagatgggc gatccgaagc atgctttgga    330780
     taaataagga cgtggaagcg gagcaagtgc ggatagagtc gccggatctg acagcggccg    330840
     tgattcggct tcccgaacga ctgattttta tagcatcagt ttacgtagaa ggcggggaag    330900
     tctctgcgtt gatcgacgca tgtgatcacc ttagaaaggc tatcataaag gtacggcgag    330960
     acacgggcgc tgtggtggac atcattatta tgggagactt caaccgccat aatcaactct    331020
     agggcgcgga cgaggtgtcc ttcggaagac agggcgaagc agacccgacc attaacctta    331080
     tgaataaatt cgctcttagt agcttactca aacgaggcac gaaaacatgg catagcgaag    331140
     gacagtatgg ggactacaag tctacaattg acctcgtcct agcctccgac aatttagcag    331200
     acctaatgac caagtgtgta atacacggga ctaagcacgg ctccgatcac cggacgatcg    331260
     agactatatt cgatgcaccg tggtcagccc cgaagcatca ggaacgactt cgtctgaaga    331320
     acgcgccata gaaagagatt aatactagaa tcgcgagcac cctggccacc actccgtcgg    331380
     aaggcacagt gtagcagaaa accgaccgac tgatgtccgc agtctcagat gtagtgcata    331440
     ccttaactcc aagagcgaaa ccatcgcgac acgcgaagcg gtagtggaca accgacctaa    331500
     cacaactccg tcacatatac acatactagc gcaatcgggc tcgctcggag cgacgggcgg    331560
     ggcggaaaat acctaagctc gaaaagatgg cccaagatgc ggcaaagcaa taccatgatg    331620
     ccatccgcaa gcaaaagaaa aagcactgga atgagtttct cgcagacaac gagaatatct    331680
     ggaaagccgc taagtacctg gaatcgggag aagacgcggc attcgggaag ctaccacaac    331740
     tcgtcagagc agataggacc accaccgcta accataagga gcaagcagaa gagctgttgt    331800
     ccaagttctt tccccctctg ccggacggga ttgaagacga ggggacgaga ccatagagag    331860
     aaccagtgag gatgcccacg gttggcatgg aagagatcga aagacagctt tttactgcta    331920
     aatcatggaa ggcaccgggt gaagacggtc taccggcggt agtttggaag atgacatagc    331980
     cgactgtcaa gcatagggtt ctcgatttat tccaggcgtc attaggagaa ggcacgttgc    332040
     cgacacaata gagacacgcg aagatcatac cgcttaagaa gccgaacaaa gaggattaca    332100
     ccattacgaa ggcgtggagg ccaatttcac tcctagcgac attaggcaag atactcgaat    332160
     cagtagttgc agagaggatt tcacacgcgg tggaaacgca cggattactc cctaccagcc    332220
     acttcggtgc ccgaaagcag cgatccgcag agcaagcgct agtgcttctt caagagcaga    332280
     tctacgtagc atagcgtggc cgacgagtgt tgagcttaat cagcttcgat atgaaagggg    332340
     cctacaacgg agtgtgtaag aaacgattga tccagaggat gaaagcgcga ggcataccag    332400
     atgacttgct acggtaggtt aaggcattct gctctgagcg aatagcgacc atccaaatca    332460
     acgggcaact ttctaaggct cgaagattgc cacaagctgg cctcccctag ggctcacccc    332520
     tgtctcctat cctgttccta tttttcaacg cagatcttgt ataacggcag attgacagcc    332580
     aaggcggtgc ggttgctttc gtggatgatt ttaccgcgtg ggtgaccgga ccaaccgcgt    332640
     agagtaaccg ggaagaaatc gaagcaatta tcaataaagc gctcgactgg gaaaggagaa    332700
     gcggggcgac ctttgaggct gagaagacag ctatcataca tttcgctccc aagatgcgta    332760
     aatcagacca taagtcgttt atcatcaagg ggcagacggt tgtgcccaaa gaccacgtca    332820
     agatcctggg tttattgata gacacgagac tgaaatacaa ggaatatatt gcgagggccg    332880
     catccaaggg cctagaggca gcgatagagc ttcggcgact tcggggcctc tccctagtaa    332940
     cagcgcggca gttatttaca tcaacggtgg cgccggttat ggactacgcc tccaatatct    333000
     ggatgcacgc gtgtaaggac aaggccatgg ggccgatcaa tcgagtctaa agagttggag    333060
     cacaagccat tatagggacg ttcctcacgg tcgcgaccag cgtagcggag gcagaggccc    333120
     acattgccac cgcacaacac cgattctaga gacgggccgt gaaaatgtgg acggatatgc    333180
     atacgctacc taaaactaac cctctccgca ggggtacaga ccggatcaga aagttcagac    333240
     gatatcatcg ctcgccacta taccacgtag cggacgcgct taagcacgtc gacctagaga    333300
     cactagaaat aatcaacccg ttcacgttgg ccccatacga tgaacgcgtg cagatcaatg    333360
     ttaatagaca agatgagcct cagactgaag cgggcggact aatgcagatc gcggtcagca    333420
     gctcggcacg gaatgagcta gtaggatttg gagtcgcaat cgagaaacaa cctcctcgaa    333480
     atcggaaatt aaagttcaaa accttttccg tcacattggg cgcgcgagca gagcaaaacc    333540
     cgttctctac ggagctggca gccatagcac acatgttgaa aatagtagtg ggaatcaaag    333600
     actacaagat tacgttgctc acaagcaaca aggcggcggc gttcacgcta aggaaccctc    333660
     gacgacagtc tggccaggag tttgtttgcc agatgtacaa gctgataagc aggatgcgga    333720
     ggaatggaaa cagcatcaaa ttccactgga tccctactac cgcagacaac aagctgttag    333780
     gtctggctaa agaacaggcc agaactgcaa tataagaaga tgctctccca caagaacgcg    333840
     ttccgaggat gaagtcgaca acattgaata tcgcacggtc ccaagcagtc cctagcaatg    333900
     agctgcgaga gaacgtagga agacacgcaa aacgagtaga tgccgcactg ccaggcaaac    333960
     acacccggta gttatatgat cgcctgacgt ggaaagaagc gaccgtactg gcccaactcc    334020
     gaaccggcat ggctagactt aatagatatc ttaatcagat taatgtagca gagaccgatg    334080
     aatacgattg cggataagca agagagaccg tggagcactt cctcttccga tgtcggaagt    334140
     ggacggcgca ccgaacggaa atgttataat gcacccagac ttaccgagga aatatatcct    334200
     tcttcctggg aggaaaatag ccttctgatg atcagaagtg gacgctaaac ctagaggcag    334260
     tacgggcctc tatacgtttc gccattgcga cgggccgact cgaggccact tgaacatatc    334320
     aacgaacaga actccccacc ccattcttcc gaccctactc acccaccacc tcgtgctaca    334380
     aacggtagac gcgcttcaac tgccgaagat aggatgttga acacttgaag aagcgccttc    334440
     aagccagtct actaactaat actaacccat agggtccaac tatgagattg aaagctgaga    334500
     agtcaatgcc gaaggaaata ctgtatgggc tccaatgaga cacggcgtat gcctaaacat    334560
     gcatgtactg atagattagt gatagttgcc ctttcggctc agccgccggg cgttaatgaa    334620
     ttgtgtgtgt gtacagtaca tgcaacgttt agacggaaag ctactcagta ctcggatgat    334680
     ccactacctc aaaatattgg cataacttgg ctccacctgt ggtggacatt ctgcccgggc    334740
     ctgtggatat gcacatattt gatgtgttga atattgatca ctgtcttata tacgttcagc    334800
     tccttttctt agctcttttc acctggggct tccaatacgg catggggcca ttgaacggca    334860
     ctctggttat acaaatcaac gacacccgaa aaacattcaa agtttgagct cacgttcaaa    334920
     ggcactattt aatgttgcca tataatctat ttaaaccttt caaaatccac gcgaaccaac    334980
     gccaagcagg ttgtagctaa attatttcat gaatagggat tgctttcttc acgttttcga    335040
     cccagcgccg aatgtcttct acgaaacgtc gagcaatgcc catctttatt cccttgccga    335100
     tgaaaaatcc tgggtcttga tccttgtaga cctgctcaag gtcaagacca tcctcgagca    335160
     tcaagtcaca gacttgtcga aatgcagcct tgagagtgtc atcagtgaca tttgacacct    335220
     gccactcact atattctctg acggcttcgt ctctagatcc agggatctcg agcgggcttg    335280
     aagacttcaa gtcaacagct tgggcagccg aaatgtcaga tccagagacc gaagactgcg    335340
     aaggcaggac attgatattg ataggaggat acggtactcc atttccgatg atatgtccac    335400
     ctttgcgatg gctcttctcc agtctctgct gctcttccat gaataattcc tcgcgtaccg    335460
     tttccggcac atccttgtga ccgtccaaga caccaccttt ttcgacgtag gtgactaggc    335520
     gtctcaaatg atgagttttc agttgatagt gcttttttcc ccactggatc cacccagcaa    335580
     taggggcccc cagggcatgt cgacgaagcg catcgcataa gattataaac gctgcgccag    335640
     actggctttt gtcccgaggc atcctcctcc gcatccagct gggcatctct ttcatcgagc    335700
     atcctgctcg tgacagagga ttttcctctt ttctccactt tccgaccaac ggctgcaggg    335760
     gaatgacgat tgtctacata gttgaaacag attttcagtg tgagttcctt accactggag    335820
     aacagacccg accacatcag gagctgcttt tcgatggcat tccaaatgat ttcggtgtcg    335880
     tcaaatcgtt tagtcagatt gcgctgtgtg cgatcattca ctgaaacgac aatggcagtg    335940
     tcatcagctc ttaccatgcg atggcgggca attttacgcc gaaggacctt ctctagctta    336000
     gcttcttctc taagaacagc tgccagtagg cactaggagc caaaacgagg tcttcctccg    336060
     tgtccttaga cacctcccgg ttgttaacgg ccactcgcca ctctatacgg tagtgaatac    336120
     aggtcggcgg gtcctggttg taatctcttc catcctccca ttcggacaac tggagcagcc    336180
     tgagagtatc tggttgtgac tgattctcaa gcccaccagg cgaggaggga ctgtagttgg    336240
     accgcgttgc gtagggactg ccaatgtatc caggggttgg agcgtacagc gaattgtgtt    336300
     cccatggctc aaacacttcg ggttgagata tggaaccgac gtgatatggg ctctgcgaca    336360
     tctctacaca cgattacagc cttgaaagac ccatgtcagc ttctccgggt acagtatacg    336420
     ctgataacga acgaaaatcg cagtagatta acaggaatca tggaaacaag aagcatgttt    336480
     tcctaccggg ttacctctct atggtaccac cgcagccttc tattgggtat caaacgattg    336540
     taggcgaagg ctgcctgtaa tgagtagacc gacaagtggg agagtgggag atgaatcttg    336600
     ccagaatgtt taggattcat cttttgtttg gtttgtttgc atgaaagatt cgaattgatt    336660
     ctacaggaat ttacggtact aaaacaatga cttatttaat attaccgacg aatacaatac    336720
     cgtcctacag ggattacagg gggaggtcta aaattagatt agcgtgtttt gagtcagggt    336780
     ttgggaatgg attcgagaga gtgtagtggt aaagctgatt tcgaatattg ctgtattgtg    336840
     cgcagctgta cgcatggaga ggacgactgt acctttccta cacaattgga tcgactgtac    336900
     agcgcgagcg acgttgtgat taagattatt ctgatataaa actgcgacgt tgtgtaccga    336960
     gcgggaacta accccctgac cgatggcgga cccacatgcg ggagggcccg agagccctcc    337020
     cacaaacact caagaaagca ccgacggctt cactggggaa gacctcgcaa ccagaaccac    337080
     cgtcgagaac cggaagcgaa cccggagtgg agatgccttc agtccttcgg atccagccgg    337140
     tcgaatcacc accaaggagg tgtggaaact gatcggcaca ctgaaagacg tcatccacca    337200
     ccaaaccgcg accatcgcag caacccaaca ggaactccag gaggtcaagc acaaccagca    337260
     tgttctccag gaacagaacg agaagctata cgatgaggtg aaggcgctgc ggacacaaat    337320
     cgagaccaac cccccggcga cagcaaccaa gacctgggcc gccgtcgcgg cggagggcgg    337380
     caatagcgcc tccctggtga acccccaacg acccgagaga gaccaggatt gcgtcagaat    337440
     cagcacccag aggacctttg tagacccacg agacaacgat agtagcgatg gaaacacgtt    337500
     cggacgatat ctccccgtcg atgccgccaa cagccatatt cgtaccgcgt tgcagagcga    337560
     caccgcgacc caagacaccc aagtagccgg tatcggcact accaaaaccg gctacattat    337620
     tcgattcaag aacacggaat cagccgagat agcccgcaga aacacagagt ggctacacaa    337680
     gctgggcaat aacacgaggc tagtgaagcc acgattcggg gtcgtcgtat accggacccc    337740
     tacggaggaa tttgatattg agacaggggt cgcccaggcg acggagaaaa tcatcgcgga    337800
     aaacgaccaa gcggatcaca gcttccacat tgaggaacta gcttggatga aagcgaagga    337860
     taagacccta gggaagttcg cgtcactggg aatctggttc gattccccag agggagtgga    337920
     atacatgctt cgaaaagggt tccttgtcag cggacaactc atcaccagtg ttgaacgacg    337980
     cgaaatcaag aagaagaggt gcttccggtg ccaacggttc ggtcacctgg cgtggttata    338040
     taaggaaaca ccacgatacg gacactgtgt aggacaacac gagcgggagc gatacccgcc    338100
     tggagtgaga gcccggtgtc tggattgtag tggtgaacac cctacgggcg atcgagagtg    338160
     cccaatacta tcgacctcca accctaccag atgctagaga agaacctccg tatcctacag    338220
     ttgaacatga tgaaatcggg accgaggatg gaggcgctga tcaacgatcc ctagagccta    338280
     gatctggacg ttctgctgat ccaggaacca tctattacca cctaccgaac gtatatcaac    338340
     cacagcgcct ggcgtttata ccgacctaca actctgacta acgccgttcg atttcgcagc    338400
     ttactctatg ttaatcgaag aatttctacc ttatcacatc gccaactacc atgcgaccac    338460
     ccagatgtcg cggccgttaa gatctggaca gccgactccc aaacgctggt attttcggtc    338520
     tacatacctc cagtaccact tttcacgggc aacgactcgt cagcattacc agccctcacg    338580
     gcgatacaaa actctattat aagcgccaca caaaatgagc agcgcgcgac gagcattatt    338640
     gtttccggtg atttcaaccg acaccatcca atgtggggca acaactatat cgctcctaga    338700
     ttcattgaag acgccagcga cctgatcgat ttcttccaag cccacaacct ccacggttgt    338760
     ctccctcgag ggacggcgac ttactgggca ttcaacaacc ctggacagaa ctcgaccatt    338820
     gaccagacgg tgacagataa cctggacttg ctcatcaaat gccatctgta tcacgaaaac    338880
     tatggatccg accaccgtgc cacctattca gaatggaacc ttcaaccccg gagcaggcca    338940
     aacaccaaag caaggaaggc gtatgagcgc gcggactgga ctaggatcgg cgaggaagta    339000
     gcccgacaga tgaacctatg gaagcagatc aagacccggc taacactcga ccgggtagtg    339060
     gaaaacctta cagcggcaac ggcctaggcg gtcgaccggt tcacacccga cacacgcccc    339120
     acaccatact ccaagcgatg gttcacgcca gatcttaaga cccaataagt cgaagtcaac    339180
     caactgcgaa ggaggtggca ggcaaactgc gccgagctgg gaagagagta tgctaatacc    339240
     acggctgcct tcgaagctat gcagcagaaa cgacgagcgt ggacgaggac catcgaaaaa    339300
     gccaagtcct cacactggaa gcagttcctg gacgaagctg gtgaagggaa gctctggaag    339360
     gctgcgacat acatgaagcc ccgagagaca tgggattgcg tcctagcact gcgagtgggc    339420
     tcggaggagt gcacccaaaa caaagagaaa gcgaagacat tcctggatgc gttcttcccc    339480
     gccatgagtc cacccgagtt caacccacct accacaccgg cgacggaact cccgtggcac    339540
     ctaatcacag aaccggagat tgagcgatca ctgaaagcag ccaaagggaa tacagcgccc    339600
     ggggaagata ccttaccgat gctggtttgg aagaagcttt gggggcatct caaggccttt    339660
     attgttagca tcttcacagc gagtgtagag ctagggcacc atccgagaca gtggaggagt    339720
     gcaaaaatta tcgtcctacg aaaactaggc cagcctgatt actcaaaacc tggtgcctac    339780
     cgcccaatct cacttcttaa cacgcttggc aagctcctgg aggcagtgat ggcccgacgg    339840
     ttgtcctatc tggcggagaa acacggcctg ctaccaaaca gccagttcgg cggacggccg    339900
     ggtaggacca ccgagcaagc cctactagtg ctgtccagtg cgatcgacaa agcctggtac    339960
     aagcacaagg tggtgaccct aatcgccttc gacctcaaag gtgccttcaa cggagtaaat    340020
     aagacaagcc tagatgcgtc gctgcaggca agacggatcc cgattgtggc cagaaaatgg    340080
     attgcaagct ttatgagcga ccggcacgcc agtattgggt ttgacgactt ccgctccgag    340140
     actgctctgc tattgaatgc tgggctagct caaggatcac cactttcccc catcttgttt    340200
     gcattcttta acgccgacct agtcgaccag cccgtcgact cctagggagg tgcatcggca    340260
     ttcattgacg actacttccg atggagagtg gggggctcgg ttcaagaaaa tttaactaag    340320
     atacagtccg aggatgtccc tcgtatcgaa aagtgggcac ggagaactgg atcctacttc    340380
     gcggcggaga aaaccgagct tatccacctc accagaaaga ggggagagca tatggaagga    340440
     cgaattatct tcgatgggac cgacgttaag ccatcgccta cagccaaatt actaggggtg    340500
     gtgttcgacc agggacttcg ctagaaggaa catatccagc aggctatcaa gcgcgccacc    340560
     aagaccacaa tcgccttaag tggactacga cacttgcgcc cagagcagat gcgacagctc    340620
     taccaagcat atatcgcgcc tatagttgac tacgcatcga cggtctggca cgacccgctt    340680
     agggacaaag ttcacatccg acacttaaac acagtctaga gaaccgtgct gatcagaacc    340740
     ctatcggcgt ttaggacggt agcaaccgcg accctagagg ttgaagccta tatacttccc    340800
     acgcaccttc gccttcgcca ccgagcgcag cgtacgattg cgagactaca cactctacct    340860
     cgcgaccatc ccatttggag tgctctgtta agagcccaga accgtaggaa caatgtcgga    340920
     tcatacgccc gcttcccatt agcagaagcg ctgaagacta tggacgtcga caggcttaat    340980
     gaactagaga cgattaaccc acgcccgcta ccaccgtggc gaaaggatgc cttcacagag    341040
     attgagctta aacccgaccg agagacagcg agagaaaggg cggcgtccgc aaaggacacg    341100
     tcagacatcg tcgtctactc agacgcctcc gggcgtaagg gtcatctagg agccgctatc    341160
     gtcgccctca acgacaagga taaggtaacg gaatctcaac aggtgcaagt agggtcgatg    341220
     gaacggtggt cggttcatgt agcggaactc atagggatct tctacgcggt cagcatgaca    341280
     ttcaaattgg ctcaccaacg cgcaatcgtt ggaaaccaaa ggcaagcaac agcaacaatc    341340
     ctttacgaca gcagatccgc tttataagca acccagaacg tgagaaatag atcagggcaa    341400
     cgaatcatcc atgcaatcct ctaagcagcc accgaggttc aagcaaggca tgtggccctc    341460
     cgcctctagt ggatgccggg atattgtgga aacgttagga acgaggcagc ggatcgactc    341520
     gccaaagaag ccgcgcaacc gggcaaaacc tatcctttcc ggccgctact aacgagagag    341580
     aacgccttcc tccgcggcaa gatccatact cagtgggagt aggagtggaa ttcaagcacc    341640
     aaaggcgcgc acctacggaa ggtggacggc gcgctactag cgaggcacac cagaaaacta    341700
     tacgggaacc tgcccaggaa ccgagcatat ttactcactc agctacgcac gggccacaac    341760
     tggttatcta cctacgccaa gagactcggc ttccgcgacg atgatcgatg cgagtgcggc    341820
     gcgcaggaga cggtcaacca cgtgttgctg gaatgtccaa atctacgaga cttacggaca    341880
     gaattaagaa gaaatgtcgg ggacgcgatg aacagcgtgt cgagtctgct aggaggctca    341940
     aacgaaggtg agagaggtga gccagacacc gtctcaaggg cgaagacggt tcaggccgta    342000
     ttggacttcg ccgaggcgtc acagcggttt cgcagtcgtg cgccacaagg gaagcctaac    342060
     aacgggagcg gcaatgggcc agggtaggcc gtgacgaggc gctaagttcc tgtcagaaag    342120
     tggatcactc tatatgtaca ttatccatga tttatagttg ttgtatcctg catatcgttc    342180
     gcgaggggac agggtaaatg aattctacta ctactactac tactactgct gctgctgtat    342240
     tgtgcggagc ggtcgctact gtatattctc gggtactgta catgtccaac ctggacatag    342300
     aggtagtatt cggaccggtc gctactgtat cgggggggct actgtactcc attgagtggt    342360
     cgctactgta gagaacaagg cgcgtctgta cctgcggaga ccatggggat gaccacgaga    342420
     agccagcggg tggggctgga ccctcagctt ccagagcccc cagcccgtcg cccatctccc    342480
     atcctcgaag ccgcaaaccc cgcaatctca cccgaatacc ccaacgttga ggacttttct    342540
     ctcgccgagg atgattctca cgatgaggat tactttctcg tctcaatcac ctacgactac    342600
     tccaccatca cagcccgagc tcgttcgttc caaggaatag tgcttgctgg ggccactccg    342660
     ctccaactag cccagaatgg cttctattac cgaccttcag gagttagcaa tgtggcatgc    342720
     tgttttgcct gccaatcgac caagcactta tccaccttcc aatgcacccc gttcgaggaa    342780
     gtgcaacaac tacacgagga agactgcata tggcagataa tctcgtgcga tttgaaacac    342840
     cacctcggaa ctcctaacag acccccctcc cttaaccacc gcattctcct cccctaaacg    342900
     gtcaactcct accgccgatt ccagtacaca aactacagac gactccagta caaagactca    342960
     aactcaatcc acgccgatta catctactat agcgaaggaa cggttgaaca ctaacctaga    343020
     ctgccgttcc aatccgctac ccgccataat agacccagag cctcaacaac ctccaacagc    343080
     ccactctccc cagcctcatc aaacgatacc gtccatcact ttctcgcccc aaaaccaaca    343140
     aacaacgtat gcttccgtcc tccagcgacc tgtcacatct ataccgcaac cgactcctcc    343200
     agtgcaagaa ccttttcttc ccgccaaccc catactcaca attgaagatc ttcatcttcg    343260
     ttttcacaat aaaccgtcac cgttccatct cgagaataag acaagctaac gctcaatcaa    343320
     acgaactcgg aacaaaactg catctgtcac tcagtcactg tccagattct tagcctctgc    343380
     tttgcccgca ttctcgcggt tcctaacaga gatgcagcca aaaccggata cttcgtatcc    343440
     gtctcatccg caattccact atagccgcgc cataagggca gcctaacaat ggaaacggca    343500
     attggccacg ataggccgtg acgaggctct aagttcatgt cagaaagtgg atcaatctat    343560
     atgtacatac ccggatatat agtcgtcgta tactgcatat cgctttgcga ggggtcagtg    343620
     taaatgaata ctactactac tactactgct gctgctgctg ctgctgtatt gtgcggccca    343680
     tgcatggccg ttttttatag aatcacccga accacgacga ataccatgac ctttccgcaa    343740
     cctctgtacg atactccgta gtggtgtatg cacgtgactc tgctggcttg tagattgatt    343800
     ggctattgat ggcgagtttg tggcatccag cctcgcttct ctagataatt gggagataac    343860
     aagccaggcc acggatcctt tcctccatag aacatattac tgtagccaac gatgtagaga    343920
     agtgaatctg acaaatgaat acaaccactt cgaggggtac ggtataagtt cccgcgtaaa    343980
     gctaatggat cagagaaacc aatgtatgat tggggattgg gtactctggg tatctttctc    344040
     caccttggag tagcatggct gacgttcact tcatcataag ctcgtccttg gtgcagcgac    344100
     ctcatctgtt cgcatcctaa gggacgaaat caacccatag aagcttctgg agcattggtt    344160
     gtcatagtcg cagctgtatt ggccgttttc gattatgtac aactggaagc aaaccaataa    344220
     ggactttgtt gctttagggt ggagaaatga gtaactaaaa gccaattgta ttcctgctac    344280
     aataccatca tgccattggc cagctgttac tcctttctcc accttggggt aacgagctct    344340
     ccagacgtcg aaaaaagagc ggggctgtag gcttaacact taatactttt tccctcttct    344400
     cgtatttggt caggccatgc catgccagat tgatactcct ggtcgaaagg gccagcaagt    344460
     atcatgcaca aaaccggacc agtgggtata gtacccaggt ccgtttcagt caagaagttt    344520
     gtggcatttg attggagagt cctggcttcc tctacttgcc ggaccctcta gtctggccgg    344580
     accctctagt cttgctggac tccctagtct tgctggactc tagagactct tgctggactc    344640
     tctactcttg ctggactctc actgtaggct ataaatcatg tcgtgcccca gaaacaaggc    344700
     ccttcatagc catagatctt atgggctacc gtgcaaatta gctggcccgg caacagctgc    344760
     aatactttag aggacctagg cacgctatta gttgttgtca gggttataca tgaagtatac    344820
     aggatgaatg gagacttgaa ttacgggatc catattatgc atatgagttc cccttgaaca    344880
     cgaagaaggc tgtctctttt gcttcctcac gctacgtttt ggtatctaga gtcaactata    344940
     gttgttctta ctgtaatatc gattgttcat ctcgagacac tattcacctc tttacataca    345000
     tcagaccctc acaattgttc ctagaagtag taacccaagc tcccaggatg ccacctctcg    345060
     ctccccggag ctatatagtc cacccccggg agctgtagac cctctataat tcctactcct    345120
     gggagcaatc aatagcgttc ctgagaacca tgccatggat cctggggtcg aatatgatcc    345180
     tagaaacgtg agggtctcac aacataaaat gtgggatctg tgatcaatat taggaataca    345240
     aattgaaatg cgtgtaataa gtgtgggcaa tagaaagaag aggtgattaa ctgggcaaaa    345300
     atatcgtgta aagacaccgc ttgaagagga atgatgttga acgatatatt aatagaaacg    345360
     gttacttaag agttgactca acgacgattt ccacgacata tactgtatca gtagaataaa    345420
     cgaaacatca tcgactagcc gatgaatgga gaaaacatga gggtcaacgg gcaagcaaac    345480
     ttgtagctgg tgattaaacc gactatttgg ttgtcttaga aatctgagta cagcatggtc    345540
     gacaataaca aataaacgga ttcattcatt ttcttgttag acatagtgaa agaagtaggg    345600
     tgtttattga atattattgg ccagacagca gtctccactc taaaccacgc gcatttccta    345660
     atacccagac accccccaag tctacagcaa gaatttattt caccctgcta cccaagtaag    345720
     atgtcctctt ggcatgccca ctttcttgcc atattcccaa ggcctccgat ccaagtcccc    345780
     ttcctgtcct agtaccttgc ttacagtatt attttgtgaa aataaaaata aaataaaaat    345840
     agaataaaaa aggctctaaa ggccaaaacc tcaggctagc tacgctgtgt gcagttgacc    345900
     aaattttcca aagcagacat tcattgttta cggttggctc tcaaaatcag accaagactt    345960
     gatgcgttct tcggacacca ttaattgctt tgaaagaacc aagctccctc ccttttgtgc    346020
     taggcgttaa aatgggcgtg gcaataaatt tgttaggcac attttacgtt catcacctgt    346080
     tggagtgacc gtttcggagt tttgctggtc ataaactcgg aacccgcagt ttctggaacg    346140
     cggattcctc gatcgcctct aggtgtggtt ttcaacgcaa attcgttgcc tgctgtgaac    346200
     acatcacagt ttcaggtgtt cgttgttcat aaactctaaa gatcacggtt tctagagcat    346260
     cactcctttt caacgcgaaa tcccataaac atgaagaggg ccgttgtttt tgtacctttt    346320
     gtagccttaa gaatccctga gagccactta gtctatacct acgactattt agtgacctgt    346380
     ttccttcagt cttttccaac agtaacgcgt ctcttcatat ggcttccgca tctaccaccc    346440
     ggtccaatcg atctacatcg gtcagaaagt ccaagcgcca gaaacaaggc cgtcgaaaat    346500
     caagccttat gaaaaaagcg gccgaataca gcaagatgtg cgatgctgat gtctgtgtgg    346560
     gcatacgcct tcgggaaacc ggccaagtat ttatcttatc agcagatgct tcgggatttt    346620
     gggctttcct tggctcgcaa ctagtatgtc tccaactatg tctctgatga aaagtcgact    346680
     gacctatcaa gaactcctac tatccagccc cgagactagt aaccgagcag gatctggagc    346740
     tagttgataa agatacaccg gagcaacgta catgaagtca tggcagcact tccatcagac    346800
     tagaaacttt gcaattaatt cagcgactta aaactaccat ttatggcttt ttttctaata    346860
     gttcaagtta ctgagcgtaa agcacgataa gttgtggttc cgacgtggat tgattctcaa    346920
     tacgcaagag ttctctatac atagtaggtt ctgaagtcgg tcacagctac ttatcggccc    346980
     gaggaattaa gggaatctag atagcctatg tggtcggttt atcgcgcgtg tacaattcac    347040
     tgtcgtagag acaaggcgat ttctatatgt atgaataagc ccgtatatgc attgatggga    347100
     agctctcgtg aggtttgcag aaaaacttta cactgtgagc ttcagtaacg ttgcatggat    347160
     tctattaatt attatggaga actgttattg gccaacatag tacgagaagg cgggttggat    347220
     tgggggcctg ggaaatatgg cataaaagtg gacatgtcac ggacttgtct aagagaaaaa    347280
     ctaacttggg tagcagggtg aaataaattc ttgccgtaga cttggggggt gtctgggtat    347340
     taggaaatgc gcgtggttta gagtggagac tgctgtctgg ccaatagtat tcaataaaca    347400
     ccctacttct ttcactgcgc ttaacaagga catgagtgaa cgatttcgtt tatttcgacc    347460
     aggctgtact cagatttctg agacaactga ctagttggtt taatcacctg ctgcaagttt    347520
     gcttgcccgt tgacctcatg ttttctccat tcatcggcta gtcgatgatg ttccatttta    347580
     ttctactaat atatgtcgtg gaaatcgtcg ttgagtcaac tcaccaagta accgtttcat    347640
     tttaccgttc atcaacatca ttcctcttca aacggtgtct ttacacgata tttttgccca    347700
     gttaatcacc tcttctttct attgcccaca cttattacac gcatttcaat ttgtattcct    347760
     attgattact tattccggag cccacgtttt atgtcgcgag acctctcacg ttcctaggat    347820
     catattcgaa tccaggatct atggcatggt tcctaggaac gctattgatt gctcccagga    347880
     gtaggaatca tagttgtcaa ggatatagat gaagcatgcg gaacggatgg agatatgatc    347940
     cgcacgggac ccacatgatg tacatgggtt cccctgaacg cgaggaagct acctttcttt    348000
     tgcttcctcg cgctacgtct tgcatctaga gtcaactata gttgttctta atattgatta    348060
     ttcatcttga aacactatcc acctttatgt atacgtgaga ccctcacaat agttccctga    348120
     gacctccagc tcccgggggt gaactgtata gctccaggga acgaggggtg gtatcctagg    348180
     agcttggatc ctacttctag gaacaatcta tagcgtgcct aggagcatag aaactaggac    348240
     cagatatcat ctctaactga tccagacctc actgaatttt agatcaagaa ggcgaaccaa    348300
     acgccaccgc tgtatgaggc gcaggaatat atgtatttag ttttgagtct tgtctagaaa    348360
     tatgaagtcc gacttatgac ctttgtacga acatgagcta tgtagttaca ggagaaacgt    348420
     ctcaggacag tttaccaccc gagaggcatc tcttaattca gcatatgtaa tgtagaaaga    348480
     attttatgtg tttcactata agaaggcgat cacgacaata ctatcccaag aatcatgata    348540
     acttgaaaag aaggtattaa gagccttgtt ttaagagcgg gatcctcttg tgacgatcct    348600
     cttgagagca atacgttcac gtgagatatt accgaagagc acaagcctta caagaggcta    348660
     tacgtcatag ttccaccaag tattctaatc caatcaaagg agcctccacg ttataataat    348720
     ccatatatca tattcggccc cttgtaaggt ctagcctacg aaattcgtct tccctgccta    348780
     ttaccattgc ttatagactg gtcgtacaat gacccagtca tacaagagtt tgtatttatt    348840
     ccgccaagat aatatagcta ctccaaggtg gggaaaggag tagcgatgaa ccaatcaaat    348900
     aagttcggcc agatttatct ttaaaccaca tgtttcctga gtcacaaaat ttcacagccc    348960
     tcgcgaatta ttgttgtagt cttttttgag ctctgtttca gcgctacgcg gagattctcg    349020
     agaagttgga cgagcaaagc accatcttgc tggacacaat cctgcatttg taaaatagtt    349080
     tccggcgatc gtcaccatct tccttcattc ttcacgttct cgatccgatg tccaatagaa    349140
     atccggttag cctactgagc atggttctct acgacgctgt tgcagcctcc tataagacgt    349200
     caatcaagtg tagccgaagg ctgcatataa ggggcagacc aaaatgcaag agagtggaca    349260
     tggatggatt ttgccaggct gttataattc tttctttctt tgttctattt gcatggaaaa    349320
     tttggatgta ttttacacaa tattacggta ttataacaaa ggctcattgt cgctaccagc    349380
     gaatgcgaga cagccctacg gtgattatca gtgggttaaa attagattcg cgtttctcga    349440
     gtcagttttg ggaataaatc gcaagtgtag gaagtactgt atttcggggt aggcggggaa    349500
     gattgtgaat tatgttgtca tggttccacc tcttgggact gagagacgta attatcgtgg    349560
     tactggctgc cgcttatatc tacgcgatca aaagccctag aggtctgtca gcgaagtggg    349620
     tggggtgcta ccagcagtga ttagacacgc ccaataatat agcgacgaaa gggagtaaag    349680
     ccatgggaag cataaaaatg aaccatattg gcctgccggg ttacttcctc tacagcagta    349740
     gcagagtctc cgacatgaaa gagatgtaga ctggccgggg aagaaaagga aaaaaggaag    349800
     atggcttaga tcaagctaga tttccggatc tccccaccta tttaaatatc ttctagaaca    349860
     ttcgaaggta atttacaata accgattaga caggaaagcc tgacacgttc atccgagaaa    349920
     ctctagcaac gggaaaggaa aatatcgttg gagattattc ttggcagctt tggggtagct    349980
     aaacatggtc tcaagggcag catgggtgtt ggaccagaat ctcagatatc gggataggag    350040
     ggacttacca gagagtaggg acttaccaga gagtagggac acactggaga gtagccttca    350100
     gggcgcaaag cgaggctcgc tgaaatcaaa aatagtgact ctcgtttcat cgaagggttc    350160
     tgtggaggct gtacacttgt ggggaagaca tcgaaatgta taattcagat tgttgattgt    350220
     cgaaaaagct aatactgaag aaagctatgt aatacggagg aactccaata tccttgctaa    350280
     cacatgttac ctagggcaga ttgtataagg atgatatccc gtacgcgttc cggcagggat    350340
     acatggttcg agataggtgg agcattgagc cgcgaagcag ccattctgat cgagaacgcc    350400
     ctgcaatatt agctgatttc ggatgtataa gcggacagtc tttgtgctta cagaaaagaa    350460
     gggccgcttg atataccctg gtctctgctt gataaatcac tacgtcagtc attaagccta    350520
     tgaaaaaata ataatagacc cactcatata cgggagtctt caatcatgga acgcgaaaag    350580
     accacgatat tcaaagtact acacgaaaat cggtcctttg tgtgttgaac ctataaaggc    350640
     agaccccgca taaatggaag ggcaacaatt actggtgtta tttgcggtca tcaaataggt    350700
     gcggtaacgt gaaacgaccg tacttgtaac gttattgaca tattgcccgc tatacctttt    350760
     acgtgtctgc aacgtcacta cagcatactt tcagcactag caaatccttg aaccgtcggg    350820
     catcatgttg atacacgata aaatataacg gttaggagtt gaccgaatca ttgataccct    350880
     actaaaagtt aaaaggtcaa ccaacgggca agagaagatt tgcaaaacaa ttgattgtca    350940
     cagaaatctg actacaaaaa gaataaaaaa ccaattaact catttatctt tcaataaacg    351000
     tggtgaaaga aataaggtgt ttattatgta tgattggcta gggaacatac tccactcatc    351060
     aagtgaattt cctaataccc aggcaacccc ccaaagtctg gtgtaagaat tatttcatcc    351120
     taccaaccta gaaaaaatcc tccatagcat gccaactttt atgccagatt ccacaggcat    351180
     caaatccaag ccagtagttc cccctacagt acggaagggg gctgagattt gaggtagagt    351240
     gccgcttggc taataatatt caatgattag gccttctttc tgttgccgct cttattgccc    351300
     gcgttctaaa atttgtattt ctaaaattgg ttatagctat gtattctaga cccccttact    351360
     aggactctca ttcctaggat ctatagtatg gttcctaggc acgctcttgg tcgctcctag    351420
     ggatcagact tagagttgct cgaggacacg aggtgtttct gggatcactt gatccgtgcc    351480
     taggagcgcg tctggcgttc ctgggctgtg gttggttccg gggaactcga tcggcattcc    351540
     cgggagcccc acatcttgtt cctagggttc atgggtccaa gtcctgtcag gtcgtacgac    351600
     catggcccat gatcctggcg agccctctgg ctgccaactg gcgtccctcc tagtcccagg    351660
     cctggagatg tgcgtccgtg gttagggagc tgcgaccgca aggccttggt tctaggcccc    351720
     gtgatccaga acagttgact caaggcgaat taccgacagc cgtggacgca ggtccacatt    351780
     ggacgtacgt ccacggctcc taatctaggt gggttttgta actgtcaact ggcggccacc    351840
     ctggcttagt gaccataagg gtcctcggtc ttctgactac ggtttatatg ggtcacaggg    351900
     tagtgagtcc ctattctcca gtgtgtccct acgtaaatca ccttctcttt gcaagttcct    351960
     ggaaagacgt gaattattcc tagctatcaa ggaaatacat gaagcataca gggtgaatca    352020
     agatatgatc cgcgggaccc acatggtggg gttcccctga acgcgagaag catatctcgt    352080
     ttgctttctc gagctacgtc ttctatctag agtccactat agttgttctt tatatctatg    352140
     tatacgtgag accctcacac tagatgtgac cgtttatgga tgcttgggtt ttaccactac    352200
     gccatctggc caaaaggcac aatgtttggt cagcgaccaa acacccaagc tactcgatct    352260
     ctgacaccca cctctgggaa tcatttgtta attctgggga gccctcgtga tcccaggaat    352320
     cgtactcagg ggattaggaa cggatgtaaa aagtgtgggt gaccccactg atccaccggc    352380
     accgatcttg ctaaacgcta aagtccaggg aacacactct agttcttggg ggctatacag    352440
     tccattccca ggagcggtag gtcctctggg tatgtcaagg atatacatta agcagtccat    352500
     ttcactgtgc gcattttctt tgttaccaca ttcacatttg acatgcgttg atcgagactt    352560
     tcgaaggcct cggcaatgcg cgcattgcga gactgggcgc cctttctttt tgatatgcag    352620
     caggggatta tctgcctcgt atcagcctcg gaccatacac agtggacgaa aagcggaagc    352680
     cgagagtgac gtaccgctgt gctggcagct gtttgcacga tcgcctcgaa cacaggccct    352740
     gcacgcccac ttctctcctt gaatcagcat cgccgattca ctgggacaac aatatccaaa    352800
     taggcaaacg aggaacagag ggatcgtagg agttaacaat atgggaagta aaacagagag    352860
     ttgtaaagca gtggcaaaga caggatgaat tggatggttt ttaagatgga tggaggtcat    352920
     cggcggctga agaaccggtg gagacgatgt ggtaaagttc caatggcgta atgaagcacc    352980
     agccaccagc caattgtggc gatacaagga tgggacaggg agggcatgga catggggcac    353040
     gcaattatct gcatgacttc gcggtggacc tatcatatta ttgtttccct tgctatcttg    353100
     catgcttgcc acgcgtcgcg ctcctcacac cgtccgtttg ctagttatct atggcctcga    353160
     tcacacttgt tgagtgtgat aagaatccaa gagcaaccca taactaggta gctagcttag    353220
     ggagattcca ggacctgatc tacagctcat cattttcagt ggacatgagt tttgccaagc    353280
     aagatgatta caccaccatt acctaaagca cagacccatt tttatgattt tactgcacta    353340
     aatacctatc caggttgagc gcccatggaa cacgggcaag tctcgcgaac ctggttgtgt    353400
     gtgaactcct ccagaccaac caactcagcg accgtgtaaa gactcggtaa caaggagcct    353460
     agaaggacag gctttctaga cggcggtgct tgggcttcat gtcattgggt acgagatagc    353520
     cggttgcggc tgcagcgtga aatacggaga aattattggc cacttatcac cctagcatcg    353580
     ctggccccat cagtaaactc ggcttcgtat tgatcgacac gccacaacca atgaaaacca    353640
     agcgatccta atagtatctc attatctcat tattgatgat ttgcacgtga cccacgcaat    353700
     ttcgtgactc tcggtggcac ctgtgtatga acagccactc aagtagtttg actatcgccg    353760
     gggtcataac agccaatcca ggttgtccaa ctacgccttt caggtcttct ttcgtgactt    353820
     tagcaagaac ccgttcaagt gtgcattaaa cgccaaggtc caagttccac agtctaaagc    353880
     caaagcaaaa gtaaaaaaaa agtctgtttt cgaggaactc aatcatccga tctgaaaccg    353940
     accagtggca gtcgagcctt catcaaaaga ctgctggata cgacactgac actgctcaat    354000
     gccatcgcga ggctggacca gactggatcc aaccggacat ggctgccgtt gctgacgatt    354060
     gggtaaaaca ctcccgcagc gactggcacg gcaatgcagt tgtaaaccag cgcccagacg    354120
     aagttaaact tgatccggcg gaaaacgacg cggcttagat cgatgagcgt caggagagaa    354180
     gagagacgag aagacacgag gacaaactct gcagccgaga tcgcaatgtc cgaccctgaa    354240
     ccaattgcaa tgccgacgtc ggccgcggtt agcgcaggcg aatcgttaac cccatcacca    354300
     accatcgcga caagtgcccg ggcggagcct gtttccttct gtagggtgtt ctggagatat    354360
     cgaatctttt ctgccttttg ctcgggcaga ataccggcaa ggatgttctc tggcgggatt    354420
     ccgaccatgc tgcccaccgc atgcgcggtc gtcgggttat ctcctgatat catccacacc    354480
     gcgatacccc gatcctggat agccttgatg gtccccttgg cctcgatccg gatggggtcg    354540
     gctactgcca acatgatgga gagcttccag gggactattt cggtggctga ttgctccggg    354600
     cggattctgt gccctaccag gaccacagac ttggcctggc gcttccaggc gctcaatttt    354660
     tcggcactgg ccgaagggat gacgattccg tgatcttgca tcaaggcctc attgcccacg    354720
     atgacttcca ggacagatga gacccgattg cgagcgccga atgagccttt catacccttt    354780
     cctggtattt catccaccat aatcgctttg aggaccggtg ctagcttgga ggcggcaaaa    354840
     atcacaaccg ccttagcaat cgggtgattg ctgttctgtt cgagctccat aacggcgccc    354900
     caaagatcat cgacgcctgc gctatgtgtt acctcatgat cagtgataga aggttcgccg    354960
     cccttggtaa tggtgccggt cttatcgaag acgatgcagt caagctggct ggcctcctgg    355020
     aaggcttcac ccccaccttt gacgaggatc ccatgctgag ccgcgagacc accaccgaca    355080
     aaaagggccg tcggcgctgc gagtccgata ccacaggggc acgcgacaac aaaaactgag    355140
     atggcgaatt gcaacgacca gaaaccccag cctcccggag tgttggcctt ccaggagtcg    355200
     ggcaaccggc tggagacacc aaggcctagc caaatcaccc agtccaacac cgcgatgagg    355260
     gtgatgacgg gaacaaaaaa ccccgtaatc aagtctgccg tgcgctcgat tggcgctcga    355320
     cggacctgcc cctggcgaac ggtgttgatg atctgatcca acatcgagtc gcctgaaaga    355380
     tgggtgacac ggaccaagac cgggtttgcc tggttgactg ttcccgaaaa aacttcgtct    355440
     ccaatggact tggagaccgg tcttgattcc ccagtcagac tcgactcatc aaactgtgac    355500
     tctccgttga tcaccgttcc gtcatacgga ggtgaggcac ctttcgccac ccgcaccaca    355560
     tctccgaact ccagttggtc gattggaact gtgctggaat tcgcagaggc ggagaggcta    355620
     cccgctccgg ccgtgtccac aagtgtggcc tctgtcgggc gcagcttgcc caggaggcta    355680
     actgcatttc ccgctttggc tttgctgtag gcctcgagca accggccgat cagtaggaac    355740
     atggtcaaaa aaacaaccgc atcgaagtac gagccggtat gagaagcttt ggggctaccg    355800
     tgtggctgcg aggcattgat ggccaggata gcgatggagg agaagtaggc gatgctagtg    355860
     cccagtgaca taagcatatc catacttcca aagcgataga atctacgcaa gataggagtt    355920
     ttgcttccgg gtcgccagag cgccttgagc tcggtgagca tgcggcggtg gaaaatgtct    355980
     gcagcgaaga aatagacagg actcgacgtg atgaagagcg cccactcaga gcgtgatgct    356040
     tcacctgacc acataggctc ctcgaggtaa atccgaccgg gattgtcgtt gttgaccagg    356100
     gacatataca ccacaccgat gataaaagtc gggatggcag ctagcacggc caaaatcaac    356160
     cggcgagcga tatgccattg atgccggcga tgcatcgcct gagagcgttc ctcaaggctc    356220
     ggagggtggt acactgaaac ggtaaaggct ttatcgatat cggcaatcgt gctcatgata    356280
     tgtcggatgg taaattttgg cgcctcaggc agatagctca cagtaatctt cggctgtgtc    356340
     ttgctaggag gcgcggtcac ttttaatctg tccgagtaga cggcgagggc atcgagaatc    356400
     cgctgtggac agcgtggaca gtgcatcccc tccacctgga tggtcaccga ccgcttcgag    356460
     ctgggttgac tagatgtggc tctgctctcg acgtcgccga gggtggccgt gtaaccaagg    356520
     ctgttgataa tgccaggaat ctcgtccagg tggtccttcc cttggaactc caccatcgca    356580
     ctagcggaga tgaggttcac atccactgtg gtgatccacc cgtactgttt cagcgtgtcg    356640
     gtcactttcc cgacgcagga gctacaggtc atgccttgga tgacgtacga agctcgccac    356700
     gtgtcttcca gtccggacgc actcgatggc tgctggagtc ggatctcctc acattcgatc    356760
     aactccgtgg tataacccgt ttccctaacc gtctcgagca actcatctat gtgcgactta    356820
     tccaggagca tgacaacggc actgttcgtc aagagattga cgtcggccga ttgtacccac    356880
     ggtcgagttt gcaagacccc ggtgatcttg ctcacacagg agctgcatga catcccactg    356940
     acggacaatg tgactcgcgc ccgagtgtcg atgaggtggt catccataac ggacacgagc    357000
     gcttcttctt ttgtctgacc gacgtgtcga ccgagctgat cttttttgtc ggcgactgct    357060
     tccttgtgaa cggtagagga cgtcttcgac gacagcatat cgagctgtgc ggaacatgcg    357120
     tcgcattttg agaggtgcaa ttcggactga gcaaggacgt cgtgttcgag ctcgccacgg    357180
     gagcttcttc tttgagcttc tgcggcgttg gcctcgatat caccctcgct ggcatcggga    357240
     ataacactgt caacctcgaa ggcaacatcc tctagagcgc gtacgatgcg gtcggcgcta    357300
     agcgtaacgg agtgcacgat ttcgatctca tgtcgaagaa tagatgtcga aatggaaaaa    357360
     ggaggcggct ttagagctga aagagtctcc tcgacgtttg tcacgcacga cgggcagtgc    357420
     aaattgttga ctaagatggt ggtcagcctc gactgaggca gcgacaactt atcactcgga    357480
     gccatctccg gcggatagac gagagtgtga gagagaccaa agatacataa ggtggttgtc    357540
     cgatctgcgg agaacagcta gcttttatag atctcgagcc ttggttcagg attggacagg    357600
     gtgactgatt tcgaacgttc tagggtctgc aaatgtatta caacttccac cacgctaccg    357660
     cactaatcgc gcatgttcct aggttcgcca ctgcttgcca gagatgacag gtgctgattc    357720
     gagatccatg aagagttgga tgcgttattt gtgcggctga gccaacggcg ggaagaaagc    357780
     taaatcgagg cgccacttca ccacgatctt accttaaagc ggggggcaac gcatacagaa    357840
     aaaggtaata tggcgaaaat aacgcacttc aggccatagt aaaaaaagac atatcatgaa    357900
     acctcaaaat taaaattacc atctcatttt tagtattcaa tatgtcgtgt caaagttgtg    357960
     atttccctga cgacaaaagt ctctccgcac gcgccttttg attaacttcg acagttatac    358020
     ccaggtctgc ttattgtcca gttcgtgttg ttggttacac cagtatgctc attcatttgt    358080
     catggacgct taccaatgta taccttgata ccgtccctga ttttgttgtc tttgctggcg    358140
     cagtcactgc agctagcata ctgatattgc acttttttag ttttagtttt atttttattt    358200
     ttattttggc cgtctcgatc ttgatcctcg cgtggagcac ccggcgagaa ggcttcagtc    358260
     gtaaaaatat ccgccggccg atggtctgtg ctttttgcgc aatatcacca acgggttcag    358320
     tcttccgata aagcgccata gctgccactg gtttactccg ttggcttcct acgaacgact    358380
     cgagccgaaa tagaggtgga tatgagcatc cttgagagca tccaattccg ttctaggagc    358440
     ttgcagcgat catccaggag ccaagatgat gtatagatca ttgccaaaga acatacgcaa    358500
     tgattggtcc cacctagctt atgtgggttt tcctaggcgc ctgagcgcct ttgcattcct    358560
     cgcgatgtgt tttgtcttgt atctagtatc tagaagcccc tagcgacacc ttggtgatta    358620
     tctttatcca aggacatgct ccgaacttcg atatttcact taccctacgt tcagggtgcg    358680
     tcaatcaatc tctgccccca aaaagagcca ggtatacaat gagagaggac gtacatcaaa    358740
     tttcttcctt tagttgggag tgcaaacagt gactgaaatg ggagcgtcac aatttcatcg    358800
     acttgtctgt gccacaataa ctgaaacatc acctaaaata ccgctctcct gaatagggga    358860
     catattcaca gtgtactctt cacagttgag gttcgccata tcaaactgat tatgagtccg    358920
     agtccatgga ccattccaat acagcgagac tatttgaccg tcgatatcgt ggtataaatc    358980
     caaagtgcct tcgaccccca ctctgtaagt tgcgctgcca cagaatgata ttgttctgtt    359040
     ctcatcatgt ggaatcatta tttgattcac gtcttcggga gacaaaagct tagcgatatc    359100
     gcttttttcg tacggttgac cacttcccga gtaaagttag tccaatttca gtctctgaat    359160
     ggtaatattt ctcaaatacc aggctatgac ggtgttcttg atgacaatgt tgcccttagg    359220
     aagatcgttc tggacgctga tggaaagacg ctgtgtgaca tgatgttcca tcttcgagga    359280
     tttgaactaa tactctcatg tagagtgtac ttgtcaaaat agaaactcgc aataagaaaa    359340
     agtttcagaa ctaatataca cgtccgagtg cctttcgcca cctggcacgt tgggttctgg    359400
     gctgtctctg ctttctgcgt tacgcgtaag agacatcaat attccaagga acttaaaaga    359460
     ccaggccaac cgttctgaag gccaagcatc catatccaat gcgatcgtta actttttgac    359520
     aattcgattg cgggcccact tcggtcattt gaccaatcca cattctccta tgcgcgatta    359580
     gtgcgtaaaa ttatgtcata gtttaccaac aggccaactt tgcgccatgt ccctgacatc    359640
     gagcagtgcc aagaccgcgc taaaatccgc gaaaatatcg cagtctcgtg gctgtacgga    359700
     ggtgacggat ataataatgg cgacgttttc gcccccacaa gggattaaag cgtgcctttc    359760
     tacagtagct cctccttatc tgccaaagat gtccgtttgc cggacttcgt acgccatttg    359820
     gcttgcactt tgttactttg tgtctcattc aaatgctatt ctccgtacat acaacttgac    359880
     ggtgcataat gacgttaaag ctccgggtac gtggaccatg agcgccaaac atgggacttt    359940
     cagagctaat tcctaaatag atggtgtcag ccgcgaagtc tttctgatca atggtcagct    360000
     accggggccc ctaatcgagg cagacgaagg cgacgatctg gaaatctttg tcaagaacga    360060
     cctccccgtt gatacttctc ttcactggca cggtaagtca cttccatgag gaaacatttt    360120
     ttttattaga accagtgatc actgattgtg ccataacagg gattttgcaa aggggtagtc    360180
     ccgatatgga tggagtgcct ggtgtcacgc aggtcagtcc ttaaatattt gacggtaatt    360240
     tacatccttg ttgctgattc tagaccatag tatcccatac ctcctggcgg taacttcacc    360300
     tacagattct cgatcaaaga tcagtatggc ttcttctggt atcattccca cgttagagca    360360
     tactacaatg acggcataag agggccactc ttgatacgac catctcccca aagactgcgg    360420
     ccatttgaaa agcttgctca tagcccacac gagcgtgata tcattctgca gacggagagg    360480
     gacgctacat ccattctttt gagtgactgg acacatgaac tttcggacac catttacgct    360540
     cgatactttg agacaggcgc ttttccaaat tgcgtcgaca gcatccttgc caatggattc    360600
     gggagggttg agtgtttacc ggagtatatg ctccaggcag gacccaatat gggatatgaa    360660
     gatatgaacc agcgttcttc atcaatgatg gcaatgtcaa tggcgaaacg aatggacatg    360720
     gacatggaca tgagcacgga cgcatccgcc acatcttctc agatgtcaac aggtacgatg    360780
     gctatggata cgaccgtgga tatgactatg tctagcactt ctatgtccgc aatgccgatg    360840
     tcagctacaa tgacgatgtc ggacatgtca ccgtccatga cttcattgag tccccgtggc    360900
     tgtatgccgc caatgatgtt taggcaaggc tacaatgtca gttcactccc acctgagacc    360960
     tgcaccaata cttcgtcgtc cttgctcacc atccctgcgg atcacacgag tggttggctc    361020
     gcgctgaatc tggtcaactc cggtgcagtc agcaagttac atgtctctct ggatgcacac    361080
     tctatgtttg tctatgctgc cgacggattg tatgtggaaa tacaggaggt gaaggtgagc    361140
     atacctttga agagtatccg ttatatcccc cagcctgggc tcaccacatg tcattttagg    361200
     tcctggaaat agagatcggc caacggtact cagtgatgat tcgacttgat cagaaaccgg    361260
     ggaattacta tctcagattc gcatcatacc ccaatggtga catgcaacaa gtgcttgaag    361320
     ggcaagctat tgtgtcctat aacgtaagaa aatcggcaag caagtcgcga ccatatcatg    361380
     cccgtgctga cttttcgttt tcattttgca gatgagcatg atgagcagca gaaccccaat    361440
     gaacgtcacg gtcgatccct caaccatttg gatgttgacc aacggatcag ccaaacctga    361500
     taccagcgta cttaatcctc agttgctttc tcccttcgcg cctgtcaacc ctccctcagc    361560
     accagcagat cagacataca ctttcacaat taatcagacc gacattgtga catgggtagt    361620
     gaatgacgcc tcatactctg agccaaaaat accaatcatc cagggcaacg tatcagacgg    361680
     ttggcaggcg aatacaacca tccatgtgcc gtctaactca acgattgata ttattatgag    361740
     aattgcaaac gattcgatgg atacggtaag tctgttggat tagtgattcc aacgaccttt    361800
     ctatgatgtg gacagctgga actaatgggg gataaactca ccgcagatga gccatcccat    361860
     gcacctacac ggccacactt tctgggtgct tgggtccggt accggctctt tcccgtatga    361920
     ttccgcgacg gacgccccag aatccctaat aaatcttcga aatcctcctt atcgtgacac    361980
     aactaatctt cctccgtcag gatgggccgt gatccggtaa atcacctgaa tattctactg    362040
     gcaagacaat agcttacctt ttcttaaaaa cagatatgtt acggataatc ccggcgcgtg    362100
     gatctttcac tgccatatcc agtggcacat ggtggtgagt acaaatggct agacggtcgt    362160
     atcctaaata atcgcaaaaa tcttggtctt gctaacatta cattattttc cttcacaaga    362220
     gcggcatggc acttgtcctt gttgaaggac cggatcaatt tcccgccctg attggtcagt    362280
     ctaataatgg tacccctcct gctacgtcag cggcgccgat gcgtcgtatc agctctcgtc    362340
     agactgcttt gactgctgct gctgccagtc tcatgatgtt gggatgagtc cggaatatta    362400
     gatacagcag aatctctttt ttgtcgatat tttaagttga gcggtgcgag aatcggccag    362460
     ttaccttcct tcaagtatgc aaggtacgtg ggttttgcca tcgagctgct agtatctggc    362520
     ggtttttctt agtgcgttat cgcagtagat tatgctgttt atatgttggt gtcacaatct    362580
     gaaaacatct gaaaacagtc aaacacgcag ggcctgaatc gtactataag atcactggtc    362640
     tacataaagt gggctagttt acagagacct cgatgtggga cttcgacgaa attgttcatg    362700
     tttaactcct ctgcgagtta ggttctgatc gagagtttcc atggactggc tctttggccg    362760
     tagtgatcaa tagaggggta aaaacagaac cagccgaaga aacgatcatg accatcgaca    362820
     atactcctcg agtctcaagg tagaatggca ccacaaatta aaagcttggc acccaaatca    362880
     aaaacccatc gtccaagtca tgtccctcat gtctcgaaga ggccttcaaa ggctagtaca    362940
     gcttgttttg gatgtcgaag acggaaagcc aaagtaggta ccatttcccc agatggagag    363000
     tatgactcac agcccctcca aaaaaatagt tctatggagg gataccctgc gtgtcgtgca    363060
     accgagagtg tgcgccttgt attatgaacg aagagagcga tggtcggcga aaactctcgt    363120
     acaaacgaag aattgcttca ctagaacatg accgcgcttt gcttatgcgc ttgatggaaa    363180
     gtcttcgcac ccatgatcaa tcggaagccg acagaattgt cagagcaatc cgcaacgggg    363240
     catcgttagc tgagatggat ttggttctca ctgcaggctc tggattgtgc gaacctcgac    363300
     gaacgctaga attcaaggtc ggcaatttag acacacggga atcggaaagt gggacatcag    363360
     gcgcgcgcca gacttatttg gatctaaatc agctatgtgt gtagcagtca cgttatgcga    363420
     tatgccgacg tatcatctat agacccggtt tcatgcagta ttcgtaaggt aattgcgaca    363480
     gtatgaataa gcccgtaggt gaacaactac gtctcaggca acgacaggag cctgagtggt    363540
     agctgggtta ggcataagct cgattagtca acgtattgat aaaatgtaat tggctgcaag    363600
     tgatcaacga gaatttcgag cgaggtggtt aacgcaacaa tagcacgtga cagaacaaaa    363660
     acgtcataga cctttggtcg ggggattcat aagaattgca gttcaggtag acaaccatcg    363720
     agtaattgga aagtccttct gagaacactg gactacctct taaaatgcaa tcagggggca    363780
     aggaaccata tcctgaagta gggcctttcc acacccaccc aaccctggag caaagacgct    363840
     aataatattc cctcagccat tgtcggaaag tgagaaacgt cacttgagca agtacggaaa    363900
     acggccgcgt ggaggcttac tgggtgaaaa gtccaaggta cttaaaatgt gatttattgt    363960
     gagtgtgctg acaatcggaa ggaacggacg tactttgact ccggcgactt tgctttttcc    364020
     gccgctcatc gagtgaccga tctcgacgct attcaaacag gcagagcgca tccccaccgg    364080
     gacaatattt cgcacccttc ttccactatc ccggctacca gcaacgttga caagaaagcc    364140
     aacgaggata tgcataggag ggaaccaagt cccaaaagaa gtcttctcca taggcaaacg    364200
     aatgaagacc ccacagacga ggataatctc ttctctttcg aagattgaaa ccaaatcgtc    364260
     acagcaatat aaatcgatat gtggttcagc agaacagcca aatagggaca atacgacaat    364320
     tcctaggtga aagcttattg tggagaaaga agagccagtc gaccaatgat acaacccctg    364380
     ggagctgtag gtcctatgga aattctccaa gtataggctt gcgacgatca aagatattgc    364440
     aagcctcttg attggattgt gtgttttgca gggtcatgtt atgctactcc aaggtggaga    364500
     aaggagtgag agagaaccaa tcacccatta tgttgccacc cgcaacaaac tagctcattt    364560
     gcacggtcgc ccataggatc cgtggctatg aagcacattg ttttctgggg cacgacgtga    364620
     gatatgactt tcgcatgctg ggtgctaccc actggcccgt ttcagtaacg aagtttgcgg    364680
     catttgattg gggagtcctt gcttgactcc ctagtcctgg accgcctagt cgtgctcgac    364740
     actccctgcc ctctttcctt ggaagccata ttttcttact acagtacaat tatgacttct    364800
     tttttttccc ttattattgg tcgcaaaaat ccacctagtc atgatctttt ccaaatacta    364860
     ttgaatggaa aactcggctt ccatcggaat ccgcatgttc cctgatgatc ctctaggttc    364920
     tcacatttgt agacccatag attatccatt agtcactatg attatctgac gttccagaga    364980
     gaaatcaagc taccttctaa cgtgctgatg gaaacccggt cggaacaatc gcggggtcga    365040
     agccagcgcg ggttcgtaat agattcggca acgaggaaat gcacacttgc atgtacgctt    365100
     agtcgactgt ggcgtcacat agccggagaa taagtattcc agaggagaag aataggatga    365160
     atactgttct atgccaaaac cattgtggca tcttgttcgc acggctacgg ctgaaggtca    365220
     ccgtagacat catacctagc aaacggaaat gcaacctatt taaagtgtat gaggagaaaa    365280
     atatgtaaag aatttcattg ctaataatca ttgggtacca tcctcatcta ctccctttca    365340
     gtcataagag ctatcagcat tgctgaagcc ttttccacag cttaacagtt atcccttggt    365400
     tgaatttcca cctaaaaaag acttcccagt agagatggct ttggtaatat tgctcgagag    365460
     aaactggaag gccttaaaaa aacttatcgg tcttaaagtt gtgtcagaaa agataggatt    365520
     taccaaccaa ccgagcctca tgacgatgga aggaacagtg atgctgttca tgcatgcaag    365580
     cgcagggtaa ttttgtgatg tgtactcgag tatgtggctt tggagtacgt gagtcatggc    365640
     atgcagatgt gaaatagtca agctagcacg tgtcgtccag gctatggccg catcactgag    365700
     actgctacaa gctctgaaat ctctgttcct agaccaccga agactgtttc acaatgtaga    365760
     aaagagatta gccgcggagg agggcggcaa ggaccatcac cgaattgaag gcgactgcgg    365820
     ggacccacta cttacagcac agctgataag ccaatgaaat cgatattcac tgaggcagcg    365880
     tgactgtctt ggctgagaac cccctggtcg cctctagact gtctcaaggt ctaggcttag    365940
     aatgattgga ctaggaaata ctacgaagag ccagctcata tagcgtgtag cgcgggagcg    366000
     gagagactag gactggggtg ttcggccacg actaaagagt agtgcaggac tagcaaggac    366060
     cactcgccaa ttaaataccg caaactttgt gattgaaatg gaccagtggg cagctgcctg    366120
     tcctgacgac tgcgacgcac tcggttctaa ccgctgtgga aaaaggtcta ttcatcgtac    366180
     cttggaagta aacacatgga tttttgtagc atatatttgc attacaggac aaaagataac    366240
     atgtaattat tcatgaattg tcactggctg gacttctttg ctcgtatttc tttgtctgga    366300
     acggaacgca tctaagattc cttgaaaaag caaagggagc cccaacagca gaccattagt    366360
     tagtagcaga ttcgagaaag cctcttttgg catttgcagg tgacgaatgc aaatggtatt    366420
     gttcttgttg agcagctgcg cgaacaatag gatcaaatgg catgatgtgc ttggcggctt    366480
     tgacggagac tcgccacgag atgcacggct ccgtcgcatt gtcaccatgg aatgcctccc    366540
     agcgaaggca cacgtttgcg ttaccgcctg gttcagatac ctgcatctga ttcagcgccc    366600
     cagtgacctg agaatagtca agccacaaat tctcagcggg accagagata ccgtgggtga    366660
     cattgaaatc ctccgacaaa cggatggtgc cagcaaatat acctaggaag tctccctcgc    366720
     atatcggcac aatagaagag acgaatagag tctcgtcatc cttgggcaga agagtgatga    366780
     atgcggactt gtctgaccca ccttcgtata ccgattcatc accgtgtggt atgccaagaa    366840
     tatcagtcga gatagacttt gagctgcgtt gcctgaatat ttcttcttca gcgttgacgg    366900
     cccactcgtt tgaagcatta ttccacgagg gctctggcac tttcagtcgt tctagcactt    366960
     gaaggttgct gaggtagcta agacgcttcg agtctcctgt tttcaatttg gtaatccgca    367020
     tttccaattg ttcgatatga gatcgatact cgttttccca tctcaaaact ttatccacga    367080
     gtggagtttc cgatgtcttg gaatagcccc tgcagaaact gtcgaattct tttgtacggt    367140
     agaggagaat tttgtcaacg ccagcctcac gcatatcgaa tatgtttttc cagaaaatgc    367200
     ggtactgtcg ctggttttct gcacccacgc tatacccagt gtcctccatg aatttctttg    367260
     tggcagcttt ttccgtcatg gtgaatccat cagccgggcc cttggcgggt ggcagcgtgg    367320
     cagggtcgat cagcgccgcg cacttgagaa tgattggcca gaagatagtt tcgttgtatc    367380
     ttgtctgtat tgctctgccc gtagttagag cagtgtccct tcgaatggcg tgaattgcct    367440
     gctcataatt gtatcgagag acatctttga catgctcccg catcctctcg agcctagttg    367500
     ttgccagggc catgcagtcg cgctgcccat attgtgcgat atcagagttg catttgacac    367560
     attgcatcaa tattgttgtt atgaccttca tctcgaaggc tgagtctagg tgtaatggca    367620
     aagagctgtc acggggattc ggcacacacg aagattcggc gtcgtcgact tcggactaga    367680
     catgaactat gtatccatta gacttccttc aatctggagg acaaaataac ataccgttgt    367740
     ttgtatttct ggcgaaattg attcctcatc agctactgac gctccgggag gttgatctat    367800
     caactccgac ttgtcgcttc ttttcctctt ctttttcttc ttttccgtgc tggccatatc    367860
     gctgtaggtt gttggaccgt cctttcctgt ctgtttcata agtcgatagg acccgcgagt    367920
     ttcatgtggt ggagtcggag gggtttctat agtcgcttcc ttagcctgag aaataggctc    367980
     ggtcgcacct ccagcaatca cgagtcgagc tttgtaaact aaagcgaccg ttaatgatcc    368040
     tttctctcag acgttggcgg gggctaactc accatgatcg gcagcgtggg cgataaccag    368100
     attaaggtgc tcctcactgt cctcaattcc gcaaattgtg aatagctctc gtatcttctg    368160
     ggctgtcagg ctcaaaatgg ctttatccat ggcgggcgat gatgatggca aaagactaag    368220
     actacgtctt gtcaatgaag gcagaaaccc ttctggaacg ttcggggcaa cggttgccct    368280
     ctggctgggg ggagggaaga atgagccaat caaatcaacc acaggcgagg ctcacaaaaa    368340
     tagcatcaac caggccaggc aagacttgac cgggattgac cccctctttt tgttgtgtct    368400
     ctgtcggcca ttgcatatca aaaacaaatc aaaccataca actttgtaaa tggttctttc    368460
     cgtaaccttc actgtcagga taggtgcaac gcccatctgg tatgtgactt acgcgcaagg    368520
     acaggacaga gctttaggga atattggtat ctgcccctga attttcgaat catatcccca    368580
     ggcgtctctc cgtatagttt attccgaaaa tgggactgtt cacgatgcgc caacacactg    368640
     accgcaggaa tgaatggccg gatgacataa attgaagccg atgcatggtt gcacgatatt    368700
     ccagactgag caatatccca atcatgtgcg atgtcggtcg gatgtggtga ggagtcggtt    368760
     tttcgtagaa atcgaggctc gactcaagac gttgaggtaa acatttcggg tgtgttcagg    368820
     acacgggtga gcgtccatga atatgagtaa ctctggtgaa ctcgtggttg catccgagtc    368880
     aactgttgaa cagttgaacc ggaaatggta aaggttggtt atgttgatca tctaaaagtg    368940
     gtgatgaaaa gcaataaacg gatggcaggt gagagacgcc acctcctgga caagagtacg    369000
     gtggtcaatt actgccattg gccgaataca cccacgcttc ctgggccccg cacacatcac    369060
     gtgtatctcc taaaccttaa gagtcacgct ccaagttaac tgcgtgaaat cgtttaggcc    369120
     tcagtggtcg gtcgatttta tgccacgtat tcaaggacag ctatttagtt aactaaaaaa    369180
     aattgctttc cacgataact gcaccgcaga ataaatgagg gtagagtaat agcgtgcaag    369240
     gagctgtaaa cgagtgttaa aggccaatca aatgctggtg aaaggataac ggtcaacggc    369300
     caagagtagg tttacagctg gtgattaacc aattgaattg attgtccctc agcaatctga    369360
     ctacaaaacg gtcgaaaaga ataacaaagc gattaattca ttttctttta aacgcagtga    369420
     aagaaatagg gagtttattg agtatgattg gctaggggac accccccact attaatcacg    369480
     cgaagttcct aatacccagg cgcccccaag tctgttgcaa gaattatttc atcctgtcta    369540
     cctaaaagaa tcctcctgtg tccactttgt gccagattct ccaggcatca gacccaagct    369600
     cttcttgtac cttttttgtt ggctcagcta ccaagttcat ttgtgacgga aaattcagaa    369660
     atagaaacgc taagttctcc acatgatgta tttctctata ttatttcggg agtgagactc    369720
     atgttcctgg gatcatatcc ggccctagga tccatagcat agcttgtcag agatcgagca    369780
     tatatagtag cttgggtgtt tggtcgctga ccaaacattg tgcctttttg gccagatggc    369840
     gtagtggtaa aacccaagca cccatgaacc gtcacatagc tcctaggcac gctcttggtc    369900
     gctcctagga atcagactta tcgttcctag aggacctata gttcccggga ttgggtaata    369960
     tagctccggg gaacgaggag ggggctttcc gagctttagt gcgtttagtg agatcagcgc    370020
     tgatggatca tgaattccag gagcatgagg gcttcggaat taacaaataa ttcctggaat    370080
     gtatgaactc aattggaccg cacatcttga agattaatct attagtgatc atacggatca    370140
     agcaggatag cttgtgataa tgtctacaat gtatttttcg actcgtcttc cagtactcct    370200
     tcttcagtta tatggtataa acaatctatt ttgatataat ataggtcaaa gagcgtctaa    370260
     aacccacctt ccaattgagg agttttcgct gagctaaaag ctttcattaa acgtaactgg    370320
     ggctactatg aagcagatcc tgatcaagga tttgatgcct tcctcgcatg gtgtattgat    370380
     attgtcggtg caaaagaaga aagcgctaaa ggtcattttc gacacgcagg cttgaagatt    370440
     gaagaaatat tagaaaggtc ctagatgcag ccttggttga aatcgatttc ccgcgcagac    370500
     tctccacaga acagaccgct tgtcgtgggc catttactca ttaaaccaag ggtcatctag    370560
     aacttgtcta gctgacgccc ttgctgacgg ttcaaactgc aataactttc cgatgatttg    370620
     ccccagcctc gtgatatctt ctctggtgag atcgggactc cgtgggccat caaagtacac    370680
     ttcttctagc cattcctgca agttgggccc gtactttcta tgattctgcc gtctcctgcg    370740
     ttcacacgca tacgctgtac tgtaagaaga gactaatcaa acccaacgtg gccgaagtag    370800
     tgacagcgtc gttccagcga gaatacaaaa tagttatata attacttctt cagcggtgag    370860
     aatgaagctg agaatggaac ggattgagtt gaggcttcct tggaggagtc ttctctaaca    370920
     tgaggcagat tatcgataac gacaggattg cagcattctg cgattgcgat tcgaaactga    370980
     atatgacaga tgtcgcgttc catcttcaaa gcgacgattc cagttaggca taaacgagag    371040
     tttgtgggac ttcagtggtg gtcactcgtg caataatggt gctctgtgcc tagaacttcg    371100
     accagcgcag aagcagcgca gcagcaatga ctggcaacac actcaccaac tctcccagtc    371160
     ccgcaaactc tgggggaatt ctggcattga caaaagcacc cgcagcgaga aggactgcaa    371220
     aggtattgta tacgaagctc catataaagt tgaacttgat gcggttgaca gatttccgac    371280
     tggcgtccat catggtgggg ataccagcca gaaaaggccg catgagaacc acgtccgcgg    371340
     cggattgcgc gacatctgtg ccttcgttca tgtggacgcc aatcgtagcc tgtgcgagag    371400
     caacagcatc gttcgtgccg tcaccgcaga aaacaacaac cggttcctta cgatctatgc    371460
     gagtacggag gagtgtctgg atatagtcct tcttgtcggc gggcgagctt cgagaacgca    371520
     cttgaccgcc aggaatgcta agcttggacg ccaaagaccg aacagctccg tcatcgtcgc    371580
     cagaaacgac atgtaccgag acgccacgcc tgtgtaaggt ctcaatcgtt cccgcagcgt    371640
     caggtcgaag ctcatcttca agaccataga ccgcctgtaa cgcattgtcg atagtaaagc    371700
     agaagacagt gtacccttga gcaagcattg gctgaacaac ttcattttcc gataaattca    371760
     gccagcgaga attgcctgct cgaagtttcc ggccaccaaa ggtggtttca acacctttgc    371820
     cagtaaggct cttgggctca ggaacagtcg aagccgtaac tccggcatcc ttgaggtgag    371880
     cagccacaga aactgagact ggatgtcggt tgttctcgat gaggcctaga agaagcggga    371940
     gcttgtccac gttggcgcac tccgtcgtta cgacagaaag ctttccccga gtcaaggtcc    372000
     cagtcttgtc aaacacgacg tgcgacgtct tatgagccac ttcaatagca tctgatgact    372060
     tgaagatgat acctctttcc gccgcgactc cgctggcaat cacaatgacc ataggaacag    372120
     ccagtccaat ggcgcagggg caagaaacaa tgaggacagt aatggcatag gtgatggcct    372180
     gaattgtagc ttcggatcca tcatatccac gaacagtcat gcctactgca acccagatga    372240
     cgaacgtgat gattgtcaat gccagcacaa ccgggacgaa gtaggacgct acccggtctg    372300
     cgagatcctg cagcttaggt ttcgacagtt tggcctcatc gaccatcgca gcaatggcat    372360
     tgatagtgtt atcgctaggc aagcggttca gtcgaacagt cataactcca gagccattga    372420
     cagacccagc aaccaccaca gacttgggat atttctctac tggtctagat tcaccagtga    372480
     gcatagactc gtcaacctca gacgacccat tgatgacagt gccgtctgtc gggattctgg    372540
     tgtcagggag aactttgaag gtgtcgccgt attgaagaag tcgggcgtca atctcacgtt    372600
     ccgttccgct cttttggtcg acaaggatag ccgtcgatgc ctgaagtgac cggatagaaa    372660
     tagattcaac agctctctga cgagcgagag cggcaaccca tcgaccaacc atgatcaagg    372720
     tgactaagag agtgctcgtt tcaaagaatt gaccagtcga aaggggctgc tctgcaatga    372780
     ggtacccaaa ggagaccacc gagaatatgt aggcagcact ggtgctcaag acgatcaaga    372840
     ggtccatctc gataaccctc gagaaaatga gagccttcag ggccttagga tagaaaggcc    372900
     ctgctatgac aacttgaaca atcgtggcca atgtgagtga agccgatgaa tatgccacct    372960
     ccccgtcagg aagcgaagcc catgccatga ctaggaccgg aatcgttaag acagcggaga    373020
     gaagcgtcat gtatccgaca tgacgaacat gcttgctgcc agcctccagc gaagggtcgc    373080
     cacgtggagg agcaagttca attggcggac cccaaatctt ggagagttct cgagctccca    373140
     cgatattcgg atcaaacgca actcgcacag tctgcttgtc tacaggtgcc atgtcgagaa    373200
     ctccgtccgg ccacgtctga ctaatgaaat tcgagggctc atcagggaca ataagatcta    373260
     ggctagatcc ctggttctgg actcttttgc acttaaattc agtggttcgc tccagatgtt    373320
     tcatgacttc ctcaactgag ctaaggcgca gatcaatgtt gaactcggct cgtgagagaa    373380
     ccagactggt tttcaggtct ttgacggcgg ggagagtatc caaggttcgg ctaagctttg    373440
     tctcgcaacc agtacaagtc atgccagaaa tgctgaggac aacatgttcc ttgccggtac    373500
     tctgattctc tatgtcggtg atagcctgaa tcgaggcttc ctcaatctct aaaccagggt    373560
     cgggcacagc agaagagcag caagcatcag tgcaagagcc ttgggggttg gccggctgct    373620
     tttctgtgca gcgagaatct gcgcaactaa cgatatcctg cttcggtggc ttacagcaag    373680
     agccagagga ggcggcgtta ggtagctgtt tgctaatcgt gttcttagct gttccacaaa    373740
     aagaccctgc acacccacta gttagaggtt caacaacgga tccgaccttc gaacagcata    373800
     ggtccgcata aacgctcttg gtgttattgt ctttgacacg ctggtctctg ggacagcaag    373860
     atccggggca gctgacatcg ggcttttcga gggagtagca agacttggca cagttatcct    373920
     taactaatgg agccgtggtg ggagtgtcct cagagcagca cggctccggg cacttgcttt    373980
     tgacaggagg ctctttggcg ggcttgtcct tcgaacacaa agcgacaaca caggcatggg    374040
     cggacgcctt ctcgacagac ctggtgcttt cacgagagcc ccttcgcagg cgagaacggt    374100
     tctgcgcggc ctggtccttg gtgactgagc cgttgctgca ggaattcagt gaaatgcgaa    374160
     aggagcgagc agacgacttc ttagagcact gcttcccgtc cagtgactgt cggtcgcgaa    374220
     tttcacagca ggtttcctgg ccaagagcaa taagagcgcg gcagatacat cccagagcct    374280
     gtagagtagc gccgtagcgg tcgagggcag agagactatg ttggttgcat gccttgtggt    374340
     cggtagctcc accgcaagct gaaagggagt tagcaatctt tgaatgccat tctcaaaggg    374400
     cggacactca ctgtttggct gactgtttgg gccgggggca gccatagcac tcatctcgca    374460
     ttcccgcata gccaagcggt caaggcaaga cgtgtcgcag catgggctga ctttgccacg    374520
     gcagcagtca ggcgcgtcgg tatgattctc ggatttgttg tccgcacatt tttcaggaga    374580
     gcagcaatca tccagttttt ccggggcggg cgttttctga cccggggccg gggtgtgctc    374640
     agtgtcgtcg ctatcgcagc aagaatcctg gcaactgctc ggcttctcac ttggagccgc    374700
     gagtgccgta acattgggct caggggccgg agtcggtagg ccgcaatagt cgccttccat    374760
     cgttgaagtc agcgttcgct ttcagtccaa tttgtgtgaa tttgaggtgt tggtcaagtt    374820
     gagttttcgg aaatcgtatc agcctgtcgg tttccccttg gacatgccag cacgtgaatg    374880
     gttcgagtcc ccctggccaa tcacatccac ggcggctacc tagcgttgga gattgacgat    374940
     accagcctcc tcaactgttt gtctttgggc tatgggctta atcggccgcc tgtaaacctt    375000
     ttcatgcaca ttgacaaatc gagtttttcg gattctgtta gaaatggtat cgatagttat    375060
     gctggcgtgc gctcgatact tggacgagat cgtgggagtg gggtttatct ttgaagaagc    375120
     agtgcatgtg accacggcag tccaaccaca aatacgctga ctaatatggg gtagtacaac    375180
     cgggcctagc tgccatctgg gagatcctat gatccgaaat accgtttaaa tcccgtattg    375240
     cgaccgttgt aattcggtat ttcattatac tacagattcc tacaacaatc gagtaaacac    375300
     ggtattataa ggaatcggta ttatttttca aaatacgtat tctaagttaa ataccgcatt    375360
     tagtagtatt cttttctaaa gctaggtatt taaacggtat ttaaacggta tttaaaggta    375420
     ttttctacta aaaataataa cgctgcctat ctaaccttag ttggaatagt agttaacctt    375480
     ttagctaaag ggatcacgtg atatcacgtg gccgtctcca cgacctattc taagggtaac    375540
     ctttaattta actaggcgga cgtctatatt acgtatgtat atttactata gaaatctagt    375600
     attaaaggta cgacaagctt cagccctcca atgcgcggat cattctggat attacggata    375660
     accagccgat tctgcaatat agcaggaatg aaacgaccaa ggggagtgag tgaccctcct    375720
     cgaaattcca ccccagtggt agtctcttcg tctcttgcgc tttcgtcaga taaataagtt    375780
     atggcgctag cggggtgaga ctcacagtgg tatgccttcg gtagagtatt cttgccaaca    375840
     aatgaagaaa gcacggctta ggttggccat tgggacgcca gatgggttaa attctgggtt    375900
     aacatcgata attccaatgt tgaagaatga aagtgagggc attccggcaa gcctgttttg    375960
     tgttgagaga ttttgctaaa ttatagggct cgaggaagag gccttataga gtaaatgaaa    376020
     aataaagttg tttggggaac tataggtgca gagcgaggag aactatatat attcaagctg    376080
     tcggtggacg acaggtctag gcaacgccgc gagatttagg gtgattggaa ttaattcttt    376140
     ctttcctcaa aaccattatg tacaataccc gctgacagaa taggtcgttg attattttag    376200
     tgcctcacgc gtgataaccg gccgttggat tacgaactgg tagagaggcc ttttgaggat    376260
     ttagtatttt ccggctcatt tacagcaggt ttagtcagcc tataggggcc ggcagcaatt    376320
     aaggtcgttt gctctaggtc ctcatttatt ttccactcga ttttcggtcc aaacaaaaaa    376380
     aaaagcttgt gtgtgtagct ttgtagaagc aatcgaagcg agatagatga caagcacttc    376440
     atggaaccaa tttgtcaaac agattcaaat catgtagacg agtatgtggt aacatcatca    376500
     atggagaggt ttcgagctta agctggtgct tctttattca aaccaggagg ctataaaggg    376560
     gcatatttct actgtcccag gtggccatca actgcgcctg gtcattacca aagatttagc    376620
     catggtaagt acccgcgcct ctcgcttgtg acgatgatat gctcacctta gaagcctgcc    376680
     gcgattcccg tccaattcct atacgggccg gcagaaattt ctttgaaggc aatgctcttg    376740
     ttgagaattg aatctccgta tctcagggaa tggacgccct cggaaactcc cagccaagac    376800
     gcgaggatac tgctagatgc ctgcaagact ttgagaagca gaaggtccca ggaactatgc    376860
     cccgatggaa acacctctct cgaaaacgat ttatgcgtct tagtggagaa tgtcctacac    376920
     gaccttggtt atagtactat tttgatgcta gcgctgataa cttggcattt tggtgcttca    376980
     tcttcagaag tggggcagga cttgattatt tttttgagac aacctcacga tattggagtg    377040
     aggcgaatac ttcaagatag atcccaaagg tttatgtgcg aaacggcccc ttcaaacttt    377100
     gactttttgc ttgtctgaaa ttgagcccca tcaagtgatc agtgcaggtg caaaacatga    377160
     attgaattat acgtgggttg atcaaatgta tccgagtttt tctaggctgt taccaatgtc    377220
     ttggagagag tcattatacc agtcgttcaa accctcgtgt atctcatatc ccaaaatagc    377280
     tgccaagtct cgcctttttt catactcctg caggtatttt gagtgtaggt gctggtaaca    377340
     aagagctttc ttcaagtcag ggtccgttgc cggttgttgc aagacaattg ggtcatcgct    377400
     gcttaaggga atgaatttta taatcccata tttcctccga acccgtaaaa taccagactc    377460
     aagcaccgca agatccacta gaaatgcatt ctttgtacag ccatgctcgt cctgggcttg    377520
     atgctgagca ccaagctctt ggagaggaac ggcatcaaca accacatcgt cgaggccatt    377580
     tctcttgatg tctttcataa gttgagttat atcgtgagaa aacaaaatcc gcacagtctt    377640
     gttgggttag gtctcggtgg tcaatgtggg gggaagggca gcttacgtgc aagcgaatcg    377700
     gcgctgaatc tctggtagaa acaccattat cgggctcggt gcctttcgtg gattcatgca    377760
     tgttacttcg attgggatct gggcctccaa ataaatgcgt ttcgcgcgag ttgcccgggg    377820
     aaaagaaaaa agaagatatg cagttcgaaa aaacccaacg aactctatgt aggctcaagc    377880
     agaccatggt cttgcaatcg tgaaatcctg gtcaatgatt cggataaacc tgagaaacag    377940
     tagtttatat catgatgatc cagcagactt gtcatttctt ttgcatatgc cactgattac    378000
     aggtctagga cagtgaaagt tagtttcaac caaaatttca aaattaatga gaaacagcct    378060
     tctaaaaatt tgagcgatgc ccgagatatt gtgcgaaata attagtgggc tctctttgat    378120
     ccattctttt gggcggtctc gaaagtccga aggcgctagt atcatactcc gtccacgtat    378180
     tttgagtcta tttttcgctt ctctgacgtt gctaatgcgc atgtgagctc atgcggtggg    378240
     catatactgc gccgcaattg attgggcgcn aaatgaatta tttaattttg ttttaaccct    378300
     cacatttcta acaaccgatc gtttaatcaa cagctgcaag cgttagccct cgtttctcac    378360
     cacgataggc attatactac tcgtcgatgt cttataaact atgtgtttat tctcgttcat    378420
     tctactatac tgattatagt ggaaggcgtt attaatatta attgtacttc cggtcaactc    378480
     ccgaataacc gttggttgca ggttatttat tgttcatcaa catcatgtct cttcaaccgg    378540
     tgtctttgca cttagcccgc atttnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    378600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    378660
     nnnngcccaa tcattcttgt tagtagattt tgtattgact ctccttcccc gctatctcct    378720
     cagaggactg aatcatctat tctacatcgt actgtcatct ttgaatggct tcgtttgtcc    378780
     atgagatgga atccagcaat gctatccact acgtcgccgg tttggagagg cacatttatc    378840
     accttcagcg gatactgaga gaatggacgc cttacatccc acagcatgtc ctcgtgcgat    378900
     ctcaaattcc actcgaaacc acaccatccc atcttctcca gcctcccagc tcccaaaccc    378960
     tttcagtgac tcagcgtaaa agggtttcgc tatcaggttc atctcgatcg gaagatacgt    379020
     ggatgaagcc attagaaagt ttcatcaaca agattccttg cgcagaaaag tggtctggag    379080
     ccgtatcttc ctctttccct cgaatttccg ttttggattc attattccaa agcgaaggtt    379140
     gcctacgaga cagtgattcc ccaacatcag ctatcccttc tcggcattca gacatcatcc    379200
     aaactcttgg ggcttttgct tcgctcgcac aaaaatgcgc caacaatgcg aagtgggcga    379260
     gattgatgtc atcctaccag aatttcttgt taagtgcgct ttgccatgtt gcgtgttgtc    379320
     ttggtgtgga tccaaattcg gtgaacaaga tgatgagatg tatttcaaaa ggcggagcca    379380
     accatcttca ggaacttcgg catggtgcgg cttggggggt cgaggcaatt gaccgccttc    379440
     aaactgagag cggttgggat atcagaagtg gtgatatatt gttttactgt caggcttcct    379500
     tgccaattgg gttcatacgg agctgacaaa tgaatatagt taccccgacc tttacttcat    379560
     tgaggtactg ggcgaaagca accaaatcga tacccatatt taccacccgt ctgaaagaag    379620
     accaatataa gaaaagccca gagagtttgc actcaaacca tctctctgtt ccgtgcatca    379680
     tcaaatgcat atttggcaaa agtgtccagt acgtctacga accgtttcgc ttgtcgcttt    379740
     ttacttacag ttagcctaga ctctccgacg tgtgtaatgt tctacactgc aattttgata    379800
     ttgctctgga atcgtttgca aaatggtacc tagatccatt tggttcagat gccatggatg    379860
     aactggaaag acaaaggctc ttctttcccg tgcatcagtt ttccctggac aggcaagctg    379920
     actttggggt tgaatcccaa acggaaaggg actcgcagcc cgcaagagac ttattgcacg    379980
     aagcgcggaa aagacgtcgc gttggcagcg ggaccaattt aaatctagac ggcccgtctc    380040
     tcaatccaat tctgtcggcc aatgtacaac tacagacaac ctctgaggaa gatcccaatc    380100
     gttccattcc aaatctatcg ggtgagcctt ccgggcaatg agatccatca acatgatgct    380160
     gactcccaca gaccaggaga gagcttccct gagcaggaat ccaaaccctg agggtttccc    380220
     acatcaagtg acatgtgacc atcgactgcg gcttgttagt ccagatccgc aatatacagt    380280
     ccacgggcgt cagacagcat gttcgctccc ccaaattcac caagatgact cacgtaggtc    380340
     atcgacaatg atgaatgatc actacagacc aggaggtcaa gtgggcattg tcagacaaac    380400
     aatatctcct gctatcctcc aattagaacc atcaccaagc tttacagacc atcaatctcc    380460
     cctacacttt cgacgagctg ccataggatc tctcgaacgg gatttgccca cctccagtgg    380520
     aattcggggg tccgcgatca gcgaaatgct caatgtctcg aatgcagcag tctgtgatga    380580
     agtgattctt ccaccgatag gaaggactgg cgtggctaac ggattgcatg gcaatttggc    380640
     aacgagcgat ggctctcagg agctacattc tcaattcact ccatcgaacc aaagtttcgt    380700
     tggcggatat ccgtcacagt attctacggc tggccaaggt gctcaatatg caggggtcgg    380760
     tgagccgcaa gtcgttgaca catcactctg ctctcataat atgttgtctt cattgctatt    380820
     tgaggaacaa gaaggcccgc atatcgatgc cgagccccag agagttgaca catcccttcg    380880
     gtcgcattac atgctgcatg atcttctaga ccagtttgaa caatcacgac aacagcctga    380940
     ttccgacata acctaccaaa cgcaattcac tgtctagcaa caacaaatga agagaatcag    381000
     tatgtgcaag attcgatcac gcagtcatgc caagtgatat agactttcca acgcttccct    381060
     aatcgaatcg ccgcattcac tccctagcca tagttgtcat atattcattt tttctttgtt    381120
     gcgctggaaa cataaatgca gtccataggc gggtgtatga catcttcgtt gcatacacgg    381180
     gttattgatc ccagtggtag agggcgtcct tgtccgactc gcggagtccc cgaaagaacg    381240
     atgagatcgc cagagcctgc tttgctcttg aattgagatg atgcctcggt tctccatgca    381300
     gaatattcaa atccctatag ctctagtggt cagcctgctg cataacgtac tgtttgttgc    381360
     agaagatacc tcttcgtaaa ccccactgtc aactaaaaga gtccaaaccc gccgtcccaa    381420
     ctcacggtcg ttgcatgagg atacaccttt cgcaaatgct tcaaaagatg cagtactgaa    381480
     ccattgtgag aatgcttttc gtcgaccttc atcgatggaa gagcatgtcg tttcgtcagg    381540
     cggcatcgct tatccgagga taaaggtaaa tgcgtctcaa aggggcaagt tcagctgatc    381600
     ggatcctgta gatgcatagt tactataatc agtttctccc ttgatttatc gcctctttcc    381660
     acttactgaa tgtggtggaa ccatcgcggg gaatatttta tattatcgtt tcctggtcag    381720
     cgcccaacgc ataacccctc atcacgtgcc attttgtatt atcatgtgat taatagcacc    381780
     attatttaaa agctccgtat gatctcacct ctgctaaagt gagaagaatc caaactccta    381840
     ttcctctagc cttcacggtg atgatggctg gtttccactt cactgaacaa aagttgggca    381900
     atgatcttgt ctcgtctatt tctagtcttc tcgactcaat aaatgtccca aaccttctct    381960
     ggggcaacta tctactcact gtttatggag ttcccacgat tgtggatgtc agtattgtct    382020
     cgattggccg gagcatccac taatgttcta acaggaagca gcttttgtta ttccggatga    382080
     tctcacccag gtcgcattct cttcactcat gagtgctggg tttttaccct gtaaccaaag    382140
     ctcgggctgt ccgcattcag ataccttacg agtcccaccg gcattcaagc acctgcatat    382200
     taatgatgag cttgtggtct cgctttatcg gaaatctgat gtgctatggg agtttgaaga    382260
     tctaaggtac ttgcctgaga aaaatccaga tatcatgatt gcgtcggacg atcgactccc    382320
     gtcggcatct ctaggtcgtg gccgaggacg cttctcgtcg catccttgta ccgtgaaact    382380
     cccttgtgct gtgagatatt gcgaggccct gattctgttg ctttgccgtg actacgattc    382440
     ttcttacgag acttattggt tggctattct gagctatatg ttggagtatg tcgacggtac    382500
     ggacattttg gatgaaaaca agctgcaaga aggttacaga aagttttacc atgccctcaa    382560
     acagggagat cctgagatgt attcaatgct ggatgagctc cgactcagct tgattgaaga    382620
     gcgtcgcctc ccaatgataa atgattaaca agaccgggct aatacctcaa tctccaatcg    382680
     aaataaacat aatttggcca ctcaaactct agatttcaac cgtcttctca caatcaaatc    382740
     cttcagactg agtgaagtaa taacctcttt ggtttgaggt cactgttttc ccagttttca    382800
     agtcttggaa gtcacaattg aaatgcgtgt ggccaaaagc ccaaagtttg acaaccccat    382860
     tttcccaaca aggctcgctt gataggtcgg tcatgaaagc tgaggagatt ttgctgttcc    382920
     tatgtctggg atcgacaacc atagcgtggg ttgatgggca gaaatgagta aacacgacaa    382980
     ccttacgatc aggctccgag cgcgaaatat gttcaatttc ttggttcagc cacactagat    383040
     cggcatggtg cgcatcttga tgggcttcga tggtccaatc atcaatgtaa tagaagtcat    383100
     tcagaccgaa attaacgctt tctttttgtg cttgggccac ccgcgagaac aaagtacatc    383160
     cgaggacggt gatcccaggt gaaatgtcgt agcgcgtttg atcgagaatg acaagtttac    383220
     cgagcgtctc gctggatcct cgagtgtcgt caattctcgt tttgaacttg ttgacggcgg    383280
     attttgtctc agaccagctg ctgtgatacg cttcgtgatt acccatcacc aaaaaaacga    383340
     tgcggaacac ttccagctgc ctacgcagga agtggaacaa gccttcgtct ttgacatagc    383400
     caatgtcgcc gagtagggct aaatatggtg ccttggggtt gacttcgaag acgtcatatg    383460
     cagcaggaga ttccaggtgc aggtcagaaa taatctggaa catcatatcg tcctttggcg    383520
     ttctatttgt ggcaaaattt gtttcatgct agaaagtggt tgtcggggtt acggggtggt    383580
     cggcgctaaa tgtcgctgtt ggtggtaccg taggtcacat gactgtttat aaccaagaac    383640
     cgatgtgcgg ctggtcgccc tgtgagcgta tatataaact aagtcttagg aaccaaagct    383700
     agctcgtcag gatcctctgg ataacttcta aatatttgag tctccatcta gttgcttata    383760
     aagcattcgt tcatctctac catgtctacg ccgtcctttg ctgaactgga ggtcgctgct    383820
     ggagcagtaa ttgatatcct caaaaccatg cctgaattct cgaactccag aatagctgtc    383880
     atcgggggct tgggtctttg gaattatctc cgacgctatc gcactactga ggttcgattt    383940
     catgatttta tctgcttgaa tattctctga ataatgtttg aaataggatg tcgatttcct    384000
     catcactgtt caaggagcgc ccaaagcagt caaggacagg ctgcttgcta tgccatcgag    384060
     tcagttccag caacaggctc aactcttttt ttacaaagga gtgggcggca agtcgattca    384120
     aattgacatc actcctgatt ggcaggtaag ctcggtgacc agttttcatt gcaaacaaaa    384180
     catatactta tggtttacag tctccctacg ttccatccgc cgcggtgcca atatcggcag    384240
     ctcgatcaaa cgccttgcct tatatttccg agcttgatct tctcgtcttc aagatcaatt    384300
     gttgcggttt gcgacccacg ccggccaaga agctacgtga tgcaaccgat gcaaggacat    384360
     tggcagaaga tatgtgttcc agaggatcta ttaatctcac gcctgctcaa aagagtgctg    384420
     ttctccaggg cttagatgat gtagcccagc tctccagaag agataagtcg tggtggatgg    384480
     caaagttggc actgtaatag tggttgtctg agtatggctc gacgatgggt ctgaatggaa    384540
     caaagatcag cagcaatgat atgtaacggt tgtaacctgc gaacggagtc ttgctagccc    384600
     aataaagagc cgatatgcta tggtaacgac aaaggtgttc cttcgtccaa tcagctggct    384660
     gcatatttct gaaagcccgt tggggatacg cacggaccta ggacctaagt ggagaaggat    384720
     atacgtaaat attaaaacca cctgaatttt ccgcgctggc tacacttccc cctctcattt    384780
     cctctccctg actttcgaac ttggctaata ttcctctcct cctgttaggc cagcgggcta    384840
     tgtaggagcg gtcatataga tggatgggct acgtaggtat ggccatgctt ttctagatcg    384900
     aagccttcgt gggtcgtggg cgagtgccag gtggggccca tggagcaacg ccaagaggta    384960
     agcacacgcc ctgtagggac agccatggag aaaatccttg aggatctgca aggctagaag    385020
     caatgcgcaa aggcgcaaat cttcttcaca gctagagttt gagcaaaagc gcatgttaac    385080
     gtttatgtct ttgcgcatgt aagagattac ttataaaata aaaagccaca ggtgcacatc    385140
     agatccatgt aatttgggtc tttcttggaa tctggcacga aaatgattgg gagttccgaa    385200
     actttctggg gagtagaaaa gggggttctt gcttggcgga aggtgctcac cgggtaataa    385260
     ttcggccggt ccgaaactga gtaattgtac tccatacttg caggagttgc gcctacagac    385320
     ttgcaaactt agtgcagctt cgcttcaaca ccacacccca attgtttgtg agggccgagg    385380
     tagttgaggg actgctgtca cggcctaccg ttgattctca attaattgat gacagtccct    385440
     tggtcagatt aaatgaacta gtctaggaga cataaaggcc tacctaattc taagttcaac    385500
     aaaggttagt ggagaaacgg aggtggtgat actgtagcaa ttaaaattca agtatttaga    385560
     tgttttaata tgaggccgtt gaaagtggtg ataaaagtgg tgagaaggtc gtttagacgt    385620
     tgtcctctct atagaaaagt cgagttgatt gaatgattgg ttaaacgtga ggaaaagcaa    385680
     tggcgggcgg tgaaattgtg accgaactac ccgcccaaga ttggtcaggt attatagcat    385740
     aattggctta ggaagcctac aacttgcaaa ttgagagaag ttcaagtcgc aaggtatatt    385800
     gcataatctg ataaatatca tgccagaaat tgcttccctc ctgtttccct aaatccccaa    385860
     gggtgtctgg gcattaaacg ctgcacgtga tgaatcaatt attgctattt cagatagact    385920
     gcataatagc aaacctaatc aagcctagcg gcactctgaa cgacattgag agagacacta    385980
     acatcgtggt atctcttatc tccatcgcaa accctcgcaa caacaatcct attgtgggtg    386040
     gctagtttcc tccaagaata tatacggagg aaacaaatag agccaaaaca cagttgtcgt    386100
     tccccgaacg acacagtctg cttattggtg ctcctagggt attacctatc attcccggag    386160
     ctatacagtc cactcccgcg agctggagat cctctgggaa ctatgacttg actcctagaa    386220
     acgactaaga gagtgcctag gagttatgtt atggattctg ggattgtatt cgatcccaga    386280
     aaagtgaggg tcccactcgc gagataaaaa gtgggctctg gtataggtaa tcaataatta    386340
     gaatgcaaat taaaatgcgg gctaagtgca aagacaccgg ttgaagagac atgatgttga    386400
     tgaacaataa ataacctgca accaacggtt atttgggagt tgaccggaag tacaattaat    386460
     attaataacg ccttccacta taatcagtat agtagaatga acgagaataa acacatagtt    386520
     tataagacat cgacgagtag tataatgcct atcgtggtga gaaacgaggg ctaacgcttg    386580
     cagctgttga ttaaacgatc ggttgttaga aatgtgaggg ttaaaacaaa attaaataat    386640
     tcattttctt tttaaataac tgaaagaagt agggtgttta ttgaatatca ttggctagat    386700
     aactgtctcc actccaaatc agcgcatttt cctaatacct aggcaccccc caagtttaca    386760
     gcaaaaaatt catttcacct aggttagaga tgtcctaggc aagcccggtg ccaagcctat    386820
     ttctgccata tcttccagat agttttccaa ccttcacgag agcttcttat taattcgtgt    386880
     actgactttt ccatacctct agaagccact ttgtctccac cacgattgaa ttacgtaccc    386940
     gataagctga ctacacaggc tatctacttt cccctatcct caggcctact aggagtcgtg    387000
     aatgtcttcg gaatttacag cgaactcttg agtaccctct ggaaccacaa atcatcgtgc    387060
     tttaccctca gggcctcagt gacttcgaat ccattgcgat aatgactgtt tcaggtcatg    387120
     gaccgaggat atggcaaaaa ataattgatt gcatagttct ggtctggtgg aagtttcgct    387180
     tggtcgtaca acttcatgta tgttgttcag gttcaggtgt atctttatca acctgctcca    387240
     gatcctgatc tgttactagc tttggggctg gatggtagag gttggctttc ccaaaaaaaa    387300
     ggtcgaggag ccggtcaaca atactatatt aacgcatcaa gctgaggcct agttatgcta    387360
     taattttctt tgtgacagct aaccgatgtg taaacattgg gtgtctccga cgagaaacgg    387420
     tcaactgcac tgtggggtta aagcaacgga ttttttattt tttatttttt tattttgtat    387480
     ttattgattt cacaattggc atccctcaaa ttcaggaggt aaagatctga ttactcttct    387540
     ggactcggat ttctgagcta gctaattgtt taatcaccaa ctgcaagtct actcttagcc    387600
     tttgaccctc atgttctcac cactcatcgg ctaatcaatg acgtttcgtt cattctacta    387660
     ttatcatgga aaacatcgtt gaaagtacaa atttggccaa ctgtctttct gttgcctagt    387720
     attctatagc catcctgtgt tcctaaatct gttgctcttt ccatctgaat ctagaatatc    387780
     gaacatggga gtctgtatta ccgaatttgg gttagcgtca ctctgaacca caggaataga    387840
     gacgctaaga gaattaagca ttagtgagtg gtagccaacg atggatcagg gaattttgag    387900
     gcatatgatg agaagctatt tggctcaact ttttgaggtc gatggatctt agggaagatg    387960
     aggagatggt tgatctacca gataagacat gtctccgttc agaatattat gcatacgtgc    388020
     tgatattccc tcaattctaa aaaaaagtgc ggtctaggat ataacccctg gggtatttac    388080
     acaagcttca agtgatgata atgaaggtct tttttgatgt gagtggttat ctcttcggca    388140
     tttttgatag atttatgcgg gctccttggt tctatggtac actttgccat caacctgctc    388200
     aaaactgctg atactgtcag agaccaccag gaccaagcaa ggcttgtccc tataaatacc    388260
     tcgtagacgt cggccctcca agtatttttt tatctaatga tcattgcagg ttgtgtcaac    388320
     gaacaaagtt cagcgactcg tgcagagatc ctattcctta caaggcctta actgcccaga    388380
     taagtcaggt acgtcttttt actttcccat gaagtcccct ggaatgattg tatgatgtct    388440
     aaccgcaaag cctagagcat accgaagcgt gttttgtcaa acagacggac agcgagaggt    388500
     aagcttattc tctctatttt gaaagaactt cgctgactac tagctttatt gtgcaccttc    388560
     ctcacagcga aatgacgtaa catagttgtc gttcgaagta aacggctgcc ataggagggc    388620
     agaatgaggg cctcgcgaat gatgcaattg agatagtgat ctcgctgtgg tgactgtgca    388680
     tgaagaggat tttgcaggcg ggccgaattt atatatgcac tgacgaggca aatctaggtg    388740
     ccatcgaaac agcgtatatt tggaaacaga ggctctgaat caacggccaa agtgccttgt    388800
     cggcgtgggc cgtattgtaa aatgtagggg tccaatcaat ggtgttcaac tctctgtatt    388860
     gctgtatcga ctttcctaac aatttatatg ggccgccgat tactaatcta aaattacaaa    388920
     atacatagga tcaatggatc ctccggtatg ccggtatgcc agtgcatcta ctccgacaca    388980
     ccccctcagc gggcccagta tgcatactga ggtcgctgca cttcatacat tggcatgctg    389040
     catgatccat tctcttcccc aattcctagg ctataagata gcctatatcc accatcctta    389100
     gcagtcgtac gaagttctca tgcttctgtc gggatagcag ctttgtgagg ccatcggcaa    389160
     ccatgctcgc cgtcgccacc cagcgtacca tgatacgtcc tgctctgact tcctatctca    389220
     gccagtggtg gtgtatatcc acatgtcgta gcttcgtttc gaaggctaca tcctcgcttg    389280
     tcaagaggct gatcgtcctc tcattatcac agtcaatggt taggtgatga gacggggtaa    389340
     atgctaggtt gttaagcagc cgccgccacc attgaacctg cttcccggcc tcggataggc    389400
     ctagcagttc tgcttccgtg gttgacgttg tcacagtggg ttgcttgctg gctttccagt    389460
     caactggacc gccgtatgcc tggcagatat atccagctga actccttctg ttagggtggt    389520
     ccccgtacga agcatcgctt gcaaattgca ccgagtccat tcctgtactg gctgctccgg    389580
     cactatattc aatagccaga ttccgggtgg tgtagagata ggtgatgact cgatcagctg    389640
     cctactagtg ctagggacct agatttgtga ggaactgcgc aagccgagcg gtggcttttg    389700
     cagcgtccgg tctggtgatt gtggtggcat atcctacaga tccaaccttc tgttggtata    389760
     aatggatctc tctcggcgta gccgtaccct agtagggtgt caattcgtca actggcagtg    389820
     gtgtatagac aggtggacgg tctgtcagat tgtatcgggt agcaatgctc gtcacatagc    389880
     tatcctgaca gagccaaagc ttcttctgct gtctatctcg gacgatccgg atattaagaa    389940
     accatgccgc ttctccatga tctgttagct cccagtgtgc ttccaggtct cgctccagct    390000
     gctgtgcttg cgctttagca gtacagtgac tagcgatcag gatatcgtcc acatagaaga    390060
     aaaccagcaa gccctatccc ataaagacgt aggggtcttc cggcatctgt tgtaacccta    390120
     gcttgcgtag tacacttgct gcttctcgtt actatagcct cggtgagatc cgcagtccgt    390180
     acaaagcacg gcgtagcttc cagcacttgc ctagggtctg gaacccttct ggcatatagg    390240
     tgtacgtctc cttatcatct agcttgctat ttaggaatgc agtgacagca tcccgctgtc    390300
     gcaaatccag atcaaaagca gccactagtg cgaagatcat ccttgctgtc cttgctgcta    390360
     gtgtagcagc ccttttctct tcgtgagaaa tggttccaag atctcctcgt acgcagatac    390420
     gagccttcag ttttaatagg taaccgtcct agtcaaattt gtatgagaaa acctatagta    390480
     gagggaggat ctgcttccct ctgtccctta gtctgtcgat gatttcaaaa gtctcctttt    390540
     cagatagcga attgatctct ttcctcattg ctacgaggaa gccttcctga aatgggtgat    390600
     ttataacatc cttccaatgc ttcggcggtg gaggaagatc atctcgatga cgacgactgt    390660
     ccggtttctc tacgtataaa ccagcggcaa aggcatggag tagagccggg ggctcttcat    390720
     cccgtactat agtggttgtt gcatatgcaa aatcgtcatc tcttcttgct ctgcgtgttc    390780
     gtcttccact tagtatgttg ccggtgtcaa tgtcactaac tatctctctg cttggtgcta    390840
     gcagctcaga ctgtagctgc ctttcgagct catcttctat aggattagga gtaggttcgt    390900
     gctgagccta atcttcgtac tgggtctggt cttgatgcgc tggatcttct tgatcagcct    390960
     atatatccac cccctgacta gagctagtat tcgcttcttc ttcctgttct tgtggcgggg    391020
     ttatcggcaa tggtggtaga tcctgatcct ccggaaatac acctggtggt gctatacgcg    391080
     ccgatggatg actaggtgtt ggccagtata cttcttctct caccccctaa ctcggggtag    391140
     tctctcgttg agcacttgct ttactagttg cttcttgaat cacttcctga gaagtatctt    391200
     gcgcttgttg aggactcccc tgtgcttgct gaggattatc ttgctgggaa tcatgctact    391260
     ggggatcatc ccgatcctac atgccctgac tttcctccat cgtactagtc tgttgaccag    391320
     tgatttcata gttgatcacc taggtgatct cttcagctgt gagttcttgc ggttgcttca    391380
     ctagcggtag tgggatcggc ttatactggt cgtactcagg tgtgtacttc cgggtttcat    391440
     caatgactgc atcccttata tgcttcacct ttccactatg cggaaaccag atcttccaga    391500
     tattcgaggc acggtaccct accaggaagc caatctctgc tcgagggtgc atcttatcag    391560
     actatacttg attctcaatc ctacagtacg ccatgctccc gtatagcctg acatttgaca    391620
     ggttagtctt cggtatcacc ggtgcaaatt ccttcctaac ttcttcccac ggaaccaccc    391680
     agcggttctc ggtagcgata tacgacggcg tacgattcaa taaccatacg gcggcgcttg    391740
     caaattctgg ccataggtcc ttaggaagct tcccttcgag agcgagcata cgcatgcggg    391800
     tgatgatcat cccgccagat ctctcagcat acccattcat ttctgagtgt ccaggaggag    391860
     tatgatatac taagatacca tcagccgtta ggctgtactc cgctgctctg cctgctgcgg    391920
     cttcattatc gtagtggaaa gccttgatcg gcagcttcca ctgattcctt gctagctgta    391980
     cgaactcctt tatcgcaagc tggcattccg gtttgacttc atgtgtcatg atccaatgga    392040
     acctcggtcc ttctagatag aagtgagata tccagcgatg tctgttgtac gccggtggca    392100
     gttgaattag atcaaagtgc acccttccaa atcgtccaaa ggatcttccg actggccgtc    392160
     gtgatatctg cctcggagca cttcctgtct tacagatttg acatagagat tgctgctccg    392220
     tcgacttctt atcttcaaga acgacgccgt ctaccatgct agcaagcttt gctatagtac    392280
     gtggttcaac gtgggctagg cgccgatgcc ataattcgga ggaagccttt gattcctgcg    392340
     gcttcactaa gttcagtacg cctgcctggg tggcatatgc ctgctgcgga ggagcttcgc    392400
     caggcttatc aaaaagccag aggttaaagt gatcccaaaa gtgtacacta acgacaggcc    392460
     tatcattagg atcccgtatg caattcgtct tttgacacca aaggccacct ttcttcctta    392520
     gcatcgcgta tgatactaga tttgtatgga atccaggtga gtatagagca tcactcaatg    392580
     tgatctccat ccttcccttc accgggtgtc ttcctatcag gcgaactgta cccctaccga    392640
     gcatctttgt ggtgctgtct ccagttgaaa cttccatatc gtccggggtg aagtcaacaa    392700
     ataagctcct atcattacag atatgcgtac tcgatccagt gtcgagaatc catcgatcat    392760
     gaagagaggg ctcgtcgctt tttgctacag atagcacatg cttactaatc tgtacggctt    392820
     catgcttttg gtaggtggta gcaaagctaa cctggttagc atattccgcc tttagctgag    392880
     cttcagcaac cactttgtcg acccattgct tccaagcgag gtcctttgct aacttcttct    392940
     tcgctttctc tagcgtacgc tcattaagag tgtatccctc cggtcgaatt gcttcattca    393000
     tgatatagca agtggcaacc ttatgcctcg ggtgggagct gccacaggga cagcgtctct    393060
     tttcaaatgg gagcttctct tgcttcattt ccggtttcgc ttcttggtgt ccttgccagg    393120
     ttgaaaatgc accttttgga gcattagtta aggtcacagt ttggacacct atctcacgat    393180
     tcatagcgcg gaatgattcg agaagatctc gagtatcgta caccttcttg tccataacaa    393240
     tctcctagta tttcccttgc caccagatag ggagcacctc tttcacagcg tgtaagaagt    393300
     ccctatttgc atctccatca ttaatgccaa gactgacagc ttgctctctt agtgtgttcc    393360
     actgttaaag ccattcctcg atgtctccta tcggcttctg cattgcaaag accttccact    393420
     tcatacggat ttcttcttcg tacgcagtcg atcgggcaaa gcgagacttc agatacacaa    393480
     gcctatcata cagagtacga tatgcaacta gagagagatg gtggattgga tcaaggtatg    393540
     tgaggatata ttcatttaca tcgctcagtc cttttgcctg cttttcccac cttatgtact    393600
     tcactttgta cacatccata cggtctcgcc agatccttcg gtccctctca tcgccttcct    393660
     cggggtattc gggttccgcc ggttcttaga gaggctcagg tcgtttatta gcgagatcgg    393720
     ttgtcgtggt gaggtctgga ttgcatagat cccatacgtt cttttgtacg gcatatagct    393780
     gcacctttgc aaaccaggtg aaccactacg gcgagtcctt cagtttttcg cccttcatgg    393840
     cggagaggat tgatgctgcc tccattactg gattcagggg tagctttgta cagcttcaga    393900
     atagcttcag gggtcgcgag acacttctag cagcgtgcta gatactgtat tccaactata    393960
     gtagtctcat tcagtgcgaa ccgggctcat aactgtcggc gtgggccgta ttgtaaaatg    394020
     taggggtcca atcaatggtg ttcaactctc tgtattgctg tatcgacttt cctaacaatt    394080
     tatatgggcc gccgattact aatctaaaat tacaaaatgc ataggatcaa tggatcctcc    394140
     ggtatgccgg tatgccagtg catctactcc gacatgcctt atatgcctga ggcaccaatc    394200
     gaatctgcag tcaaggggtg agtaagctgg atccctccgt gacagtccgt tcccctcgcc    394260
     aaacagcagg cggcctactc tgttaacttc attcgattat ctgctggata cttttataaa    394320
     caagggatcg aggaaacaat tgctgaatta cgatgtcagc ctgaagaata acaaaggctc    394380
     cgagaagcag cagagcgcag ccaggaggaa gaacggcgac tccaacccac accgtattgg    394440
     cattctctat cgccgtcaca tctctgtcta gagcgatccg agttgagtcg gatggaccct    394500
     catgactcag ggcgaggcga ctgacccagt gaactgactt tgcccccagc gcatagtccc    394560
     tttgaaacca gagaaaatcc aattttttgg tgagtgctga ggcctccctt ttgtccagga    394620
     aggggatatt atgtcatact ttgagatgct aaaattaact agttagttaa ccaatagaaa    394680
     ccttgcgtca tttgccggga aatacttcta ccggaaaccg tgatcggctg acatcagcct    394740
     cctggatcaa gcatccacca atcgagacct gtcgcgattg tctcaagcta tttccccctc    394800
     ggacagatcg atggccgaca acaactcccc agattacaag gctctctttc tgcaggcgga    394860
     aaagagacgc aaagaggccg aagagcaaca aagacaggcc gaagagcgac agaagcaggc    394920
     cgaagatgaa ggaagacgag agaaaaggag gcgggagcag gaagaggaga gacggaagca    394980
     agccgaagat gaaggcagac aggagaaaga gagacgagaa caacttcaaa agctcagccg    395040
     accgaccact ttcgtggaat tcttacgcca ttcgcatgac ctgctctccc gaccgctgag    395100
     agtcgagaca ccatctcgct cgacaactgg caaaataccc cttcccactg ggaaatattg    395160
     cccaacacga ttggaacact ggaccgactg ctcagcactg cagtcggagc ttttcaggtc    395220
     cgtctacaac tatctccagt tgacaccagg aggcgctccg cgtttgtttt catccttgca    395280
     tgagctagaa ggattaggcc gacgacttgg tcgcaagccc ataagcagcg agcaagaact    395340
     tgaggcctat gagcggttcg ccgtggaaga gcacatcaac gatataataa cggagttgtg    395400
     caagataccc gctgctcgcg acgagctcgg cctcggagat ggcatccagt tcagcaatca    395460
     tacgaattcc ttgaacgata acggtgccat tgaagcagat acaactcaac cgtcaagtgt    395520
     ataccaccca agacctgacc aattctgtat ccatcgtgtc gaccgcaaca ctaccactct    395580
     cctcacatcg gtcgagtata agccgcctca caagctttct gtcgccaccc ttcgtatggg    395640
     gctccgacca atggacttat ggaaggatat ggttagatca aacaaaatac cgacaaacca    395700
     ggaagcgaag ctaaggtaca atgcagagcg acttgtctgc tccgctcttg tccaggagta    395760
     tcatgtgatg atccaggaag ggctcgagta ctcctatgtg actaacggga ttgcccgggt    395820
     cctcctccgt gttcgacaaa acgatcctgg cacactctac tactttctat gtgatcctaa    395880
     cagtgaagtg aatatggaaa tggaagctac ctttgcaaat agttctgtcg caagaacact    395940
     gtgtttgtgt ctgatggcat tccactcgcc tgtgcgaggt caggagtgga ggaattccgt    396000
     acgatcagac attccaatat ggaaaaccag tttcgatcac actcgctctc atattcccga    396060
     agacgaattc ccgcaacttc ccctcaactc cgacagtacc gccccagaat ttccaagccc    396120
     agattctggt tcgacttatg aaccatcgtc atctccgcca gattcccctg aatcaacagc    396180
     tcgtcaagtg tctactagat ctcgagttag ctgtgcccca tccgacgtga gacatcgctc    396240
     acagtcgtca caatcgccag accccgattc gaaaccagca acacgccaca aacgaacctt    396300
     cagccaagtt ccatcttctc catctgccca acgcgtggct cgacaaagag acacatataa    396360
     tgataaagga ccagaaagcc agtcccgcca ccgcgaagcg caattttgca cccagcgatg    396420
     cttactcgga ctgcagtctg gcggtgttct agacgactgc tgtccaaatg tgatgcgcca    396480
     tcgtcgaaac aaagacgatc ttcatcatcc gattacctca gaagatttgg tgcgtttact    396540
     aaaggcacaa ctggacgaaa acattgacag atgcacaccc cttggaggtt gcggggctta    396600
     cggtgcgccg ttcaaactta catgtgtcgt atatggctac actgttatcg gaaaaggaac    396660
     cacgtcgggg ctgtggaaag atgtctctcg cgaagcgcaa gtataccaaa ttttgcgcaa    396720
     ggctcaaggg tctgctgtgc ctgtatttct ggggacgatc gacctggcaa aaatttattt    396780
     ccttcatggg gctggagaga ttcgccatat gctcgtgatg ggctggggag gcgaaagtac    396840
     aacgtcgatg gaactcacgc ctacccttct ccaggagata cataagtcga acagagagat    396900
     caaagctttg ggaatcatcc acgaagacct tcggcgtgat aatattctgt ggaacgaaga    396960
     gcttgggcgg gcgttgatca tcgactttca ccgctctacg ttgaaaagtc gaccgacttt    397020
     gcagcgacca cgagccgtaa aacgacgact atgtcaacca gagataggag atccaaaacg    397080
     tcttcgtgtg acgtgagcca gtgtgcttat tttattggat tagcaataca actatgcatg    397140
     ataatgaagc atgaagcatt tccggccgta tccgcatgaa tcagtcagaa ttctatctat    397200
     tataattctt gatgcccgct tctccaacgc acctacatgg cctctggtga tatacgattc    397260
     tatatgcgtt gacaaccacg aattgatcat ccaattctgg ctctcgaact tgacttttgt    397320
     gtgatgccat gaaccacata aaaaccttga ttcaactatg aagcttcaga accgatatta    397380
     tggactgtcg tgtactaagc gaaaatattg cgataagcgc ccaaccgctc gacaacctcg    397440
     aaaaacgaga ttatcaacat gactttccca ggtatgctat tagacataca ttccatcagc    397500
     aggcctctct ctgccaaact cctttgaaaa tttcttattt gattcggcgg ctaacttcaa    397560
     gtatttgtag ttcacccggt tgacgtcagc ctcagcgaga gcgtgtgcaa ttgctgcgac    397620
     gtttttgatc tggttcatga ttggtcagca agtgagatgt tcagtgccac tcggacacct    397680
     acctctcgtc cgttcagagc taaagactcc aatcgtcgaa gttcgtgctc ctcaacaatg    397740
     gcaggtcctt gcatcgtaca tgccttggac agaaaagttg accagagatc tctgcgaaac    397800
     tctctcgtta aattctcata ctcaatgatc aaatgaatcc ggctgagaat tgcgtcatca    397860
     aactggatac cccgattgga agtcaagaaa agaattcctt gataatattc cagctttcgg    397920
     aggaaaatgg tcacaaggcg attatgggta tcgtggtaag atgtacgctg ctccatgaac    397980
     gcgtctgcct catccaagag aagcacggca ttaaagtgtt tggcgatctt gaatactgtt    398040
     tcaagttgtt gctcaagcgc attggaatct ccgtggttga ncaacaagtt cgcctgcaga    398100
     tatctggaaa aatcagtgac gccaaaatca gccgagctgg atggttcata ccgaatagag    398160
     ggggagcttg aaatactccg aggttgcctc aaccgtgaaa gtctttccga cccccggtgg    398220
     gccactagca caagttaggt tgggaagtct tgatagcata gacgctttgc cgacatactt    398280
     cagaagaatg ttgaatcctt ggccctttcc atcaattacg tcgtcgaatg gtaccgtcgg    398340
     tatcatcccc aggcgggttt tcgccaatga caagaggatg gtcttggtct ctgaagagat    398400
     cttcaggcag tcgaacgact ccggtgacca atccacgtcc ctaagagcac taactgcgca    398460
     ctccactgga atcacattag ccggacacca aaccattgtc agtcgtctca catacagaac    398520
     attttttcct tgaagctgaa acagcaaact gttgggcagg agaccagtaa atccgcctcg    398580
     ctcagctttt gtgcatccac accgtctcct cgcattttct ccttctctcg ctcacggtcc    398640
     tccatgagca ttgcaccaat gtcaatgact gcaatgctat tcttgtcttt tacccctatg    398700
     tcgcggagtg acggtcggga gtagtttggc tgcatttcat ggaaaaatgc ggcgtccact    398760
     gccactcggc tgttgatgtt gattttgaaa atcttcccct tgttcataaa gaatgcactg    398820
     cctttacagt gctgaatgtg tgagcctgcc aaccccagaa acttttggcc tctctcgacc    398880
     aagtgtttct ggatttgctc gtgactcgga tggtggcgga gagggtaagc cgcaagagtc    398940
     gcgatcggct ttgacccccg gaactttggc acacgcagaa agattccggc ctcaccgaac    399000
     ttgactccgt cataatcaag gaatnggcat tcgagattaa accacgtctc gtcattttgt    399060
     gttatctctt cacctgcgtc gaatgtgaca catcgcggct cttttgtgcc aatgcatgtg    399120
     gtataaacat ggcaaccagg cttgaaaagc gcccaaagaa ggtcatatgt aatatggccg    399180
     tgttgcaaca ttgactcgag acgctgtaaa gtagaagtat atttgtgctt gaggtgctcg    399240
     atgagtaaga ggagatgctt cgcatgtgcc gactcatggt ccgaactgct atccatgttc    399300
     tctgcacatc tgtcgagctc tgggaggaaa tggaaaagga cgttttgctc gatctaaatc    399360
     cacgtcagtg tgctccttga tgataatact gtctcaatta ccgatggctt gtcctccatc    399420
     aggctaacgg ccttgatgtc gtgcaacacg tctcgcagga tgtcgcgtag gccttccgac    399480
     ttgatgtcta tgaatgacac tacctccttg gacgtcctgt ctgatcatac tattagtagg    399540
     tattcggtcc ggcaagcaaa ggtgtcacat accaacacgt tcacggacaa cgaatgcgta    399600
     ctcagcgtag tcgtccaggt cattgctagt ctccgttggc tcggcaattc tgtatttaca    399660
     tgcttctttg tcccagctag acccgtgtca gctatctgaa aaagtggaag nggtggttgg    399720
     ctggtggctc atacacttcc acaactgttt tgaattggga ttttgatgcc catttctcaa    399780
     acgacttgaa atcatccggt gtagtacaga tctggctttc gatatcaatc tcgtctatcg    399840
     cctgaacatt ctcttgctgt tcattgctgg cagaaagaag atcgaacagg cttagttgcc    399900
     agggagggtt cagctgaccc acattcatcg tgggtgagct tgaccatcaa ctgcttcagt    399960
     cgaaccatgt cgaggcctgg tggggattgg tcctgggaga cgggagtgtt tggaggttct    400020
     tggtcggcaa gatcgagcag cgcnnttctc aagaaactca ccaaagagaa gcatcagatc    400080
     cttcaaggtg gcaggagaca ttgtcgactc ccttcgttgg gctatctggt ggcgtcaagc    400140
     cttggtgact atcaggggaa gtttttttca atgccatatt gtgcggttaa tgactgagac    400200
     tagaattggt tgtcgaaaag gttgtaaaat cgattacaaa ggttgatgtg aatatcaatg    400260
     aaagattcat ggaacggatg aagttgcttt cttttatatc tccgtcgccc ccctctcaat    400320
     ccttgatctg ttgatcctgt gcagaggtac atgctgcgag tgtatgaaat tatatgcatg    400380
     aggggtctca caaatgagaa tgattggctt ggaaattctg caaataataa atggtagatt    400440
     gagtggaaga ttgagtggaa gattgggtgg aagattgagt ggaagattga gtggaagatt    400500
     gagtggaaga ttgagtggaa gattgagtgg aagtttgagt ggaagattga gtggctttga    400560
     aggctaggct aagcggagca aattgtcaag ctgaaagaaa gcagccaaga aacacatgag    400620
     gagcggaccg atagtacgac agacctataa tttggccttg attcacagcg ctcactgatt    400680
     agttagtgat gaatctagtt gattaactaa ttagaatcaa tgtcaactct cagcatcgat    400740
     gggccgggat gatcgataag gccacgggag aatgtaatcc cgctgcccct ccttcccctg    400800
     tcgcgcatga tttatcgtcg ggcagcaact gctcggatat attatttact cttgactatt    400860
     gtcagctttc attttcccag agtgtgggtg aaaattctga aatcaaaagt catttgaatg    400920
     ttttcttgtc taaccaggcg ccttgtccct tccagagcaa accgaaacga ccgtctcgaa    400980
     tagtcagccg actcctctgg cgttgctaac ccagcagctc cgaaagctca ctctgcgaag    401040
     aaggcttctt gttctcagcg gtacttcatc tacccaaacc acatatcggt cagcagagca    401100
     aaccacgatt ctctcctctt ggtctgggtc gcttcagacc acaaaatacg catttcttga    401160
     ttatgtgctc ggtcgcttga taatttgaaa tgtcaaccaa tgtgtgttgc ttctattgaa    401220
     ctgaatactg gcacgtctaa tacgggagac ctttaggtcg gagatgcagc tctcagaggc    401280
     gaagaggaat atattcgagg gcatatattc gatggagtgg attatgagag gcacattatt    401340
     ggcaagggca cccttatcat gatcattcct ccctcggcca gtgaggagga gccnaaaaca    401400
     cacaggaatg tggaaacaga gatcaanatt ccagttccac cgaggcacga ggtcaaggta    401460
     ctagatgccc tagtaatgat gaccacgtag gtttcagttt cagcttttcg agaaactgca    401520
     taccagccct ctgtccaact aacagagtga tggatatatc tgcatttgta tcctcgggta    401580
     tgatcgtcgt gaaacaatca gttgtctctt ctcctgccgc tctttcnatc ttccattgct    401640
     ggctggtttc gatcgccttg tacatcagct ctccgagttg cggaacgagg tccactgatg    401700
     cttccgaata cgtgaacgcc ggttctagaa tgtatttagc tttttgaatt gattgtctgg    401760
     ggtttttttt gctcacgtct tccattgatc aatccagttg gtcgaggcct cgacaacatg    401820
     gctgcttgtt cgtacgtgtc aaacaatgtg ttgtcacttg gtgctttttc tgttgggatt    401880
     tctagctgct gaaacccctc tgagcccgga nctacggcaa ttagcttgat tttctggctt    401940
     tgaaccaaca ctcacgctgt gtagtatctg gcaaattaca ttcaacaaca gcaagctctc    402000
     gtataacagt nccagaaagc cgcgtatcag tctttaaaat gcccccaagt cgatcacggt    402060
     tttgctggtt catattagcg acaatgactt gccccaatgc aactgcacat aagaggaccg    402120
     catgagcgcc gcaatctttc tgcaggctgc gtaaaaacaa ctgatatttt tggcgcttcc    402180
     agctgttggt ttctgtttgt aagattgtga gagcagcccc aaggcttttt ttctcgctct    402240
     tggtaagata ctctcgtaga gatagactct cggctttgtc aacgagccgt ttcaaagcgt    402300
     ccgtcgcact gtacggcttt tgcggtctga catatcgttt tccccccatg ttgagaaagc    402360
     agaagaaact gtggaagagg ggtggaagag gggtggaaga gtgatggaag agtgatggaa    402420
     gagtgatgga agagtgatgg aagaataggt ggaaaagtga gtagaacaaa ctgcggttac    402480
     agcgcatttg accgcgtgtc aaggatcatc aatcacacga gctttttcta ttggctattt    402540
     tgtagagtgt gcacggctcg cttcccttta tcatataatt ggtcatgagg agacagctac    402600
     ggcatctcgt cgctttagga ggacaggaca ctgcagtatt tgctgcagtg atgactgggt    402660
     tatcactcac ataagtgggg cagtcgtcca agatttgctt gaacagaaag accgtgcagc    402720
     cgcacataac ctcggtccac caatcccacg agcactgggc gcgtagagcc gcaaccagac    402780
     ctgctccatg ttgcccacag tgggccaggc gctaagagaa cacttgccat gcgccgttat    402840
     gggtgtaata tggttcacgg aattgttgga caaagttgcc aacatgcaaa ctgtcttgct    402900
     tggtcactga gaaacgcaaa tgtttgaccg tgacgttttc tgagcgctca agccccccgg    402960
     gaagtctaca aatacgtcca aatttcccaa taatctcctt tcatccccat tgagcttcga    403020
     aatccacgac aattacattc ttctggtacc gtatacatcc aacgacgtgg atttatcgca    403080
     cacccgagtt acatcttatc tttgagtgag tatcaatgat catcactaga caaaaaccgc    403140
     tttagctgat atggatgaaa cttacaggca tcatgtgtca gaaacttatt gacacaatcg    403200
     agcatctatg cagacatcga gttgattctc ccgggaggat cagggaactt aatggctgca    403260
     acaattgcgg catcatccag aaaacagagt accttggcaa gacaaccaaa agggacccat    403320
     gcgatgactg tatcgacaac ggtacttatg tgaagagcaa tggggtttgg aagagggcct    403380
     agtgggtttc tggaatttgc aatcctggta aagattagtc tcacacaact tcataaatct    403440
     tatccacatt tcctaaccct tgctgtcgaa ttatcttctc gtggagtctg aatccttagg    403500
     gaaacatata tatcacaatc acgatgatat aaaacctctc caaattccct aaagaggtta    403560
     taaatcacac aaaaataatc aaactattaa aaaagttcca attagacagc cgttgttgag    403620
     ataccaagtt gtaattcatc gcatttactt tatggtgtct tcggggtgga ccactcggca    403680
     gttgaatacg ttaacaacta acctagccaa ttgaaccaat cagaattgat tatgtcactg    403740
     cgcctcgctg gttagccaac tagttacttt cttgctccta tcccttctct cctccaaata    403800
     tcctccaaat actgctgctc catctcacgt caacctttca accatggata tccaacgtca    403860
     gtttccaagt gttcattgga tctggggcgg aggcatctct tttgtttatg aggtccaccc    403920
     tcgcatcgtg gtcaaagtcc caaagcctgg ggaattcgag agggaacaat ttcaaaaaga    403980
     gctcgagata tatcaagtat tctcgcaaaa tccgccttgt ccctctattg tgcagtgttt    404040
     tctcttttcc agcagtggca tcttcctcga gtacatgaga ggtgcgaccc ccattggcag    404100
     ttaaaaggtt gtctactaat ttacttccta gacatatcac tttcttctag gatacaaaaa    404160
     aatcatactc ggaaccagca aactatggtg gttactacag tggaaaagtt ggaacctcta    404220
     cacctacgaa aacaatggat gaacgatctt gctcaagccg tcgctttctt ggaatccgtc    404280
     gacctcgctc atggtgattt acgacctgag aatgttctac ttgatcgcaa ccgattaaag    404340
     ctatccgatt ttgattgtac ggcgaaaatt ggcacaaatt acgaagcttg catggctccg    404400
     tatggccgaa tactcaataa taacgagtca gaccaagggg aatgtggaac tcctggcttt    404460
     cttggccctc gaacagaaca gtttgccctc ggttccttgt actatttgat gaactacggc    404520
     tttgaagttt atggagatcg ctgtcttgcc gaggatcctt acgaacatgg tcctaaggtc    404580
     gtggacttac tacagaacat ggagtttccg aaattggatg gcaatcccct gattgacaat    404640
     atcatcgaca aatgttggca taataaatat gtcaccgttt cagatctagc cgcgcacacg    404700
     aaaacacttt tgaacgaaag aaccgacgtg aaagaaagta acgaaaaccg aaagaaggaa    404760
     agtagcgaag tgaccaccct cgtcatacca attttcaacg aacgatggcg tatgatcatg    404820
     ggtcgcataa ttcatgggat atgttatcgc cttggggtgt ggtggaggtc gttattacag    404880
     agtgtccacg gcgacgcaac tatcatcggg cgagccagtg gcgacaatcg tgattatgtg    404940
     gatcaaaact gcatggaaga tgaatttctt gcgagaaagg aattttgtca ggacctggag    405000
     aaacgtggac ttcttcacgc gctttcttct ggcgagcctg agcaaattgg attcactttt    405060
     gattggtata ggcacagcct ctagggttga ataaccatac aaacttcata ggaatcttga    405120
     ggtttgcagc gatgtcttcc aacgtttgca ggtcggtcca tgacaaagaa atgtcacgca    405180
     tcgctaagtt caaggcatcc agatctctag cgatttccat cttcgtcatt caatagggga    405240
     gcttatcgca accctgctat atacataatt caagacccgt gatttccagt cctacgagac    405300
     ctagagggta gaccgcatgt ctcttgtgga gtcacggcca cagctgcagg atatgtagcc    405360
     cttgcattcc gaccttgcct gggacttcca gttcctcggt ccttgagcct cgtactatag    405420
     cgaacctgga gagaaccctt cgtcctccca gggaaatgtt tcacgatccg actccacggg    405480
     agacctcgtt cttccttcag ttcaatcaac cggtcgtcct catcgggcag gaaacgagac    405540
     gcacgcgctg gttgcttttt gctgctggac tgcgtggcgt gcctcgtatt gtctaggttt    405600
     ttgtcgtaag cgggaacttt ggttggccca tgcggacaag gttgcctatc ttcctgaaag    405660
     gtgcacgagt agataactct tgatagaaac gtttgccgag tgagaaagcc tctgacggga    405720
     atggtttgta tgtcctgcaa acttgtggca ggacgtggat ttgcaatttc ctgttccggg    405780
     gccggcgagg agaacacgcg atgcgggctt tcacgtcgag cctgagcggg ctggatcttc    405840
     gttgtagtag gtcgtctctg cctttttgtt agacgtggca acctggtgat gtcaccaaca    405900
     ccagaatcgt tcccgtccgt atagtcactg tcgtcaggat catcgctttc aacagtgcaa    405960
     gcggaatttg ctcgattttt ccttttccct gtatagcgtg tggagcggga tctagtggac    406020
     cttgttattg ggagtccacg ggaccgggtt acaggcacaa caactgatac agagcacgac    406080
     ctagataaat ctcttggtgg atcctttccc tctgatctgg aaactgcctg ctttttttgt    406140
     tgcagcatag gcgagatagt gcttgataac cttcatcgtc aggacaacaa tttgttgaat    406200
     ggatgtcgtt gccgtcgctc cgcacttcca ggtggctgtc gcgagttgct gaaaggtccc    406260
     tcgcgtccaa ctggatggaa tgtgcctccg tgaccggtag agggcttgat attctgtact    406320
     ctgcaccagt ttcaggactc cacctaaaaa gccgctgatt cgcaggctct ggttcatctt    406380
     cggctggaac aggtgtgctg ggattaggcg atggggcctg atcagttgaa acattaccgg    406440
     ccgccacgat gttgacgtct gtctcgcagc caaaagcgga aagctgggtt tcattgcgct    406500
     cagtgggtgt aggatctgta gccgtatgat aagaagcaat ctaggaaaac actatcacca    406560
     gacaccacta accttgaagg ggacacggct cgttcggtga aacggagcca tcagcttcca    406620
     taggacaagt gggtgcactg gctgctgatg aaaggtctgt cccgggagag tctgatgagg    406680
     cggcggtatc ttgcggcgta gtagggccct ctgagaggat ccttgaatcg ttcgtaaaac    406740
     gatcgtcgct gtgggaggct ccttttaaaa taagaagtca gcacatttca cttatcttca    406800
     acttaacaat taatggcacc caatgggggc ctgagaagct agaggagcca gcaggtgggc    406860
     agatcactta ccaccgtgtt gatcatgcag ttcctttctt tggatgtcgt tgatgtcctc    406920
     tgcttgagtc tcttcggtgc ctccaaagca taattcggga gtctcctggc tcccaaattc    406980
     ggccatttcc aagttggcta attctttatc aaaatcgttc agatgggcgt cgcgatcacg    407040
     acgcacagat gacacagcag gagaaggact ctgtcgacga gggtgacaag tttgcgggga    407100
     ctcgtgagaa aggcacgggg gtcgcggagg tagaggatgc atcaggacgg gctgattgga    407160
     aggagggtgg gaagaaccac gagaagaagt agtcagatgt ggcggtttgc aagggggctt    407220
     ggacatgggg gcagggtggt aatggatgat gttgtccaga tcgatagaga ccatgatttg    407280
     cacgagagac ggagagaatg aagcggttgg agcaaataga aggggggtgg ggtgcactgt    407340
     gatctgaaaa tttggttctt tcgctctcac ggagattcta aagtatcttg tatactgaga    407400
     taaatagaag agagctggaa acacaaattt agcgtccctc tgcgtaggag ggaatccaag    407460
     gactctttat acgcgcctcc cgggtcaccc tctcccttct ttcaacttcc acttcccatc    407520
     cggggcggtt gggaaattgg cccaagtgct gcccgtcccc ggagagatgt gatacaccaa    407580
     cattcagagc aagaatgacc aaggggtcag atggcacggc gctacaacat gcggcatttt    407640
     tctaattgga taatatatag catcgtatca tcaggtttga cccggcctgt ccgtccatgt    407700
     atcgatcagc cttgctgcgc cttgttgaaa gtgggccaga gtcaaacgat cgcccttgta    407760
     gaatagcagg gcgcggccga aggcgtccat tcaagtgagc ggccaatacc atcacggtgt    407820
     tttaggttcc attgcggagt tctccgaggc tgctgtacga ggcaaaaggc tccgcaaaca    407880
     agtgagacac ctggtcattc tgcgccacgg cgtcaagacg aggaatcggc gacagaacac    407940
     cagccaatgg cacacgagta cgccgattag acagcgcacg aaagagcgag agtcggataa    408000
     cgtcgtatcg taggcgcatt tgtgcgcaaa gacgagagtc aatccagtct tctggccaac    408060
     agttgggcac tgttgatgtc catgatagag acggagacat acaggcgagg tggtgggagc    408120
     cggccagcac gcacgtatcc agagggcaaa tcctctctag caaagtttgc ggaccggcaa    408180
     ctgtagctga aacccccccc ccccagggcg atggaccagt agacagcgcc gctggcgctc    408240
     cagcttcagc gggtggagaa ggggcactgc tccgtgtgtg aggcaaccag ctgaaacagg    408300
     gggtccagtg ccgtgtgatc cggaaatacg gtatcatttc acggcggcga ggtcgctggg    408360
     cccggccggg cgagagggaa gggtagcaga cgagagcgag gacgtcgagc gacgcaccga    408420
     gttatatact cgcgtcggtg gggcaggtcg gcggtggagg gaggccgacc ccgattcggg    408480
     gaaggcgtgg gccgctaaac cttccttgga cgtgctaagc ctaaaaaaga tgagatggat    408540
     ctcgatgcca ttttggggct agtgccgcgc caaaccgctt ctggacagac taaacccgaa    408600
     cggggcacct gggggccaac gccaaacccg atccaggggg gcgccgaatc cggccgcgcc    408660
     ggcacaaatg ctttttgtac cactttctct atagtgtata ttaatagcta ggtatctctc    408720
     taagatccct ttattagaga tattaaaata cctagaaata gtagttttaa aatgcttaat    408780
     tatatctccg gatagagata ggactagtag attattaacg tacactataa tatagagact    408840
     atcctttata aaaattgaat agtctactta tatacggtag aatcctatag aaattagaat    408900
     gttataaagt agctaatacc acttataagg actctatttt agtctataaa tagtttttta    408960
     aagcaatcta ataaattaat tagtaggata gttatcttat atacccttag gaagttcaat    409020
     tttaataggt tcttttagct ttacgtaaag gaacgtagtt ataatatcga tatagtgtaa    409080
     gagctagcgt ttagctatag caatagtagc aaagatttta aataatatta gcttagtaac    409140
     gatagcgtaa accttataaa aatcaaggtc tttcacttac tagaaaccgc gagctactaa    409200
     acgagcttta taggtcccgt tatatttaat tttaaagacc tagcgaagcg taagaggttt    409260
     atagccttta tctcttactt tcgagcgaga gataactctc taggtcctat ttttgttata    409320
     gcgggagagc tctttatata tagctactaa ctatttatct ttttccgcgt aaattattgc    409380
     ttctttctat ctattaggtt taaaactaat atcctatagt tttaatttag aaggtgcgta    409440
     ctactcttta gaagtgatag cggcaaaaag ctttattaag atatctaggg agctagtaag    409500
     aaattataat atattagtat taaagaaagt cctagaagcg agactattaa gataggccta    409560
     ggagggcttc tttagtctag ttaaacgtct taggtctata gatatattaa tagggataga    409620
     caaagatagt ctatatatta tatccctagt attattatta ggaatctagt ctataaagga    409680
     atagtcttac taagaagaaa tctatatagt atcctgacta gtataactag tagtagcttc    409740
     ctaagaagaa gactatatcc ctaaactact attttatacc tctactctca aactaatact    409800
     acccgctatt ttaacctaat tatcgtcgat ctcgaaggta tctagattta gaagtcggtc    409860
     ttctatttcc gaataaatcg ggatcctata attaggatat tcacgaagta gagcggtatt    409920
     agataaatcg aggggaggac tcgctagtct aaagaggtct atatcgtcta tatcttcgac    409980
     tataggaggg ggtagtaaag gggttataaa acgttaagga atagcctaaa ttttagtacg    410040
     aatagggtct ttattatata gaaacggatt actatagtag tcgtatttat taagaaaatc    410100
     aattaggata taatagttag agagagatta aactatacta ccctaactag caatattaag    410160
     attataggta ggattaggaa gatcctttag tgttagattc ttattaaaaa taatatttcg    410220
     agaataaata ttcttcttag tgcggatatt atataatata tagttatctc tttcgttata    410280
     agtaataaac cgagtttctt ctatataagg atctagcttt atagctcgct tctctttagg    410340
     aattaggaac tagcactagc acctaaaggc gcgtagatta aataaatcta gcttctttct    410400
     atagagagct ttatatagcg atatactaat acgagaggta taaagtctgt ttatagtata    410460
     gttcacacta ctaagaagat aaccctagag gtattttaga agctagtact taattataac    410520
     cgctataagg ggttctataa gataacggtt tttaatttcg gtaacgctat ttagctactt    410580
     tatatatagg ggggtagggt cctatataat accgcgagaa gagagatagg tagtaagggg    410640
     tttatactta ggagtattat tactatacac cttctttact ataaaggaga attaagtctt    410700
     taaatagcct tctagctata taaatttctc tataacttta gctctagatt ttagtaagaa    410760
     gagctaggta aaccgggtag tattattagt aaaagtgata aaatagtgct ctctactata    410820
     agatataatt aagataggcc cctagacgtc gagatagata aatttaccgg gtttagacta    410880
     gatagatcta actttactaa aaggtaaagt ataacctttt cccttaatat agggagtgta    410940
     taggaaagtg acgctagaac ccggctttaa tataatccta tctatataaa tttctatctt    411000
     ttttatatag tcttcgctag tataatatat atatcggtaa gtaagatcta tagagatagt    411060
     agggatagta gaactaggtc ttcgtactat aaatatagag tttagcgagc cggtaagaag    411120
     actaaaatta tagtctagta tagtcttaac cttattaata ctattatagt ttaactagta    411180
     gtgttctctt tcgtatatag tataactaat aatagactct atactagtag tatcttaata    411240
     cttaaaagtt ataaaaccac tcttagtcta ggttctaata ttatccttat ctaaggtaga    411300
     tatagaaatc aaactagatt ttagctctag agctaactat acctttctta acgtaagaga    411360
     gggaagggta ttagtctaat cctagtttaa aagttatagg ataatatctc tatagccttc    411420
     ggtgtaaaag atatcaccta tagctataga gataggcaaa atatattatc taaaattaat    411480
     aaaaatagac cgataagggg ttatatatat actagtaccg gaatcaatta tctatctagt    411540
     agtatctcta ccggaattag ctattaatcc ttctttagat attatatata cccccctagg    411600
     gatataaatc cccctaggga tattagttta aaatagtgta ttagtaaaaa ggttattata    411660
     ataaaagaag gggtctcccg aggaagggcc ttactaggga ggaggagtag ggtagatagt    411720
     attagcttat agtctctact actaagatag gatcgaaatc accctacttt agctattaac    411780
     ctagcctata atctaactag gttatagaat agagatttat tagggttatt agaaactaaa    411840
     ttgctactat tagatagatt actactatta aggttattag tagatagtat tagtagatcc    411900
     gctagctttt aaataatagt ttcgggtata atagttccta agtgtattat atatcttaca    411960
     ctagattaaa tccttcttat cctttttatt taaagactac ttatctttat tattagattt    412020
     agacttatta ttcttcttct tatctttctt agataaagta ttagagttta tattcgaatt    412080
     agtattcgaa atagtagata agtcctttat agatatcgta ttagctaaat agtttaataa    412140
     actagaattt aaagagttta taatataatt agaaccctct attattataa agttataata    412200
     aacctccact ataaagttag ggtcctttaa atccggtctt aaattttaga taaaggtata    412260
     atatcgtaga ttgccctaaa tagccttaac gaaaaaatta aggactatat ctagtggcac    412320
     gatagagttt cgttactaga ttttaaagag agcttcttta aatttatata cgaattctat    412380
     aggattatta tttttatatt ataaattaat aaggatctta aagcgtttaa aattgcctta    412440
     ctataataag gtgccgtact ccgtacgaag gtacttatat atatctcgta ggttattaat    412500
     attttatata taagaagtag gaatagcttt aagggtaccg aaaatttagt tataacaata    412560
     aatattaata gaatcctact tattaacgag gacttagtat tcctttataa gctctttatt    412620
     ctcttacttt tgctttcgaa taagctctcg gataagagct tcggagatag gaataggtag    412680
     ggtattagtt cctaaagtaa gagtagtagt agttatatta tactaagcta gttctcgtag    412740
     ggtatccgga gatttatcac taaggtccgg tagggtaggt ttagtgatag tgccctagat    412800
     aagcttaata tagatcttat tatttccccg aagggatata tataacctat actactatta    412860
     ggcgaaattg gattcaccct taagctttag cacaattttt gtgatatcgg attccttcta    412920
     tcgatcgaaa tcgtagggag tcgatatagt gatagtcgat aggtatcgaa cggttataac    412980
     gaaagggtga taaggttaac gaacggtctc ggaacggtct ttaatagtcg taaataaagt    413040
     agaaataata caaatagata aaatctagat atagataaaa tagtgagttc taattggtcc    413100
     aattagaata aaaattgctc ggaagcgggg tatagatcaa agcctcgatc tggaaaaact    413160
     ctgctacggg cctatataga gttttcttag cgtgacgcaa cttcgccaag aagtgaggta    413220
     aaaacgggga attgaagctt attgtaagaa agaggcttca atgacaggcg ctcataacct    413280
     gatagagaca gactacagag aaaaggtagt gtgctctaga aaatagatag atgcgtgaag    413340
     aagagaagaa actatctaca ggtgagctag ctaaagtgtg agggagcatg tgaggaggtc    413400
     acgtgacctc caacacctct accattgacc gctttgctat accgcctgcc tattcccact    413460
     agtataaacc gcgcgcgtag tatactagta ttatactacc cctttccccc ccccccccca    413520
     cccttttttt taaaaaaaaa aagcagagat tataccgtac cgagtggaag aggttcttag    413580
     tgtgaaggct ggtatatttc ctaggtagtt actagctagt tagaaaatat gagaaatttt    413640
     accggcagaa aaagagtggg gcctaaagta ctagggtgca aatactcatg caacatgact    413700
     gtagatatag ggaacattga agttttattg taatgttcgg ataactgccg cccctagagg    413760
     ctttcaggca ttcagtccta gaaacaccga tagagtatcg ggatacgaag tagctacgta    413820
     tgtctctcac ggcatgaatt tgttgaccaa tacaactatt ggactccagg atattacgtt    413880
     gtactgaaac ggtggtggtc agaaacaacc tgagtgtcac cattccttgt agtatgtatg    413940
     gaaatgctgg ccctgcagaa atattcgcag gacggccatc ctcacaactt ccgctctatc    414000
     agatcgcagc actgaccaag tcctcgttat atagccgtgt tattggtcat aaaggggcct    414060
     tacgagacca cgccaatcac tgcggtgatg tttggaagcc acgagcgtca caccgctatt    414120
     cgatatgatg atctaggtag actgtatata tgtatgctcg gacgataaaa ttacgacctt    414180
     atatgccaac ttgaagggat ttgtgaggtc agcaattcat gtttaccggt aacttatagt    414240
     atgaatttta tacacgtacc gacgtggctg ctgtatgtat tcaatacgcg gtgtaataaa    414300
     atacgtaacg ggttaactta cctggcttca agtgcttgta attgccgggt gcttgtaatt    414360
     gccggggaga gcttcacggg catggcaaga aaactagtta gatggatcat acctaggtag    414420
     tttgctatgt cttcttaacc gaattaagga tcggagaagc caatgattat tgcatcacta    414480
     gttatgaaaa tagggaaggc atcattattt gacaaatgtt ccagaaagtt atttatcgca    414540
     attatgatgt gacctggcca ttcctagcat agctatattg ttgggggtag tatccttagg    414600
     ccagaactgt ccttcctagt agtttagtgc ttgctagctc tctctcttac acctccccgt    414660
     gtctcttctt agtctagcag cagccaatac cattgatatt gcctacatgt ttattgcctt    414720
     cgatattgat cgaaaggcca cgcaagaagg aacggaaaaa gtctgtcatg cattccgagc    414780
     gaagcccaca tagagagtga gaagacgaga gaaggcgaga gaagaagaga gaaaggaaga    414840
     gagaaaggaa gagagagaac ccgctatttg gtccttcacc cattgatggc ctcaggcata    414900
     ttacagatat atatggcttc taagttccga tgttgggtca ttggtcattt cagcagatgt    414960
     cagatgttgt gtcgactcta tgttgtactt tctcgcgtat aattatgccg tcacatgcgc    415020
     acctcgaggg ctaaatgacc tgcttagcca tgtgtatacg tctgactagt tgacagccac    415080
     acattgcgct attggacttc agagttgttg agggctacga tactggggat ggggaaaatc    415140
     gggaagaaga aaggtgtgac aatgaatcta tggacaggag gcagtatatg aagcccccat    415200
     gaacaaagag aaaggcaagc taggcaaact agcaaaaggc tcagtctgca cagagacaaa    415260
     gacgtaaaga catcccatgt atgtcaacaa gagtggccaa accttgcacc aatgatgaag    415320
     cctcctaaag gtccgggtaa tcaatctgcg gctgaaaatc cccaattatt gggttttgct    415380
     ttttccatca atcgaacagg tcattctatt ggttgtactg ccaccacgat caaaagcaga    415440
     tccaatccac tcctagcaca acatctggac tttcctgttg ttgggaccct ttttgtatag    415500
     attctattgg atggtgtggc gtgattctca aatccaagaa cttttagata atggagggtg    415560
     cgaaatcagc aagggatgtg gaagccttgc ctccctatgt ggatcacgct cagctgaaat    415620
     cgctgaaatc gggagatctg ccgtcgaact ataatgtaat tcgccattta acccaatagg    415680
     aagatgccgt gctccgtatt cttgcagtca ttgaaagggc tcagaaaacc ccatcagccg    415740
     gttctatcaa gttttgggtt tatttttgcc catttgcccc ttttttttgg ccccttcttg    415800
     ctgtgccaaa gatgtttaac tgaatctctc ccgtctttgg cttcggttgc cgcaggaaga    415860
     atcccaatac gaaattgttt gtgagcggta tccagttctc caaatgaccg atcaagatca    415920
     ggaggcactt ggtgcaagtc cacaagatga agaatgcatg actaggtcga gtggtctcca    415980
     gataggaaaa cttgccatcg gatcgcttct attgggtgag ttgctgcttt ctaacaggat    416040
     ggccaaatat cgaatgctaa ttcgagttgt acagcttgct ttctagcaaa tgcagatgaa    416100
     tcctttgtcc tcaccactgg gagtgatgtt gcctcggctc tcaatgcatc cagctctgcg    416160
     gcatggctca tcaccgggta caacttaggc tatattcttg ctcttccgat ggtaagttcc    416220
     gatcgtcaac atttagaaca ataactcacc actgcgctgc agtacgggca aatatgtgat    416280
     ttgactgggc cgaggaaggc aattattctt gctttgacgg tatacggatg tggctgtctc    416340
     atgacgtggg tttctccgat cacaccttga atgagttcat catttaacaa tttgacagag    416400
     gagtctcgca aaatatttac tgggctgtag ccggtcgtct catttcaggg tttggcggag    416460
     ccggaatgaa tgagcttgtt tctgttattc ttaacggtat gtctggcttc tcccgtttac    416520
     ctctggggga gacatttgct aattccatct aaacgacaga aatccatagc tttgaccgcg    416580
     ttgccatgtt acgctcctat gtatctaccg tatcaattat tggagttacc tgcggcgccc    416640
     ccctgggcgc ctttctcaca agctggattg gatggcaatg gtgagcatcc acgactcttg    416700
     cactcggtat actagataag catgattgct gattgtctga tgccagggcg ttcctgatcc    416760
     atattccatt tgcaatgatt tgccttaccg tcatctcgct ttctctttcc ccaacaaagc    416820
     ccccgccgct cacctccaag tcatcatatg gatcgattca aaactgcaag gcctccgaaa    416880
     atacccctcg caagtctttc gatattttgg gcctcatttt gctgtttata tctattatct    416940
     gtttcctcgc ctttgtgcaa ctcacccagg cagacgattt agaaaacaag tcaatacttc    417000
     tgactgtttg tgcggcagcg ttcgttggat gctctacggc cttctatctc aatgagtccc    417060
     gttgggctca agagccaatg attcatttct cattattcag tcccaataaa cttggcctga    417120
     tatatggtgc tcagctgtta ctcggcattg cacaattttc tgtgcgttct ccccttgctt    417180
     tctcatcggt tcaacttgtc ggtgactgat aattctcttt ttggatcgca gatgacgcct    417240
     attcttggag actattgggt cagcgctcga ggattatctg cctcacaggg tgcaatgtgt    417300
     tggataccgg gtaccaccgg gtttgcattg ggttcattgg cgactggcaa actaattcaa    417360
     aagtgggtat tccaggatga gtcccagcaa gctcaccaca atatggcatt tttgctaaca    417420
     tcaagttgga tcgatcagaa cccataaatg tgttcgatgg acgattgttg ggttgatgat    417480
     ggcgatctta agcttcgctc tgatacttgt ccgatggact atttttgaac ctcaactttt    417540
     cgagataata tacattttcc caggatattt cggcatggga atggtcctat cttcgcagtt    417600
     tgcagcttta gctgccgcaa gaccggagca aaatgccgct acttctgtca ccacgtatta    417660
     cttcgcacag caacttggat tgatgactgg tattaccacc gtgaaagcat tacttatcaa    417720
     agaaatgaga cgtggtctgg atgtgacgct gagaggtcag cctgggcgcg ccggggtaag    417780
     gccgaggtct tttattccat cgctatgaag ccatttttca ctaatagcga gtagttgatc    417840
     gaccaaatca tgaaacaccg acagatcaag ggcttactgc ctcctgcact tgcagaaccg    417900
     gtgcgccttg tcatacaaaa atgttattac gtgtcaccag gtaagcactc cagggctcta    417960
     ttcatccagc ttgaatgtgc cagcaccata ctaactagta tactatcata gccacttcac    418020
     ttgtcttctt acttctcgca tttttcattg tgctcaagca aagggagatt aagacgttct    418080
     gagcgcataa agcagaacgc gacagccatg tcccgccacg ggcctcgagg atctcccacc    418140
     ctttgcaagt aagtaatcgg gtacttgacg caatatgatg ccgtatgaag atttcggagt    418200
     atgccaggta ggacggtaca aggacaggcg tcgcattgaa gcttcttatt gtgagcgaaa    418260
     gaaaaagaaa tccgccccaa gattgtttta tcattgtatc agaaaggttt gaaattggga    418320
     agtcaattta gttaattgta tttaaagctg aaattcaagt atcatagaga taattccaaa    418380
     agctgcacct gcgctgtgtc ttctcctgat gtctagtaat tctgcgtttc gtttcctcgt    418440
     ccattccatc gagttgcttg ttccactcct ttaccacgtc aatgtagatg cgaggcaagg    418500
     ctgtttcttt attctgccat ccccaccacc ccacagtcca gttgccaccc tctgccaagg    418560
     gacgttcagc agacggcaaa aagccattag agacagaaga atattgatgc taccagcaaa    418620
     gaatgggtca gtccggtctt ttcgaaccaa cagttgacca aaatatgcac atgggctccc    418680
     gtgcaagatt gaacagtcct cacccaggcg tcgatagcct tatgtggaac acggatgaaa    418740
     aattatgcat gtcgaacagg cactggcaga gtatcgaatt gagagcgatg tttgcgctgt    418800
     tgggctcagc tttaaggatc ttttttggtg gccatgggag aaattgccca gccaggcttc    418860
     agacacgaac cagctggcat tgttcggacg attggatcat ccgtcggggg cttcctgcca    418920
     ggagatcgag tggtaatttt ttggatatcc tttcccgggc agaatgggca tctcgtgcag    418980
     ctacagtcgc atccatttgg atctggcgat taagataccc aaagtctcag cttcgaaatt    419040
     gccggactgc cagtcatcta tggaacagtg atctattcct tgactcattg ctcggattcg    419100
     tgctggtgat aagatcctga ttcacgctgc ctctggtggc atttggcagg ctgcggttca    419160
     atacgcaaag gtgaagggag ccgaggtctt tgtggctctg tcaggcatca aaaagaaaga    419220
     attcatcatg aagatatttg ggattcctga agacagcgtc ttctccagtc gtgacttgag    419280
     cttctcgcgg ggaaccaagc gcatttcccc tagaggtgtt gatattgttc tcaactcact    419340
     gagcgtcaag gtactgcgga aatcttgggc ttgcgttgcg ccatgattgc aagcattgct    419400
     tcgatgagtt cactcaccaa ctttggttga aagcatgggc tctcaatcat ccagtggcat    419460
     tacagacagg catctaacct ttttttattc atgtagcagt cagcctcctt ttatatcact    419520
     ctttctgcgt atcatttctc gcgagttaaa agaacctatg catagacttg gtacctaggt    419580
     agctcctctt agctctcatc ttctccatca tctatcctcc attgcgttag ctaataccat    419640
     tacctttggt ttatgttatc atccttagga gataaatatc cgaaagacaa agatggccgt    419700
     gctcttaagc ctgtctacac gtgacgcctc catgtctgct cgcgtatcga ggggtcatac    419760
     agggagatgg aagagactcg ttctattcaa actagcaaag ctaatgcctt ttatagactg    419820
     cacaggatgg gatgatccca atggggttca tatacatttg caaattgcaa aaataatttc    419880
     cgaaaatgga aaggcttggc gcaaacttcg gacagcgcag ctcatcaact tccctttacc    419940
     ttgtcgcttt tgacatatcc catctaccat acctgtcact cctggcgctt ccattgccgt    420000
     cgcctttccg ctctctgttc tctttacagg tcccatctcg caactctgta tcgttgacgc    420060
     gaccgtgaaa tatccccagg tgagtgctca cgcaaaacac ccctcactac atcttgttat    420120
     tgcgcaaata cccattactt ctttggtgta atgtgcatgg cagctctcat tttgttgttt    420180
     ccaagtttct acgtttgttt ttgtcgagtt tccgagaaca aatgaaggag aaggtggaca    420240
     cgtgcaaatt ggcagcgtac caccttctcc cgcatgagtc tctatagcgg ggttttttag    420300
     aagccatgct ttgtgtgaca tccggtgaaa gcatgtgtgc tccatgatca gtgatcctat    420360
     agggacaaat gtgcttgctg tggttttgca gaatgcgccg gcatccgggg cctataaaga    420420
     ccctgcactc taagcctttg aaatgacata ctgacagttg tggctcatag gtcgcctata    420480
     actttctttc ccggtcctct attaacctcg tcaagcactt tggtcgcgtt atccctctac    420540
     cccgcatacc atggcgatgg acgccaaaga gattgaagct aaggccaagg ccttgggcaa    420600
     ggccgcgaca tcgaacgagc ctccagccgt gattctgggc ctcctgaagg atatccaaac    420660
     cggggtccgg gcaaccgagg acctcctccg acagacgcgc atcggaatca tcgtcaacaa    420720
     gttcaagcaa agcaagtctc cggaagtcgc gcggctctcc agcgagattg tctccaagtg    420780
     gcggaccgag gtgaacaagc agaagcaggg tggtggttca gcagccagtc ggggctcgag    420840
     cggctctccg cgaccagcgc aaaacggtac aggggcgtcc accccagccg ctgctacacc    420900
     ctccgacaag gcgtcgaagc tgtccgtgcc tccggataag cgaacctgga aggcagacgg    420960
     ggcggagatc aatcacaccg ggaatcgagt gcgggacagc tgcacggggc tgatgtatga    421020
     tggattatgt gttgggtcga ccgagcctcc gaaggttgtt ctatcgcgcg ccattgcagt    421080
     ggaggtttcc gcctacaagt acctgggacc ggagacgaag gaggaatacc gcacgaagat    421140
     ccgcagtctt ttccagaacc tgaagaacaa gtccaacccg aagctgcgtg tgcgtgttat    421200
     cgagggagag attaccgctg atcaattcgt gcgcatgtcg cacgacgagc tgcgctctgt    421260
     tgaacagcgt gaggcggatg ccaagattca gaaggagaac atggacaagg ctatggttgc    421320
     ccagcaggaa cgcagtatca gtaagagttt gcagtgcggc aagtgtggcc agcgcaaggt    421380
     tacctacacc gaagctcaga ctcgtgcggc tgatgaaccg atgaccctgt tctgtacttg    421440
     tctacactgc ggcaagtcct ggcggcagtg agctcggggg gacgttcggg agctgcggga    421500
     gcggaaatgt attattcttg ggacctggtg tttctttctg ctttcctttt ctctttttcg    421560
     tgttttgatt cttttttatc aagcgtaggc tgtgaaagcc gacgctggag ttctactgtg    421620
     ggccttcgat ttcttccaaa gtttcttctc tctacatctg tttcccttcc gggagcgaag    421680
     ctcgtctggg caaatagaaa acatccgtga gctatctacc aaaatccaga tatcccaatg    421740
     atcgatcgca gcatttgaag tcttacctcc ataaatagtt gttgcgatac tacctaaacc    421800
     gtatgtagat atcaacaaac acaacgtcac atttatgtca ccaccgccgc tatggatcag    421860
     acctccatat atccaaccaa tcctcccaat aatcacatca acacctcgca agccatcaag    421920
     gattccccaa catgatcaca cgcccagatc tcctaaaacc aatccatgcc ttcctagaag    421980
     ccctaacaaa cccaaaccca aaagacccca atcaactcct ctcaaccttc acaactctcc    422040
     cacaacctct agtccacgaa cacggtctcc cgcaactagc tccctttcta ggtcgccaat    422100
     tcaccggcca ggatgggata gcaacttact tcgagcttct ctcctccctg ctgtctatca    422160
     aggacatggt cttcgagccc gaggagagct gggtggttga tgcgagctgt atggctgttt    422220
     cgctgcgcgg gacggcaacg ttcgtctgga agcagacgca gcagtcatgg gacgagacgt    422280
     tcgcttatcg cattaagctt gctgctgatg gtggtgggtc cggggagacg gggaggttgg    422340
     cggtttgcga gtatcatgtt tgggcggata ccggggctgc ttaccttgct agatgcggga    422400
     gattggggga tttaatggat ggtgatgaag attttgagcc ggaggagggg atcgcgtaag    422460
     aagatatata ggtagatcag ccaaaagcca agatacaccc cggaggtagt accaatcatt    422520
     aaaaggagtt tcattatctg ggagattttt ttctggtcta catagcgtcc aggtggtata    422580
     cgcgtattct ataccatgtc tctgccgttc tcgccacatt attctataag gccggggcag    422640
     tctatccctc gaagacgctg tggttaagct ccacccctat atccttagcc atattctgca    422700
     tctgggcctc tatatcatcc tccataccac cacccagatg caagaattgg cgcaccttgg    422760
     tgaaatagaa gaagatatca ctgctaaaca gcacgacacg gaagataaaa tggcgaccga    422820
     tgttacggat cttctcggcc agcggcagat ccggcgactc gataagcgca cgcgaagccc    422880
     agataccagt aatcttaaca cggttcaccg gcgagcccag gaactggtta ttcccttgga    422940
     cgatgcgcaa gttgcgaccg atgaagatca actcctgtgg ccacttggtt tcatcgccta    423000
     gtatatcgcg gatcgccttg cgcatcccct gctgcatctc gtagtgtcgc tctgcacgct    423060
     cccgcttgct gagtcccttg agaccgcgct gcgtagacat gtccccgcct ttgtaggggc    423120
     gcatcaatgt cgctgacgcg aagaagtctg ggttattcac gccccagccc ttgacaatct    423180
     cgcccagcgt gcgattatcg aaggtgagga gggctttcca gaaccgcgcg tattcgtgtc    423240
     ggaatccggg ttccatgtga atgtacaaac cgtggtcgat cagaaccagc tctggctctc    423300
     cggatggctt gcggcggatg aagatattgc ccgggtgcgg atcgcagtgg acgtatcccc    423360
     acaggaacat ttgggcggag aacaggtcta ccatagttgt catcacgtcc ttgagagaca    423420
     gtcccagtcc accgcggttg ttgcggcctc gccagtaagt gcggtccggc ttggtcctcg    423480
     acgtgctcag gtttcggtcc gcggaatttc cctctggccg gtcaagcggt gtaccgtgac    423540
     agcctggact tccctggccc cagccgccgc gccagggccg cgtgatggcg tctttgtccc    423600
     agagccgtac gccttctacc cattcggcag tcatgactcg cttcgagctc agttcgcgat    423660
     acacacgagg aatatacacg cgattgcgca gacgaggttc agcggctacg agcttggcca    423720
     tgttctccga gttgtctgct tcattcacga agtctgtttc aagcgagagt ctctcactga    423780
     tatagggaac aagactgtag aaggggatgt cgaacatctt gctgtagata taggtcacga    423840
     ctctataatt tcaatgttag cataatatcc cctcacggct cgaactcgga caactcactt    423900
     gaaagcccag agatcccacg ccaattgctg cacgatctcc cgcttttgga tcttgatcgc    423960
     gacctcggtg ccatcctgca gacgagccca gtggatctga gcaacactgg cactggctcg    424020
     ggctttgcgt tccatcacgc ccttgtcagg ggcacccgta aacgagatac cgaatacctc    424080
     ctcaggcgac ttgccaaagt cctcacggat gactttctca atatccttcc agtcattttg    424140
     aggcgcatca tcaaacatgc gggagaacat tgcctggaac tcggggggca agatggctga    424200
     ttgcatcgca atcgcctggc ctatcttcag gtagaggccg ccattatgtc tcagtaggtc    424260
     tgacagccgc tctgcgttgc gggcgtgcac ggcaccaata gagctggcca gtggcgggtg    424320
     tgggcggaaa ttgatcttgt agtcgagggc gaccaagatg ccgagggaaa aggtccgggc    424380
     tgtccgggtc agcgacgagg cgtagaactg gctgtcgatg ccgtatgcga cgcctgttgc    424440
     tagtgagacg taaattattc ggcgtaacca tctgatggtt cgtttgtatg tttttgcttc    424500
     ctttggtttg cccaaggagc ttggtgacgg tggcacgaag ggttggaact ggcttgaatg    424560
     gacatatcgg tgcgggcgcc agatggaggg acagatgccg gtgggccgca gagagcggag    424620
     gaaggtcgtg tgcgccatat gggattgcgg aaaggcggaa aggcggatac ggaatcactg    424680
     catggcgttg gaaatcaaat ccagtctgat ctgaggtgaa gacagagtag tgagaagtgt    424740
     caagtgttaa gtgtcaagta agccctggag atgttcggcc ctgtcgtcat ccgcggtagc    424800
     tccgcgtgga gtcggagtcg gagggattca gcaatgccct tattttatct atgtacacta    424860
     ggtgataact atgtgatatt aattacatgt atagcactat ttacagttat atccaggtag    424920
     gaatcataat tcatcatggt cataaggccc caaactgcca cacactttcg cataatccct    424980
     catattctga gggatcgtag tatcccacag ctcatcgccc tccaagaacc tgagttgttc    425040
     cttgcacgat tcatctgagg ccattggtat cagagcagga agatgtttga tcgaagcctt    425100
     gaggaaattg cgcttgaagc agttgccgaa cccagccagt gtctccgaat cagagcagat    425160
     atgtactcca ccacccagca ttggtccaca gctttccttg atgctgaggg caacattgtc    425220
     gcccatcttc aacaaagcct cttctttgtg tgggacattc atgcgctgca ccaggctgcg    425280
     aacggcgggg acaaaggtgt tgttgcgcgt ccatagatcc cagtgaggga cagtcggctg    425340
     gcatccagca tcacagattt cactctggaa tttatcgaaa aggtatcccg gtcggctaac    425400
     cagcgcggag acgactttga agcatgaggt gccgattgct gtgacggggg agaagaacag    425460
     gacgaggacg agaaagaggc gatcgaggaa aatacgcatt atgtgggatg gagaagacga    425520
     cctcggaaga ggatgaggaa tagaagaccg agatcgacag aggtcttcta gctttctttt    425580
     tcggtcaggg gaagagctgg aggtgagatc tgattccccc gcatttgtgg agaactcgga    425640
     acttctgtca tcttttgata ttcgctgacc agataggatt catcttgaaa tggatttgga    425700
     tactcgccat gatcctttca ggtatatcta tttcctttcc cttgccctga tagccactaa    425760
     ctatatatct agtgacgact ctgtggaaat gcccataaac ctagaagagg tggactccct    425820
     cgaagctatt gttatcatcg acaatgagct ggatccgctg tctcccccag ccccagatac    425880
     cgttcaagtt tcggggaacc tgggggcaat tgccatgggc tcgaagcata cgttgacaga    425940
     tcgcggggat gcctgcaagg aattaaggct agaagatgtc tgctgcgcag cacatggctt    426000
     gtcaattctg gtggtaagac gatgttctac cagtagactc ttggatacgg tttgatatta    426060
     agcctattat atagactgcc actaaaagcg gcaagaagca cactattctc ttcgatgctg    426120
     gtcccgaaga ggaagcttgg gagagaaacg tgaaacggct gcgaccaaat ctctcatctg    426180
     tggaagtgat tcatctatcg cattggcatc gagaccactc cggttcgtga tccgtaatgg    426240
     aaatggacac atggacgcat actccctttg ggctgttctg acttttgcgc aggtggtctt    426300
     ctgcgggcaa tccgcatgat aagcgatgcc aaacgagccg aaagccgctc tggagacctg    426360
     gtcgcggact tgcacccaga ccgaccggtt tacagaggca tttctctgcc cagtcatatt    426420
     atttccctcc aggctgaccc tacctttgag gagattggaa atgcaggtgc ggtggtcgat    426480
     aagcggagcg agccacacac tgtgctagat aacttctttt tagtctccgg ggagatccca    426540
     cgagtgacgc cgtacgagac aggtctgaag aatgcagtac gatacgatcc tgatgagagc    426600
     gattggttct ctgacgaagt catcgttgat gagcgttcgc tcatatgtaa cctcaagggt    426660
     atatgcatct taaaaacccg gcacacaagc ttattgaact aacatattct tcagggaagg    426720
     gacttgtggt tttcactgga tgtagccacg ctggcgtagt aaacaccacg aaacacgccg    426780
     tcgagctcac cggtggaacg gtacctgttc acgccgttgt gggtggattt catctcgcca    426840
     caagcgacgc ggaccaaata caagacacag tagccgatct taaagggctt gatcccgccg    426900
     tgctcatgcc gggtcactgt tcaggctggc gggccaagtt tgcgattgag aaacacatgc    426960
     ccgggtcatt ggtaccctgc actgtaggat caagaatcac attctgattc gtgttgtatt    427020
     agtttcatct gatacattga tactctttga acccgttcct tacaggctcg ttctccacgt    427080
     ggatgcaggg tcttggtgcg aaaccgcatg gcatgggttg ctcggagcaa cgagtctcat    427140
     caaggggcaa tctcgtcatc ggctcggcat aacttgttga tcggattctt gttcctgaca    427200
     tcactctatc tccttgctgc attttcctgc gatcggaaga atgcgggata gatgcggatg    427260
     actgtttcta ggattatgat actaggtagt gagatgataa tgctaataat aatgatactg    427320
     aagcagatac agtcaagtag gcgctgatgc ttgtgagcct ggttatagtg ccaggttcta    427380
     tgacagattc caatgatata tatgatggga aagaattaga ttttcaatac acattctcaa    427440
     taatatataa tatcaagaaa tttggagccg catgaaatct gtagttgggt agtcgaacct    427500
     gatatatatt tacacccagg agcaattgtg tgctaacaac atttattttc ttccagtcta    427560
     tcggactcgg ttcctagtga tatataatat cacatatctg cggaagcaat ttcaatatat    427620
     atgtcccagg aacaatgcaa agtagacata agttatatcc aatacagcat caggtcttca    427680
     ctgatctcgc aacctcatgt ccaagtacca tttccgtgca cgtctagtca tgtgtccatg    427740
     tctagataag tcgaaaaccg cctcaccatc cacgagatac aaaataggat acagtgtaac    427800
     ctccagggca gtaactacgc ccaaggacgc ccaaggacgc ccgaggtcag ctggactaat    427860
     cttccacctc cgttgtgcat tgttctacag ccaagatccc ttggaagtag atatctaccg    427920
     aatcttggag gcacagcata caaatatcaa gtaaaacagt caggcctcgt cttggccgga    427980
     gaaaatccct cagcggcaga gtcagcccaa gcattggcat agcgacatga acaaatctaa    428040
     atgtgcgccc ctgacagcgc cacgcccctc acaggcgaca cctccgataa gaagcacgtc    428100
     cctacatatg tactgatttg catgactctg taccccgttc gcagtacaag catgcacact    428160
     gcccccgcca agacgcaaac acaacaagca ttactccgta ccaacaccac ccttgcgctg    428220
     gttgactccc tctcctctcc accccgcccc acgatcaccg aagctcgaat ccatgacctc    428280
     acgccgactc gatcgagaaa aaaggggctg gtcagaggtc aaatgctcgc caaggcgata    428340
     atgcgggagg aaggtatgca cggtgtggct tggcgtcggt ggacaggtac aagatgaggg    428400
     cgatcagcag atcaaggggg ggaaattcct atcatggtct ttggtgcgat aaggaaaaga    428460
     tacttgacat cattcaatga ctttatcgca tcgtccttgg tataataatg tagactcacg    428520
     ccaagaacat atttgaatag tgtcggtcct cgtttttggc gccaaggttg attgtttgaa    428580
     ggagacaggg atgagacgca atcatcggga tgatttgcgc attgattttt gagacttgtc    428640
     gatgattcct ggttaatttc ccttctcttt gtggtagctg gacacacgcc cagatgcgat    428700
     ctatgcgata cgcatcactc tgtatactcc tcccttatgg ggcaggtcgt atttgacgat    428760
     gcatgtcatt gagactccgg atcacatcgg actattgata taccaagaca atgagaacaa    428820
     ggatgcaagt cgatcatgca tcccgttccg agtctcataa ataggcaatg cccagtgtac    428880
     atactgctta gccaagaaac tctagtgaaa cagagcagtg aaactcgaac acaattgccg    428940
     tccccttctg ttgttggatc ttggctttgc ctggctatcg tcgatcatgg agtttaatcc    429000
     cacattggtg ctatcgttgc actatccatc cactcactgc gacgaatgct atctatagac    429060
     tgtaacacac acagcactcc aggcagcatg tcgatccccc agtatccccc acgaatctat    429120
     ccctgttttg cttggcatct ccggacaagg tatcccagga caagctcaca gtacccaggt    429180
     aagatacatg taagacctgg aaaacaataa aaccacactg aaacggcgtt tgagttatag    429240
     tatacaccct cgactccgcc cccgagattg aaaccaggcg ctggtaaaga ttgacaatcg    429300
     gcactgggtg accggggagt ttaacggtgg ctatgcagat ctgccgacgc acgaaggtgc    429360
     atacgaagag aaatatatat cgtagcctag caggcagtct tataccacct tctaacaata    429420
     gcaacagaga attaaatagc aaatagcaac ggctatacca catctcatcc caccacagtc    429480
     accattatag cctccgatcc tatcgtgaac accgccgatc actggtgctc gagtggcagt    429540
     gacagccagt ccgagacgca atactgtaac gtttaattcg gtcgaagcag tcgctctgtg    429600
     tttcattgta tcgatataac acagccaaga ggaatatcaa tactccatac atacaattat    429660
     tgagtacatc gctgcagcac ggggagatag gagcgtgtgc attgtagact cgactgtttt    429720
     cgcgtaacgg gtagttcggg atacctaccc cataacatct ctcgcacagg gcacagggga    429780
     gacactattc gacgatggat taccccggag ccatactaaa gagggtaaat attatgtcag    429840
     ttctgtatgt tgtgcatact tgccttgcgt cacaggggga agaacaacaa agtgacatag    429900
     tatgtctttg cattcaatgt tgatttgtta tttccccatg taatgtagat agatagcaca    429960
     aacccttccc gacaccggat tgtcgcgcca atcccagtaa atagtgatgt gcaactgccc    430020
     tatatgggaa agtagcaagc gcggataata tccgttttgc ttgatccctg aaatagcact    430080
     tgctagccgt gaaggttcgc gtcgagtgtg gggtgtttgt tctcctgtcg atcacgacca    430140
     aaatgggaag actatctaaa catgcggtct gtcttggatg ggggtaatct ggttttatgg    430200
     ctctgggcta tgactcaaag tcgcgtgagt tatcttagta cggagtatgt agagatgtgg    430260
     gtgtttgttt actcattgct tttttgggta tggcatggtg gctccggata ttgtatgtca    430320
     tcattgctat catcattgtt atcctggaaa ggcttagatg gaatgatcgt gtgatcacac    430380
     gagctacccg ggatagcatg tttctccgtg cgatctcccc ggtctatctt aaacacgagt    430440
     caaaagattc gggtttagag ttattttaat caaattgtta aaccgcgaag ctagagacag    430500
     aaagacattt cggccaggat gttggccatt gttcgtttcc gttttcgctt ttcgctttca    430560
     gcggactgta cgtattcgta ttgggagcgc gcccgtaggt gattacatgt ccgaagctct    430620
     gatcgacaca gggtttgtat gcggccaaga gaaaggtgta acatatgctg tatacgatct    430680
     tgactatagc gtatgcacac aatccaagtc gaaaataata gaagtgtact ccgtactccc    430740
     gtacagagta cacaattgac ttactgaata gggctgatca actaattttc gcactattac    430800
     ttggtggcgc gccagaccat aaattatgaa taaacaaaga aaaggacaat ttacccggca    430860
     agacggcgac gtcagaacca gaaacgaaca atgaactggc aatgaggcaa ttaaaatttg    430920
     atatgtacga agaccactgg gcaacttcaa ctgaaactgc gtgccgagtt cccgcgtgcc    430980
     gcgtcgcccg agtcggagtt tcaacacggg atcaccgaca ctggccgact ctgcgcctcg    431040
     gccagaggcc acataacaca agccaagacc gggaggggtc cgacataatc ctgagtctct    431100
     ggtccaatca tatgtctcga gtgagaagcc tcaatattcg gggtcttacc tgcttaaggt    431160
     aagaataatt tcaagcctga gcgcgcaata gtctggaaag cacagacacg cggggctgta    431220
     ctatgttgta gtttcttatt tcaggctcga atggactgtt taattcgaat aatacagagt    431280
     actacgtact ccgtactccg taggtgaaag agaggtgata atcatttcgc aagctatgat    431340
     catccccccg gaaaaggcac agcgtcattc ctctccgatg ccgactctgg agattactcc    431400
     ggacaatcct ggactccgcg tgatgtaaag agagggatat tgttacattg catttaggct    431460
     tcaattccca tgcgttaaac acgggtagac aacgtatatc tcgtttcaaa aggcttcgag    431520
     ctctcctgca agtgcgggaa caacatgaca ctattcctaa atagggcttg gggtgaggta    431580
     accctgtgca cggagtcgac ttgcgcgaca ttcaacccgc gttttttgtc ttagcattgc    431640
     ttttctcctc ggcctttgtt tctccatggg cagggaaatt ctggggtgaa caaagctggg    431700
     cttggcgaac cgcaatttgg ctaataacag ttacggtggt acttttggta tcatgataga    431760
     tttatgcaac attcatgatc tatggatgca tgatacacga cgagtgacaa attaaccaaa    431820
     gcgtcagacg aaggacctcc gcggacagct ggcagtttag tcaaaaacgt gataataacg    431880
     tgaacccttg tcggtgtgaa tgaaatgggc tagaaagcga cagaaaatgc ctcacgatct    431940
     gggatcggca aaagtcctcg gagtaccaag tctgaccgta ccaggtacgc ggagctcggc    432000
     gtactaggat acaccgtatg tggtaaggta tactccgtaa tcaaggaacg atttggcagg    432060
     cgggcgatca ttcagtgggt ccgcccaccg gtgagggctt gattcagatg gtgggagctt    432120
     ttctaagcgt atttaaagac atctgattcg tggagggaag cctgtcccat cgcactacgc    432180
     gcgctactgt aggtacacgg ctgcgaggcg aaagccaaga ccgtactagg agatttggtc    432240
     tttgacacct ggccagtaga cgtcgataaa gtaatgccaa tggcaatagt gtggattcag    432300
     gatctggatt taggtgattt ggccggggag attaggttgt gtgtcctcat cgtcatttgc    432360
     tctgacatta tacctatact tccacaatag acataccttt ctagggctat ccctatagaa    432420
     cacccgtcga cggcatgtcc aagccggggg taatttacat gttttggtac gtatttcagt    432480
     gggaaatcca cccggacctg gtacggtaat taattgagtc agctgtttct aaggggtatg    432540
     attggtgggg gaccgaggta atctcgctgc acggatttta cccgaattgg aaagattcat    432600
     atatttccgg gtattttcaa agtatgtggt aataatagca tttgggttag tctaacaaag    432660
     gcatagcgaa agcggcatga taagagtcat gacgtgatac tgttattctt atcatcggac    432720
     gttatgaaca ttaattctca ttgtgccgac atccgtcgat taaagaggta agggaaaagg    432780
     gtaaaaaaac agaaaaagaa aaatcccgtt cacgcccaca tgcagcgtaa gctgcattgc    432840
     acccatggta cagtcacctc caggaagcct tctagaagac gtccagaaca ccctaaatct    432900
     ataaccacac gcaccgaact gggtccactt cgagaaatgt atgatcactc ggcaccgaaa    432960
     ccccattagg gccagcctct agtttactct gcacgcagca ttttacatct cggcctcacc    433020
     gtgctcaccg tcctttacga tagttagcaa tggaatcata attttccagt tgcccccggt    433080
     ccggtccgga gtggcaatca tctactcggg caacgcgaaa tgatttttga ggcattttgt    433140
     tgcatgatgc aggacggaag acacaatcga aaaaggccgt gctttcggcg tcagcaggaa    433200
     ttgatcctac ggtgcttccc cagatcaacc cctccaaacc agacggcatc agcggcgcga    433260
     tcgcccgaca ctacgaggaa tgttcgatcc tcatatctct cccggtagac gtcgtatcgt    433320
     gcttcacgtg taaagggatc ctggcggcta cgtaaagcac atgtccgacc gaggagacat    433380
     gagtgattcg ccacgtatag attaaatcgt atacggagta cgaagtacaa tggtagtgga    433440
     aggttgttgt tcttggggta attgtgtagc ttccgatggg attggagatc gtgaaacatg    433500
     ttcccagccc ccctccccca aaaccatata cggacatacc gtgaatcccc gaatgttatt    433560
     gttacgtcta ttatattatt ggcattattg aaaaggttgg cattactcca cggctacgga    433620
     gtcaaagatc agcgataatg gcgaggctac ggttacttca aaattctcca aaccaaaatg    433680
     gattgtggac ttgggccatg acattatatt ttgatattgc gcacgtgtgt gtagtacaat    433740
     ctacctccta cggcggatat tgtcccacag catgatccac ggtcacagcg tgggggaaga    433800
     gaaatgctct gtaaagtaat aatttcctat gttgtaattc tcgacgcttc gattgcccga    433860
     gccatttttc cattttcgat tggggtccaa cagagctctc cacttatgcg cctcggtttt    433920
     tggagatatg aaaggtcgtg ggccccgaca gaattttttt ttaaaccaga acaatggccc    433980
     aatatcccag tccaaatgac tgatccatca aagaaaattc gatgcagggt catccagtga    434040
     cctcggcggc gctgaggaca gtcctccccc cggatcgtgc actgctgcca gccgggcttg    434100
     gctgacgtgg gatttttgaa aggctaaacg gcgagaatcc cccggaataa tcgtaactca    434160
     attggacctt tttttcattt tccataattt ctttttccct ttgttgcttt ttttccctca    434220
     ccctcgcacg gggctgcaag aggacgaagc gtaagcgttg catcgaatag gggtcagttg    434280
     cggatttcag actccactcg cggccggctt cccgaaagag tttggcccaa gagctatctg    434340
     tctttgcagc tattcctttg atatggaaga gatgagacag ggggttcaga gtgacgacac    434400
     tgggctagag aaagcgggat tgtggtctct ttctttatct ttttacggga aaaccaatag    434460
     ctcctacgga gtacggctct agaatggaag gtgatatttt tttgatatat tatcacggcc    434520
     agactcggga gctccataat ttcctctcgt tcagatgccc gcaattggct cgcatagtga    434580
     acggcacgtc tgccgcgtaa agcgccgggc gcctttgatt aaagtatatg ttgtacaaag    434640
     tacggagtac atactccata ctagagacgg gatgaccgac agggttgtct gagggattat    434700
     cgcaagccat ccgtactcga tcgatagtag cgcctctata tattattcta cgatggacgg    434760
     agcgagaacg agaggaggaa tttgtctaga tcgcgtagac tcgggatatt gatctcgact    434820
     ctcccgcgcc gttgtccatc gccaacggcg cgtgcacgat cgagggaaac cccagccccg    434880
     aggagattgg tcttctgggg aagaattgcc aagggcactc accggaaagc cggggtgcgg    434940
     gtgtttttct atcaaaacta tgggaatatc gctgccatcc tactccgtat agagtttccg    435000
     attgactaaa taaaagcact ggctgatcat aaactgttta ctacattgtg atttgaaaac    435060
     gagatctcat ccaatggcat tcagccttat tatgttgcat acaccgggaa gcttggtgtg    435120
     atccctagaa ggttcagtca tggaggatca ccccaataac atgcatccga tgacccctgt    435180
     tatactttgt cgaggattta cccgcagggc acccttttga catcgcgaac taggtttgtt    435240
     ccctgctgga ccaaaggcaa ttttgtcttt tgggtcatgc acactgtcag gcgatcaatg    435300
     gagctatgtg ctggccggga gggtaacaat agtctatcat aattaaagcg actacgaagg    435360
     actccatatg agcatcgaaa tttccccatc ttgaccaggc catcttgcac aacatagcaa    435420
     agccagaatg attgccatat agataccatg gagcattcca gctgtactct gtacaaggag    435480
     accatattag agtcagtgct tgggaacatc gtcggcgatc aaaccacgat gaaatcatcg    435540
     gccggcgtct gcacccgatg attcgatcaa agccgcccag ttattacaag gtgctagtcg    435600
     gcggggactt ttgcggtcgt gccgaccagt gaggggcacc gaattaaatg acgcttctgg    435660
     ggacgctctc cacgaggcca ggggggcgga aaagagaggg cagagatcga ccgtggcaag    435720
     aggtacgaac gaggcagctt cagcgaggga agtggaaata ataacagggt gcgtgttgat    435780
     accagagttg gaggaggagc aaattagcta attgatgaca tgatggtaag aattgtaact    435840
     ttattgtcag atacagtgta attttcgttg gcccggcatg cttccaatag cattggcata    435900
     catatcaata aaaaatcaaa atctaccgct tccgggaccc cttgctatgt ttaaaatggg    435960
     ttgggtgtga cggccatgcg atattgtcgt caccatagtc actgtggcat tttttgttgt    436020
     ccacgggtga aagccggact cggtcgagaa gggaaaattg aactatacat aatgtaatcc    436080
     gactccgtag ctacatacgg agtagggtaa atgaaaacgt atccgtatca atggactatc    436140
     ctggggctat ctcggaccat gtcgctcaat agaggagcat tctcctgcaa gggcattcct    436200
     gtctattcct tttgccatgc ccgtgaattc tccgttaaac agctaacctg cctaactgca    436260
     aatcggaata catcagattc gctgtaccaa ttccattagt tttgtttttt ttatttccct    436320
     atgtcttggg gtctcgggac acagtaagga tcgaaatgac cccagacaca aaaatcgcgc    436380
     atagtcagaa ctggggcata tcggctaagg catggaaact catgtaaaat tgtggtactc    436440
     cgtaccaatt tcatacggaa gtgatgtctg tggaggccaa ctcggcaggt cattgccggt    436500
     agcagagacc tccagaggga gagtggtatc ggtatcaggt tttttcaatg ttttggggct    436560
     aagccgagtg cagtgtcggt cccacttaaa ggactgtgcc ttgaagatga ctggctgcag    436620
     ccgggtatcc ggttggagtt ttctgggtag ggcaaggggt aaagtctggt attgaccaag    436680
     aaatcacata acgctaaacc gaagggggag gaaaaaatgg gaataaaaaa caaaaaaaac    436740
     atcggaaaaa caaccaaaaa ataccaaaaa gtcaaaatga cccgaaaaga atgattccag    436800
     agcgggtcaa aaaggtacct gggttatacc ttccccagca accattttca gaagtatttc    436860
     ccccctcaga ttgacaaaca cgggatttcg tgcaaaatac ctttctcccc catttcaatc    436920
     ggtccccaat ttattattta tttttttaat tcccaattct tttttcaatt tcaatttcaa    436980
     tttacaattt ttcttttttt ttatttccct cactcttttc tctcattatc caccaaccca    437040
     ctccggttcc ttctttttga cccccccgta atccattata aaacagtcct tccttcactc    437100
     atctcatttt tctctttttc tctctttaca taggatctgt tccgactctg tcatacccgt    437160
     cattccgttg tctttactca tatcgttggg ttccaaggct gtgtgagccg aagcaacaac    437220
     aatggcggag cggagaattt cctatgctgt tgacgtcgaa aatggtgagc gtcctcaccg    437280
     tgaggctggt gacgagggta acctcgacga gtactctgct ctcaaccggt acatctcgac    437340
     cgcccgcgac aaccgtcgtg gctccacctc gagcgccggt gctctgagtt cgggcgagga    437400
     gaagaagaag ccctggtgga agttcggtgg caaggccgct ggtggtatcc aggatggttt    437460
     cgttgccccc gatgactggc tcgagaccga ccttcgcact ggtctgagca ccagcgatat    437520
     cgagcctcgt cgcaagaaga ccggctggaa cgagctggtc actgagaaga ccaacatctt    437580
     cattcagttc attggttact tccgtggtcc cattctctat ggtaagtggc tttgacatcc    437640
     gtctcgattg acgcgtctta tgccaattga ttgactaacg tgttcgttac tgtacagtta    437700
     tggaacttgc tgtcctcctc gctgccggtc tgcgtgactg gatcgatctc ggtgttatct    437760
     gtggtattct tttgcttaac gctctcgtcg gttggtacca ggagaagcag gctgccgatg    437820
     tcgttgcttc tctcaagggt gatatcgcta tgcgtgctat cgttgtccgt aacggccagg    437880
     aggaggagat cctcgctcgt gagctcgttg ctggtgatat cgttatcgtc gaggagggta    437940
     ccgttatccc tgccgatgtc cgcctgatct gtgactactc caagcccgag atgttcgagg    438000
     cctacaagga gtacctcgcc aacgccactt ccgacgacct caaggagaag cacggtgatg    438060
     atgacgatga tgatgttgag acccaccagg gtgtctccct cattgcttgt gatcagtccg    438120
     ctatcactgg tgaatctctc gctgtcgaca agtacatggc tgatgtctgt tactacacca    438180
     ctggttgcaa gcgtggcaag gcctacggta ttgtcactgc tactgctcgt cactctttcg    438240
     tcggtaagac tgccgccctt gtccagggtg cccaggactc tggtcacttc aaggccgtca    438300
     tggacaacat cggtacctct ctgctcgttc tcgtcatgtt ctggattctc gccgcctgga    438360
     ttggtggttt cttccgtcac ttgaagatcg ctacccctga gcacagcgac aacaacctgc    438420
     tccactacac cctgattctc ctgattattg gtgttcccgt cggtcttccc gttgtcacca    438480
     ctaccaccct cgctgtcggt gccgcctacc ttgccgagca gaaggctatt gtccagaagc    438540
     tcactgccat cgaatccctc gctggtgtcg acattctctg ctctgacaag accggtactc    438600
     ttactgccaa ccagctttcc atccgtgagc cctacgtcat ggagggtgtt gatgtcaact    438660
     ggatgatggc cgtcgctgct attgcttctt ctcacaacat caagaacctt gaccccatcg    438720
     acaaggtgac tgtccttacc ctccgccgct accccaaggc ccgtgagatc ctctcccgca    438780
     actgggttac cgagaagtac actcctttcg atcccgtctc caagcgtatc actaccgtct    438840
     gtacttgcga tggtgtccgt tacatttgtg ccaagggtgc ccccaaggct atcctgaaca    438900
     tgtccgactg ctctcctgag gaggctgtcc tctaccgtga gaaggtcact gagttcgctc    438960
     gccgtggttt ccgttccctt ggtgtcgccg tccagaagga gggtgagccc tggcagcttc    439020
     tgggcatgta ccccatgttc gatccccccc gtgaggatac cgcccacacc attgctgagg    439080
     cccaggttct cggtctctcc gtcaagatgc ttactggtga cgctatctct atcgccaagg    439140
     agacttgcaa gatgcttgcc ctcggtacca aggtttacaa ctctgagcgt ctgatccacg    439200
     gtggtctcgc tggttccgcc cagcacgacc ttgtcgagaa ggctgatggt ttcgctgagg    439260
     tcttccccga gcacaagtac caggtcgtcg agatgctcca gcagcgtggt cacttgactg    439320
     ccatgactgg tgacggtgtc aacgatgctc cctctctcaa gaaggctgac tgtggtatcg    439380
     ctgtcgaggg ttccactgag gctgcccagg ctgccgccga tattgtcttc ctcgctcccg    439440
     gtctctccac tatcgtcgat gctatcaagc ttgcccgcca gattttccag cgtatgaagg    439500
     cttacatcca gtaccgtatt gccctgtgtc tccacctcga gatctacctg gttacctcca    439560
     tgatcatcat caacgagact gtcgactctt ccctcattgt cttcatcgcc ttgttcgctg    439620
     atcttgccac catcgccgtt gcctatgata acgctcactt cgaagcccgc cctgtcgagt    439680
     ggcagttgcc caagatctgg gttatctccg tcgttctcgg aatcttgctc gctgccgcca    439740
     cctggatcat ccgtggtact ctcttcctcg agaacggtgg tatcatccag aacttcggtt    439800
     ctccccagga gattctcttc cttgagattg ctctgactga gaactggctc atcttcgtta    439860
     cccgtggtgg aaagacctgg ccctcgtggc agttggtcat tgccatcttc atcgtcgatg    439920
     tccttgccac cctcttcgct gtcttcggtt ggctcgcccc cgactgggag cagacttctc    439980
     cccctacccc tggtggcccc ggcttctcca agaacaacga tgttgacatt gtcaccgttg    440040
     ttgtcatctg ggcctactcc atcggtgtga ccatcatcat cgccgttgtg tactacctcc    440100
     tgaccattgt tcctggtctt gacaaccttg gccgcaagac ccgctccaag gctgacacca    440160
     agatcgagaa catgatcgct cacctctcca agctcgccgt cgagatggag aaggactccg    440220
     aaggaaagac tcgctacacc ctcggtgccc gtgccgagga gatcgaggac aacgagtaaa    440280
     cgctcgttcc ttagcttttt ttgcaactcg ttactgattc gaggtctaat ttcttttatc    440340
     tccctgcgat tacacgcaaa ttttgccgtg ccacctacct gaacatgcat gccgtgggag    440400
     tcaaaaaggc ctcccgtgtt tttttgcttc cttttacccg tattatagac tttgtgtgtt    440460
     tcatttaccc ccctggctgt ggtttgcttt cgagttgcta gagtcatgtt ttcattctct    440520
     acgtgtatgt atgtcgttaa tagtggcact tagtcaatct aagggattct aatcatttct    440580
     gttcctcgta atttccattt gcagtattgt aggattccaa tcttgacgat ctttctctat    440640
     tcttgcttat tatcccctat cctcctgttg atctaaattg tgcgcactgt ctcttcttcc    440700
     atgctccaac gctgacaggt ggaagccaat tctccgtccc cgtacttttc ccccggatga    440760
     atttccactt cgcggagaca agcttccagt gagatcccct ctcttcccaa tatggacgaa    440820
     ctacagagaa atatcacaat gcactcaact atctaattta ctcctaaccc atcttggtat    440880
     tatccatctc ctaattttcc gtctcatgcc gcaactggct atggcttcta tacaaacccc    440940
     cactctccaa atgcctataa aagaataata caaccaccat agaccgtgcc catcggaagt    441000
     gagcaattat ccacatcaag cacgatgctg ccatcaatcc tctccctgct gggtcttctc    441060
     ctcttcgccc tagaagccaa tgccatcgcc atccaaccca tctccagaca aacctgccaa    441120
     tcaaccggaa cccactgtcc cccgggaacc ctagtcgtca gcacaacctc taaacacgcc    441180
     tctcacaaaa ccattcaatc cgccataaac tctctccccg acgacgaaag cccacaaacg    441240
     atcctcatcc tagaaggtac ttataccgag caagtaaaca taacccgctc gggcccagta    441300
     acccttctcg gccaaacaac ctcccccaaa gacgcaagcc gcaaccgcgt gcgcatcaac    441360
     tgggcggctg gtaacagaga caataccggt ggcatcgaca atgtcttctt cagcgtgatg    441420
     gttgtagcgc ccaccctgga agcgagtctc acgggcacag gaccgaccgg gtatcccgtg    441480
     ccagctgata cgccattcgg aaataaggat ttccgagtat ataatgtcga ctttgataat    441540
     acttgggctg agtactcgga cggaccagcg catgcgctga gtctcagtcg tgctaatggc    441600
     gggttttatc actgcggttt ttattcgtac caggatactg tacgttcttt ccatctgttg    441660
     ggatcattcg cacaacacaa acacaaacac acactaatcc ctccgcaggt ctacataggg    441720
     aaactcggca acgcctattt ctacgaaagc attctagccg gccaaaccga cttcctgtac    441780
     ggcttcggca cagcttggat ccaatccagc gccctccaac tccgtggctg tggcggcggc    441840
     ataaccgcct ggaagggcac gaacacaaca atcccgaaca agtacggcgc gtacatagtt    441900
     gactctagcg tgcgtgcggc gaacgcctcc atcgcggctg atatcaaggg tgcgtgtgcg    441960
     ctcggccggc cgtggaatag ccagcaccgg tcgatctttg cgcgctctta cgaggacggg    442020
     agtgtcgatc cgcgcgggta tattgattgg gttgttgatg gtgtttcgag gttcgaggag    442080
     ggcgttacgc ttatggcgga gtatcgggtt catgggcctg gggttaatga gactgctcgt    442140
     gttgagggcg gtgttacttc tgttcttgga caggaggaat gggagatgta tagtactccg    442200
     cagaaggttt tcggggatac ggagtggatt gattgggagg ttgtcaagga gaattagtgg    442260
     gatgggttgt ttagtgacat tctcatataa acagttttga ttgctttact cctactatta    442320
     atgcatcacg catcaggctc ccggcgcagc tccccaatgg ccttcccatc tgaagtccca    442380
     taagtatctg catacctccc tgtcatccac tcgtgaacgg taatcggggg atatctagcg    442440
     ccctctggat cctcacagcc aggaagacac cggatagtat agttcggatt ccccgagaag    442500
     aagaagggga cacttaaccg ctcctttccg ctggtattaa tgacgcggtg cagattcgac    442560
     aagtaccgat cattcgtcca gcgcatcatc atattgccca ggttgacaac atacgcgcct    442620
     ggaaccggcg tgacatcaac ccattcagaa gacaggttat tccatacctg caacccgccc    442680
     gtatcatcct gcaggagcat cgtgatagcg ccgaaatcgg tatgagcgcc gattcctaga    442740
     cttgccttag ttcgttctcc ttgtgatatt cacattcaca tcgtaagcag ggtttcctac    442800
     taacctctct caagatccga cgcatcagcc tcttgggacg gataatgaag cagtctcaga    442860
     atggagacgg gatgatcgca gaaattgcta aaaacatctt catccagacc cagagtgcgc    442920
     gcgataactt gcatgatggc cacggcaagc tcgatcatgg cgtcgtggta ctcgtccatg    442980
     acgcgacgga agccttccgc gtcggggact tcggagggat acttgttcgg tccttggccg    443040
     aagcgtcgct ggacgacgta tacatcatcg agtgggaggt cctttccaag atagaagcct    443100
     tctttcagat cgccttttgt gcgtttttcg aagttttgag agcgtagtcg ctcgtacccg    443160
     cgattgaagc cgccagtggc tttggggttt aggtaagtta attctttttt tggtatttgt    443220
     ggggtgagcg agcgctgtgt taccttggtt gtatctctct ttcgtttcca aggggaggtt    443280
     gaagaattcg cttgagtgtt gtaggactgc ggtttgtagt tcggttggga tggcgtggtt    443340
     gattagctgg aagaaaccga attgttcaca cgcttgttgg atttggcgga taaggtcttc    443400
     tttggccgaa tcgttggcat agaaggctgt tgagagggtt agataccttt attagaatat    443460
     acggcgctgg agggtgcttc ttacgggcga aatcgatgat aggtggttcg ttagggttca    443520
     tcttgaaggg atgtagttaa gtcttgatgg aatgagaata tagtcttgat gagtcattta    443580
     tagctgttct tatatcttca tagatgcggg gaaaccgttg tcttttcact tatgtacatg    443640
     cacttattac ctacggacat gtatgtcgaa aacccgaaca tccgactccg tttctatgta    443700
     atccccgaag ggacttgtcg gcctttcagt ggtagtcctc gaaactgcta tagagacagt    443760
     atgcatcctt agtctatatt gaaactttgt atgttagacc gagcagccgg ggagatctag    443820
     agatcaacat gcgtaatgaa catgatcaca ttatttgaga aatggcaaag ataacagact    443880
     cggatctatg agaagagagg tattcgttca gtatggtaca cttatgcgta caaaagaaaa    443940
     aagtatacaa ataaaagtca gggttcttct aatccggtgg gtatcatatg tgctctaatc    444000
     aaacatgcta caaatgcatg ggcgtccact cctgtccagg gtaggacgtg ggggacatga    444060
     cgatctcctc gctggagtca tccgcggtga tggcaagctc tactggctga ggcgggttat    444120
     taactacacg ggcctcgtcc tcactgcggt gaggatgcgc ggatatcgcg gaggcgtttg    444180
     agacggcgat gttgcgcggt gcatggttct ccgaggctgg gcatgtcaag tctgaaacca    444240
     ctggctttcg ggatcggatg ctgagctgag gagctagaat ttgctgtttg agattgcctt    444300
     gtaattcgtg cacttgttcc gggttgtttt gcttgcttgt cggagcctcg gatatctccc    444360
     cgtatagttc gtgtcgaagg gggtccccaa ccatgcggtc tttgtgctcc tcatgctcct    444420
     ctctttcctg gttctcgttt agggtgccta actgcgggtc tccgttttgg tcttgctggg    444480
     ccttttgctt gagctgctcc tctttctgca gttgatgtat ctggtggtcc tgtaactcct    444540
     ccagcggtga cagtgaaggt acagctctat tctcctggaa tgacatggga gatggtgacc    444600
     gggaatgatc tgggagaggc tgactgagtg tgctagcatg gcgagagccg ttgggggttt    444660
     cattcatgga tccagatcgg aactgcgagt aaaaccgacc agtccccagg gagttggacg    444720
     acgaactgga tggaattgac atagatggaa gggatatact ggcacgttga cgatcatcgc    444780
     atggaggctt tgcgtcgctc ggtggtggcg gtggtggtgc cctaggctca gggggctgag    444840
     ttggcaaagg ggtttgttca aatggattgc tgaggaccgg tggttcatcc tgtgcagcaa    444900
     cactagtatt tgcatttccg gttgtcgacg gacgtgtcgg caaatacttg ttttgcagct    444960
     gctctgatgt agtccttttg tggtcggtcg atttcctttc agcatcttga gagtcttggc    445020
     ggccaaatag tacctgtcta agttagaaaa caaacaaaac aactttataa agtagacgta    445080
     cgctaattct gctgaatgtt cgtctccgct ggcctccttg gggcgcctgg ggtccttgta    445140
     gttgaatacc agagaggagg tctcccactg aagcgcgtcg tcgtctcccg aactccttca    445200
     gttttccaat agtggactcc ccgttccctg caggagaccc cgattccgaa ggttgcgaaa    445260
     ggccgttagc aggtgtggac gggcgagtcc ctttgccgtt ggcactctgc tttccgaagc    445320
     taccgaagct cagcatactg cttcgggttc ccggcgagta tctgacttcg tttctcaagg    445380
     ggctatgcac atctggaaca gagggaggta ggccgctgat cgatttcctt ttggattcga    445440
     ggacctcggc agagcttgtg aactctgacg gatagaaagg tatgaaagac cttctcttct    445500
     tttgagcgga tgccaatgag ccaggagcgt catccgcaga ttgctcaacc ttgctttcat    445560
     accggggttc tggtactacc ccggctgtct cttgcaaagg agaaggggga tccctgtcga    445620
     tttcctcgtt agatgtacgt ccggtttgct cgtcaggccc gagcgttgag acagagggct    445680
     ggcgtccatg accctggcta ggtgcaagcc cattgccatt atccttggga ggaggcgaag    445740
     ggggcttagg actttcatca agcaccggac ggatggacgg agtaactatc gccggtgtag    445800
     acttgcttgg ctgatgcctc tggctgttca caaccgggac ggggatgtga aaaggctcat    445860
     caggaatgac tggcagaccc ttttctgcga ctgggtcttt gctcgccggc gcttcagcat    445920
     cggactgatt gccagttgtg ctttctccct gttgcggcag tggctctgtg aattgccgtt    445980
     tcccaccatt tacttggcta aatgcattca acaccatcgg ggtacttgct gcccttcgag    446040
     gatgggggtc tgtgggcgaa agaccaagtg cagctatcat ctcctgctcc aaatctccag    446100
     caaaggctga cttcccgggt acttcagctt taggagggac accattggaa gatggcagtt    446160
     ggtcccgttg cccagtcgtt tcgccaacat ggttgtgcga ctggttatta ttccccgatt    446220
     tggtcgcctt gacacgtttg ccaccattgt gctcaccctg tggaccatct agacagaagc    446280
     tgaccggtgg atcaggatca gagttgagcc cagtttgctc ggatttgaag ataggcagac    446340
     tgccaaatgt gacagagttt cgcagagaag agttaccaga cacttcacca gtccctgaag    446400
     ggaaggagaa ctgaaagctg cggcgagaag cattttgagt tgactgaacc tacaacatta    446460
     ccaacatcag aatgtaaaca aataagggcg gggtgttaga ttgtatcgaa agggcagatg    446520
     catcaatcgt gtctcattct agagctcaat gccaaaaaga agtgctcgga attacatcgt    446580
     ggtatccaga aagtgaagca aggcagcgaa agtccaaggg aaacattaaa gcgacggcat    446640
     ccaccgtgct tacccaagta aacaactcgc tcaaacgaaa aaaaaaagaa tcaggcatct    446700
     accttctcag aacctccact gggtcggaac ctgcttctgc ccttggcaaa cagccccttg    446760
     gctgccccgg ttgccttgcc actaaacgct cccgcagtgt ggaggaactc cttccctttc    446820
     tccccgactt tatccttgtt catcactgta ccgagatggc ccgacgggcg tcgaacatga    446880
     gtggcgttag tcggggtacc gtcattcaag gaaccgagat tcgaaagagc acccaactta    446940
     gggaatctga tgcgggaagg atctgatagt ggcacggtag gggagagatt ctggctctgt    447000
     tggaccacat cggcatgctc ggggtgatca tggactgtga actctagcca atgattcaaa    447060
     ccagtgtcga tcgtggcgaa ctggtcgcgg gtgtgttcga aagacttgat acgctggttg    447120
     atagatgtga tgccgagaat gtcacggaag cctaaaagtt tagactcatc gagggatgag    447180
     ctgtcgacgt taggggcttg gagttgtgga ggtggcgtag cccccggtcc cataacttgc    447240
     tcgggtggtg taatgttctc cggaacaggt gggacaatcg aaagtcgagg tctttccaca    447300
     gcacgctgag tactggacgc ttcatcctca gaagcaagtg ggtcgtgcga tacgtccgac    447360
     accaatgggg cggactcctc acgtataggc tcaggctctt gcatagataa cgatgtggct    447420
     aaaggagggg gcgatgaata gctgccaggc atttgaggcg gctctgtttc agacgaatcg    447480
     gacgactccc atgagaaccg tctttctaac ttgggcttct ttggctgatc gacgaccatg    447540
     gatgcagagt taccagccgc gccttgactg gtcggatagg ggtcttgaga cgccaaagga    447600
     ggcgggctag tccagtctgg gtggctttcg gaaaccgtag tctgttgtgg gacggattcg    447660
     gcaggtgcct gcgactgagg ttggtggctg ggctctgggt cgtccgaggg ggtagcttcc    447720
     cgacttaatg atcggataat ctcctccctc aagcgatcat tgtcagtatt ctgtggcgat    447780
     tcttcggctc ccatgatggt tgggatctcg ggatggaagg tgtcagggcc agatgcactt    447840
     ccgaatttga gaggggcagg catgtcctgc ccattattcg agtatgattg catgggcggt    447900
     ttctgaggag agatccccgc atcaggtgat tctggagatg gattctcgag tgggggaatg    447960
     gaagacaact ctgcacggcc cgcgattggg gtatcttggt ctgtgacctg aggttttctc    448020
     gaaggactgt tgtctgaact aggaaggctc aggtcccggc gatgaccagg gttaaaccct    448080
     ggaaccgcat tcgcagttgc cttgggggag ctcgactcat taggctcctc gagaatggtg    448140
     ggtgttcttt cgtcagtcat agtacgacca cccatgatag ggctgatcgt cgaagtgcca    448200
     tcactgttcg accgcgcgac actagtggta gtggattgcg gagtttctgg gacatcaaag    448260
     gcctgattca ctaccgatct gaatcccggc gaggggttgt ggtgcaaaga gggctcctga    448320
     gatgcagggc tatccgttgg cgggttgggc tctgcaccac ctaagaagtc ggtaccaaag    448380
     ctagacatgc gcttgacttc cggtagaccc aaatcggggt tctcttggtt cgtttgaggt    448440
     ggcactccaa ccccgtcaga cttgggctca ttgctaccag tgataggaga ctgctctgtc    448500
     gctttctcct cacgcatgcg tttatagagg tcggccggcc gtacgaaagg aagcgccttt    448560
     tgatctcctc cactaacagt ccgacctttg ccatcagccg gagcagattc ggcggctccg    448620
     gttccaaatc cgatgccaga caaacgcctc gcggacagct cagatgaact gccagtgttg    448680
     tgggtggcat agggaggccg aggtactgcg ggaggtgcct cctcctcctc ctcctcttca    448740
     tagtcatcat cactacccca atcacctccg tcataagaat atttttttgc ttccacccat    448800
     cgttttgttt tggagcgatt cacgttcgtt tggaatgaga tcggggttcc gctaccgctg    448860
     cctgccgaga gtggactgcg aacatttggt ggggaagggc taaagcaggt ctcagtattt    448920
     gtgcaactag atatgcgact caatctgaat agatagtctt acagtttctg ggctccgtgg    448980
     ccatgcgatt gggtggggtc tgccatcagg ggaacaggat caagggaccg ggcttgatta    449040
     ccagcatcga ctgttgcttg gctgatctcc gataattctg cacaagagca agttgtaagg    449100
     gttaaataag aaggtgaaca acactgttcc cttaaaagat tgtgtatata ggagggacga    449160
     aggtggcgat ttggcccaag ttgggcaagg caccgatcaa acgggctggg ataattggag    449220
     gagacaagat gtacaagaat gacgtgtatc cacagagaaa tccaagaaga tcaagccagc    449280
     taatatcaag agagaataga ggaaacaaaa ggaaacgagt attaatggca atgaaacgaa    449340
     ctaactccgt atattcccct gatcgatcgt tgaactaaat ttaggtggcg atgcggggct    449400
     tatgtaaacg tttccgattg agtaaggacg gggttaattg cgtagacatt gttgacttcg    449460
     acctttccat cttcttactt gactgtacgg agtatatcaa gtctctttac tttgatcctg    449520
     gatctgttca agtcacgacg ttgtaccctc ggagctctct acctgcaacc ggacacgtct    449580
     tcatctcgcc cccttatcga ttgcagatag aatcacacag cttcaacacc gaattcggcc    449640
     tttgtcgact taatctacat ttgcttctca ataccgtcgc tccttgaaac actatagcta    449700
     ctcgtcgcta ctcgtctcct atcttcgcct cacatccctc cttccacatc gcaaaatgac    449760
     cggcccgtcg atacaagacc ggaccagcga attcaacgct atcttgggcc acgcccagaa    449820
     gcgcctgggg acgtcgaaag tcggttcgca gcgccaggca ctgttaaccg atgcgcaaag    449880
     gcgacaagcc aatgcgtcgc cccagggtgc cggacaggag gcgaaggcag caagatcgga    449940
     gtttgcgcgg cgggcgcgag atatcggaag ggggattact ggaacaatgg ccaaactgca    450000
     gcggttggct gaatgtaagt ccaggtcaca ttgcgaccta attctagcaa tttaacggga    450060
     aatagtggcg aagcggaaaa cactcttcga cgaccgacct gtcgaaattt ccgaattgac    450120
     atacgtgatt aagcaagacc ttgccgccct aaaccaaagc atcgcttcac tgcaggcgct    450180
     cacgcatgcg caacacccca aatcgaatcg ctcgaagaca gaccaggaag gagagcacaa    450240
     tgacaatgtg agtgggacat gaaaggctgc gcacggacaa gtcgctgatt acccattcta    450300
     ggttgttgtc atgctgcagg gaaagctggc cgatgtaggt gctagtttca aggaggtgct    450360
     cgaagttcgc acgaagaata ttcaagcatc ccgatcacga accgagaact ttgtttcctc    450420
     ggtatcttcc aaatcacaca gcgccctcga cgcacagcgc tcagactcgc ctttgtataa    450480
     cacttcggga cgacggacac ctcagccagg atatcaaggc aactcctccg accttttgac    450540
     cctcgagccc tcaaatcctt cgcccttagg gcgtccatca ttccagtcag accagcagtt    450600
     gatggtaatg gaagaaggag aatcgagtaa cacatatgtt caagctcgag gcgaagctat    450660
     tgaagctatt gaacgaacca tcagcgaatt aggtggtatt tttggtcagc tggcgcagat    450720
     ggtcagcgag cagtctgaaa tgatccagcg catagatgcc aataccgaag atgtggtcga    450780
     caacgtccag ggggcgcaga gagaactgat gaagtattgg acgcgcgtgt ccgggaatcg    450840
     ctggctaatt gccaagatgt tcggtattct gatggtacgt tgactcatgt tgaaatttat    450900
     tgcctggaca tccaactaat gaccattata gatctttttc cttctctggg tgttgatttc    450960
     gtgatagata cgaggtcctc ccattttttt ctttgtactg tattataata tctggcccgt    451020
     gtgttttcga cagaccatgg cccttctgca tatctgcact cgctgagcat tgcaatttct    451080
     ttttactctc tggctagact ctgagatgtc caaatcatca cgctctttat cttccttctc    451140
     acatttgccc cgttgctcct tcttgcttgg gactgtgtcc taaagagtca gctacgtaaa    451200
     tacaccttta tgtactatgc aaatccaatc aaccgagatc atgggaaaac catgaagcac    451260
     ttccagaaac atcttgaagc acgtattgtt atcctatttc acgcatcaaa ctgcgccatg    451320
     gcattccaca gttcagactc cgcccatccc aacgagggtt gattgtcgaa cagttcccac    451380
     acaagactgt cattccatcc ctccacagac ggtggtgcag taggacctcc tccagtggaa    451440
     tctgcacccc caagtctggc caaaggctgg tcggtaccgg tagcgcggcc aaatatatct    451500
     gtgtaggatg tcatctgggc ctcagtattc tcagccgtgt ttggatcaga aggtgcagct    451560
     gctggctgtt ctgaacgtga aggttcggtg ttccctttaa ccaaaggtgc acacaggtcc    451620
     agaaacttgg agaatagctt gtacagtttg ccgatcgagg cattggcctc tgcgaattga    451680
     tgtaggtcgt cagtgatgtt cttgatcata tcgaagtctc tctcgtttga tgttgcgatg    451740
     acattgcaaa acaggacaaa gaacggtgct agagggaata acagcattgt cctattgaaa    451800
     cggtcattag ggctaggata ttgagggacg gcttgaagct atgtcatacc aggtaagaaa    451860
     gtatggatat gagtcgatag aattgatgcg gtttgaaaat gcttcctgta gagctcggag    451920
     agtggtgagg gcttcccggg ctgtgtatag acagttctcg cagaccaaac gggacttgag    451980
     caccgaggag cgggcttgga tgattgtcgt gagaacagag tagtagttga agtccattga    452040
     tagccattcg cgccgcagat ggctccatga ttgtgtaaat tgttgttctt ggcgacgacg    452100
     aaactgaaag ttggattagc gattgcttgt tggctcatcc tcgatctctc ttaccatttg    452160
     catattggag tggattatgt gcgcccgcgc cacaagatca gatagcatat tggccttctc    452220
     tgtgtctcct atcggtttag tatcaagcaa gatggtcagc agagtattct tcaactctga    452280
     atactcgact acgcctgtta tcatggtgga tgttggcaga tcagggtcga tgtggattaa    452340
     ctgggttggt ttaactttca gatccggcag agacggtggt cggaggagca gcaggctgag    452400
     ggttttgtca aagtaatagc acaagaaaac acaggcatgg atattttcct cggtctgggt    452460
     tcgaggactg acgtctgtga tgttgtgata gttcaaggag acgatcattc tcgaggctag    452520
     cgctgtcagc atccagcagc gtgtcatatt tcctaaatat tgcatcaaac gggtctgtcg    452580
     tgagtcagaa atgagtcgat gtgtatggag ccaccgtaaa gaggcaaaac aaacatactg    452640
     cagacaaaac cgattgaagc aaaagaaggc taggttcagc tgccagcgga atctgattca    452700
     aaagttctat ggcagcggct tcatatctct ttttgagtga ccgaaaatga tccctcaagg    452760
     gctcacttga aacaagaggg cccatttttg atataaaact catggccttt acccagacat    452820
     taagtcggta atgctggagc acttgctcac attctgcgcc ctcgataatt ccaagcccca    452880
     tttgttctag gaggctgtcg gaaatgtgat caggccaatt gattgttccc tgggagtttg    452940
     ttttcttatc aggtcctgta ataatcagca ttgcggacat ctgctccaat cgtggtagcc    453000
     taccaggtaa catcatatag agcaactccg gtgtgagaga aggggattct aggctttctt    453060
     gaatctccat atcatgaata gccgcggtcc cctcccaatt tagagtcgga ttagacagct    453120
     gactaacgaa cttccgtgct gattcaagcg cagtgcgtct atcttttgac agagcagggt    453180
     tgcattggag ttcatgctca atatattctc tagcctcact agcatgatgg gttgagccag    453240
     gtgaatgtgc ttggtgaacg ttttgttgcg ccacagcctg agatttgcgg tgcttacttg    453300
     gcggtggctg cagaggaccc atatcattgg ggtcatatgc ccgataccgc ttctgcttgt    453360
     cattgagcac cccagtaata cttgtcagtt tggccgaagg cgatgaagat gtactgctag    453420
     cggcgtgatg ggttgttgga aagtttattg cctctttatt gcttgcctct tctagcttcg    453480
     ccaatctttg ggtcaatgtt tccagtcttg gaaatgtcag ctgcggagtc taaagacctg    453540
     caattcacat tctacgtacc gagagacccg gggcctatga actcgcgcct ggcgattgcg    453600
     aaggcattct gcacctgcat cggtgcagtt catgcaagga tcctggcgat cgcattttac    453660
     ctacaattac ttgagatgag cattgaaaca ttaaaaattt cgatgtgaga aacgaatgat    453720
     tataccttcc gagtatgaca tagatcgcac tgataactgc ccgattagct gggctacata    453780
     tatgtttcga aacagcgttg cctttcacaa tgccattatt caggcaaact tacagcagac    453840
     atgtttcctt cggaattccc aacggaattt cggattcaaa tgatatccca ggcacttcag    453900
     aggaagagaa aggaatctgg ttgaagtccg ggattgtggg gttcggcgcc cgaactgccg    453960
     ggaaccgagc ggaagcggtt tagtgcggag cttggtgata tccatatggt cttgttttct    454020
     atctgcattc aagattgttg actgatgttt catttttact attcgtattg attccaaaga    454080
     ttgctcgatt catattactc ctaaatatta caactttttg cctgatagct gtgctaagct    454140
     ttgggctatc attcgtcata acaatcatag cagtaaccac attctaattt cacaacagag    454200
     ccgtggagaa cctgcacttc ggaatactta acagtatgcg gaatagcccc tcgtcgatcc    454260
     atctcattgc gtgctgcttg gaaccataca tggttaagct ctggcacgag gagtgtgtgt    454320
     tcaccctgac cattgaaaga tgccatgtac tcgttcaaat cctttcgcat cgcccacaaa    454380
     aactccttcc tatgagacca cgtagactca tgctcgccct tttccttcct ttggttatcc    454440
     tttgcaatgg aaacaaagaa gtcgacgatt ctctccatgg ttgaagtggt gagaaggata    454500
     ctcaaccagc ttttggccga ggagcgggga atttccgggc ccatcaagcg ctgcacagtc    454560
     gaaaatagaa gctgcatgca gtggtgggtc gacaaaaata caagtgtatc gtcaaaaggc    454620
     gcatttcgaa gaattgattg ctgtctttca atagaataag ccttattttt gtattggtga    454680
     gccgggtgac cacagtcaga gccagaagat gcggctgatt ccaagaagaa taccgcatag    454740
     gctctatatt cgagtaagta cgcttccaag taaaataata tgatggggcc atacatcgga    454800
     tgcaaaagtt tggcttggag cgaagccacg gctttgctgt agataacttc tctctctgtc    454860
     ttggaggacg accacaaagg ccgggcaatt atatcggtct ccaaatggtg ttcaaccaca    454920
     tgatcagcca agtgatagga tagtcgaata caggtattcc aacatcgttt taaatcgccg    454980
     agatatccca gagaataccc tgcgttgtcg tgggccatgc ctgtgctata ctcaggaggc    455040
     gagggaggga ataactcgga gacgaaggca atgtcatcac ccggggacat gtcgccatca    455100
     ttgcaatggc tttgacgatg ctgctttcgg agttgaacat atgcccatgc tatggcgcga    455160
     tccaacttgg aaacccggtc gtggagtgct cgacaggaaa gaaacaaagt gccaatatcc    455220
     ttcagatcac aaaaggctag gatcgtaaca aagacatcac acggaagccg tttccaccca    455280
     gaagttctag gcacagccga catcgaatcc cgtttacctc tccggaggac tgttcggact    455340
     cgattgagaa aacgcgtcat ggttcataca tttggtaaat catttggaat atcctttggc    455400
     atgtacattt aaaatctttg acacgaaacg ataaacaagt caaatggatg atagaaaaga    455460
     ctcagatgga atggctccgg ccgtgatttg tatgtgccca gaccgtagag acgcagtgat    455520
     gggaccaaat agagcactgc aaaaacataa tccgatactt tgagcgaaga tgttgggttt    455580
     tacataagaa tatcaaccgg aaattaagcc atagggtttt ttttcgaaac aagcgagatt    455640
     gtgatgatgt cggcaactga tatcggcggt gcgtagttgc tgccttatat tcaaggcctc    455700
     agaattccac ggacatttgc ctttccgttc cgtagcctta ccttacctcg atgccaccag    455760
     agatcaaatt gcttaatcaa gcatgccagt cattcatgtc tagctgggtt gcttttcaac    455820
     caccgtgctg catcgatggc tagtccatat aactccttgc atggtgcaac ggattcgcca    455880
     tcaaaacagc ccgcatcgta tgcatgtgtg gtctgtcaca accgaaaggt caaatgtgat    455940
     aaacaagatc accgtactcc ctgttcaaat tgcgcaaagg caaatgtgga atgcatctac    456000
     cgtgctccac cgcctcgtcg caaaaggaat cgagaaacca acgggagtgt atctcaagaa    456060
     cgcgcaaaac atcttagacg cagcacggga tttgaccaaa atccccctgc ccgtcagcat    456120
     catcaccatg ccgcgggaga tcaacggacc gaaccagaaa aaagtggatc tgggaggatg    456180
     atcgtgaaag atggcaattc catctatctc gacaagtgag ttgctcgcac cgcatttgac    456240
     ctagtgtcag tgttctgacc tgagtaatag caatctttgg accagtgtga gcaatgaggt    456300
     tagtacctag gtatttctgg cttacacgtg ctatcaaccc tgaccatctt ccctagcttc    456360
     caaatgcagg agacgtattg gacgatggat cggataatgg taccgagaac tttgaccagg    456420
     atgtgagcga cgattatgcg atactctcga catctgcaac aaaaaaagtt cttacagagc    456480
     tccacccgag tcccctgaat atcttcaagc tgtggcaggc atttctcgag aatgtgaacc    456540
     cgctcaccaa aattatacat gctccaactg tccaacaaca aatcttggat gccatgagtg    456600
     atttgttaga aataagccgg gagatcgaag cattgatgtt cgcaatatac tgcatagcat    456660
     tggtttcctt gcaagcagaa gatgtcgaaa aatcattcgg agaaagcaag aaagccctcc    456720
     tatcaaagtt cagacgagga gctcaactcg ctttcaagaa tgcatcgctt cttcgtacat    456780
     caagctcagt agtccttcaa gcgtttatgc tatacctggt gcgttcatat tcctttgacg    456840
     agatctaatc cccctttaac gacgtttcgg tagctttgca tgcgttcgtt ctctgatcca    456900
     catactgtct ggacattatg cggcattgca gtaaggattg cgcaacggat tggagttcat    456960
     cgagacgggt ctgcacacgg gctgccagta ttcgaaacgg agatgcgccg tcgcatctgg    457020
     ttccagctca tgatcataga tgccacatct gcacagttct gtggtgtagc accaacgccg    457080
     ctcccaacca caattgatgt ccaaccaccc atgaacgcaa acgatagcga cctcgatcct    457140
     cgcatgaccg agccagcctg cgagaagcca ggaccaacag aaatgatatt tgttctggct    457200
     cggagggcat ttggaaaatg gctcctccgt ttgtcaaacc aaattgagag ttctaatact    457260
     ggaccatggg ctttcctatc atcgtcgtcg atgtcattaa aggacaagga caagacaatt    457320
     gatgaacttg aagcgcacat ggaagacacc ttcctccggc actgcgataa atccatcccg    457380
     ttacatatgg caacgacaat gatggtgcgt tcggcgattt actacacccg gatgatagcc    457440
     caccatcctc gtcaatatca ggatcccgac atgcgcatat cccaagcaga gagagacatc    457500
     atctttgaga attcccgcaa gatgatagag tatgctgact acgcccaaaa gaacccagtt    457560
     gtacggaaat actcgtggca cacgattaat tttatgccgt gggatgccat gatattcatg    457620
     ctctcgggga tgcggcaccg gactgatccc gatgagaaga gcgaagtctg gcaattgatt    457680
     ggaaatgtgt actctgggca tatcaagacg atgagcgaga acggcccaac gcctctccac    457740
     atggccattc aacacttaat cgtcaaggcc tggcggacat acattgaaga gtgtaacctc    457800
     aaccaccgta caccaacacc ttgtccaacc atcgtcgcat ccttgttagc caatgcagca    457860
     gggatttcta gcccgcaaca ggaagatgaa aacttcccag ctggcaagcg tgatgctaag    457920
     ccccaagatc aacctaggta cgaccatcct agttcacaat tcgggctgga tgaaaagttc    457980
     ggtttcctac ctggtgatag cccgcaggat tggaatgact gggacaatct tctcagtaac    458040
     ttccaaggat cttttacaga tgatgcaaca tatctgccgt gacctaagta tgatgatgga    458100
     ataaaataca atattccact agaccacaaa aaccaagatt cttgtctgag gctctaaggg    458160
     tctagggaag cacatatccc agttcgacac atgattcccg acactgtaga tttctcagga    458220
     ttcgctcaca taccccttgt gatgaatctc aagaggtatg accgcaatat tgtgttcgaa    458280
     gtccatgcgt accccaaaag ttggagaacc tcgcgccgat cggcatgcga cgccccgatg    458340
     ccgtccaggt gtcttggcgt ttacgagcct cggggtcggc gtctaaacgg ccgagcagag    458400
     tcatgattaa cattcttttg gtgttcattt ctttacagag cgatgatatc tgcctggtcg    458460
     gaaattttat ttaaagtcgg ttccgctcgc tgctggcttt ggatatgacc accaatttcc    458520
     tacttgcaat catcttttga ccccggtatt tttgatacat caattcaatc tatataccct    458580
     ccgaagattt tccaacatga aacccaaaac ggatgttctg attgtcggtg caggcccaac    458640
     tggccttgtc cttgctctgt ggcttcacca tcaaggtgtt aatgtccaca tttttgacca    458700
     ggcagaggct ccggcgaaag actcacgagc gataattgtt catgcacgca taatcgagct    458760
     gtatagacag ctcggattgg ccgaagatct gctggcactt ggatacaagt taccggcgac    458820
     aaatctttgg gttcatacgc agcacaaagc acacatttcg ctacaggact tcggtcgcaa    458880
     gttgactccg tacccgttca tgctaagtgc accccaagac gaccatgaaa gaatgctgga    458940
     aaaacgactg aatgacgtcg ggatccatgt tgaacgaggg tcaaagttgc aaggctttgt    459000
     ggaccacggg tctagcatca ctgctaccct gttccgcgag gctgatggga gctcaaccac    459060
     acatgaggcg tcctacatag ttggatgtga tggagcacat tcggctgttc gccacgcaat    459120
     cggtgccaaa ttcgagggtg aaacatacaa accgctgttc tacatcgctg atatcgaagg    459180
     caaaagcgac aagcacttca acggcgaagg gaacgtggtg ttcacagacg acactttcaa    459240
     cctgatagtc ccctacaaca aagcaggcca tgcacgattg gttggtatca tggcaccgga    459300
     taacgatggc catgaccgtg agtcgccaga gtgtgagcac gagatcacat tcgaagacgt    459360
     tcgaccccga atcatgcaag tgatggatat agacatcaca aaggtcaact ggttttccac    459420
     ttaccgcagt caccaccgcg tggcggacag attccgcagc aatcgtgcgt tccttgtcgg    459480
     ggatgcagct cacatccaca gcccagttgg cgggcaggga atgaacaccg gcatcatgga    459540
     ctccatcaat ttggcatgga agctagcaac ggttctcaga cagacaaaga tgaccgaaga    459600
     agcaaaacac caactattgg aatcatatga gtccgaacgc cgctcatttg ccatgatgat    459660
     agtcaagtcg accgacacgg gctttatgac gttaacatcg gaaggattct tcccacacat    459720
     tcttcgaaat tggctgattc cgtatcttgt gccactgctt ttgagattcg attttacccg    459780
     gaccagaata ttccggggcg cttctcagct catttgcaac tataggggca gtagtctttg    459840
     tgagactgtc catgggacag tgcagcctgg cgatcgtctc ccgtgggttg aaatcaacga    459900
     agtggacaat ttttcaaccc tgcgagatgt ttgttggcag ctccatatct atggggagtc    459960
     tctatcacaa gttgtcaagt gggcccagga gatgagtgtg agggttttca ccttccactg    460020
     ggacgatcaa tatgccaaag ctgggctgat caaggatgct gtctacttgc tgcgacctga    460080
     ccagtatatt gcaggtatct ttgagggtcc gtctgttgag gcgcggctgg acgaatattt    460140
     cgctactcgc ggattttacc tagatagaga ctagagtctg gataccacct caatgctctc    460200
     tccactattc tgttcgttat ctcccattcg actattattc cataccctgt cttagaccac    460260
     gtgcattgcg atatgtcgca ttttcccgct aattcccctt ttaagacgcg gaatatagcg    460320
     ttatccgact cactcccgag gtctactcca aatgtcactt caaatgatac ctagcgaatg    460380
     ggatacgaaa gccacatccg tcttcatacc cctcggcatg cgaaaagaac ggagcgtgat    460440
     tggtgacttg gcacatatta agcccttgtg gcggatgatt tgattggtgt gcctgcaggg    460500
     ctagccttgg aagctccacc taagtggagc cataagaccc acctatactt ccgtctgggc    460560
     atgttctccc ggggacttcg ttgtgtttgc atccaatctg gacacgagca ttatcaacta    460620
     ccggtagcat ccggattgtc tcaactccac caatgctatg ccggccatac tcgcgtacaa    460680
     tcgatgttga tcggccgatc aaaacccatg gactgaacat gtgccagaga cggccgcatt    460740
     tcatttgcca tggtgtctag tttctgcctg tacattcctc aactattgag catctcttct    460800
     agtgcacata acatgtaggg agtgagatat aaaagccttg cagcgaccga ggaaatgatc    460860
     ttcgtattca cttcagtcca actctgttta ccacatcatt taccggcacg atgaagacca    460920
     ccgctctcat ttccttgctc ggtctatccg gtagcgcctt gggtgcggcc gtggagactg    460980
     gcaaaggaaa cgcgcccttc ggctacaagt ctggctcgaa ggagtccatt gccaacatga    461040
     aggacaagat cgagaatgtt gtctgggtcc tgctggaaaa tcgcggattt gacaacattt    461100
     tgggtggtgt gaagaagaag ggtttggaca acgtcgtcaa caatggtcct ttctacaact    461160
     tggaggatat tagcaaccca gacagcaaga agtggcccag tcagttcaag aactacgact    461220
     cggttctcaa tgaccccgac cacacgctca ctggtac