(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13

ID   PENCW_13; SV 1; linear; genomic DNA; GRV; FUN; 3716833 BP.
XX
AC   AM920431_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 19)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c16, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920431.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3716833
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   rRNA            complement(1..821)
FT                   /gene_name="small subunit rRNA"
FT                   /locus_tag="Pc16e00010"
FT   CDS_pept        join(complement(1486..1629),complement(983..1384))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823842"
FT                   /orf_name="Pc16g00010"
FT                   /product="Putative uncharacterized protein Pc16g00010 "
FT                   /protein_id="CAP92671.1"
FT                   /db_xref="UniParc:UPI0001831CCB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R5"
FT                   /transl_table=1
FT                   /translation="MSLSFSKKWPTLYGDFAVHGPPPYKNCPPEQFLATSTAFCIFTPQ
FT                   MGSCWGGSPTAVVSSGTQQRLIPPMTSSPRSALGPLGGHSAPGLVVMGALAELLPGASA
FT                   VVTEARGPFGARHRWSLWIDGRWPYPKPRFLEGAAPWDPPFAGVVHGVWTLHPRATCRS
FT                   LPAPSRAPGPDPLRADWC"
FT   CDS_pept        join(1904..2658,2775..3246)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977032"
FT                   /orf_name="Pc16g00020"
FT                   /product="Putative uncharacterized protein Pc16g00020 "
FT                   /protein_id="CAP92672.1"
FT                   /db_xref="UniParc:UPI0001831CCC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S1"
FT                   /transl_table=1
FT                   /translation="MPARAHRRAPDPLAGAVNPLPPCRGLSPMAPRGSGLALYAPLPKP
FT                   PGRWPPSTPDPPAVRRTGESVKSPYLPPRRGSSPTPPPKPRLPKPREGAPAPXXXPXAS
FT                   RLALGRPLRAPASPPPHPLHLTRRCGQLPRRANWRPTPPFPGPRSPAGRPSPRGWGRGD
FT                   RRWRTVTWGPACRGVVPRGSPCQGPHRNIPRHPGTPHATRRGHSCGPSLPQPRTVGPGS
FT                   LLHRLTDPIWGVKMQNAVQVAGNCSGGQFLCFGPAFAPPTPILDPAYLPPGPGGALATI
FT                   PAEGACSTVASTKGPASLPAWTGCPLDPRSGPRPTRRANWPIPKGTITPRGRPVYCLSS
FT                   YVPPQLKITALDSPSPPSIPLHPPHHPLHSTAMARNLQPHETHHPQFPFAALRHPPSPS
FT                   PPTTFHRNN"
FT   rRNA            complement(4012..4112)
FT                   /gene_name="25S ribosomal RNA"
FT                   /locus_tag="Pc16e00020"
FT   rRNA            complement(4410..5103)
FT                   /gene_name="28S ribosomal RNA"
FT                   /locus_tag="Pc16e00030"
FT   gap             5242..5341
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(6169..6855)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   gap             8105..8204
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(10378..10406),complement(9798..10266),
FT                   complement(9015..9624),complement(8497..8963))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128152"
FT                   /orf_name="Pc16g00040"
FT                   /product="Pc16g00040 protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP92674.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI0001831CCD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R4"
FT                   /transl_table=1
FT                   /translation="MRKSWRAGVTAQIETVYHLLRPDAIEGRLPGRRRERVNYISPGPN
FT                   DVWHVDGHMKLEPFGIEIYAAIDGYSRYIVWPYVGVSARTAVSVQRQCLDVFAEYGFQP
FT                   RKIRSDRGTETVLLADTQYELRKLGDPSVQIRDCYLYGRSVDNQRIEGWWGLLSRATTG
FT                   LFHEYFKCLQRENLFVKDCIPEQVSLLAIYMPLIRCRVEAYTNQWNYHHIQSQPHRPHV
FT                   VKGKPIMNWKHADVPDLHCPINLDPTSEQGQLLQSLREDVQDWDPDEYLPPSTLTWCHQ
FT                   QLTEIGQQLVGIPFNPNDPNPALCGEPRAPYRAVYEALRERAFTHWNTGYNPILDVCIK
FT                   PHGAADWQGIGAAPANWQVADWQVTADWEVSRDFLSLINFSSSIDFSSSINFSSISSMA
FT                   APNSVLANAFVTALQQAGYTISAPATAPATAPATAPPPPYTATPYTAPPYTAPLYTAPP
FT                   YTAPPSTAPPSTPFSGLRGTVSSTRLAYQRQRGNQVAERDIPLTVTFYLQERPGETNCW
FT                   GGHVLIT"
FT   CDS_pept        join(10876..11683,11768..12445,12560..13618,14312..14620,
FT                   14912..16352)
FT                   /pseudo
FT                   /gene_family="HOG000213032" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(16511..17662)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076644" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945507"
FT                   /orf_name="Pc16g00060"
FT                   /product="Pc16g00060 protein"
FT                   /protein_id="CAP92676.1"
FT                   /db_xref="UniParc:UPI0001831CCE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R6"
FT                   /transl_table=1
FT                   /translation="MSDTGSGSGSRGESSRRLPAPQPQPVTQGTRLSEKTDVKWMKACT
FT                   LRVDGSNFVRWKREITNGLRMTRIENVVNFNLPKPKEDDPEYDTWYYWSVYTLGWISST
FT                   LDNEITTILEGSIQQFPEYADDLMKEITRIVSGDNKVLNVGAEVLKFDKLKRENYTTAK
FT                   DYIMAYQRQFNILGRYGVAPHPFAALYTMLHALREELPSVNFTFDTLKRQVPTETTMND
FT                   FGEYCKELIIESNTTTEETSPGLAKTTRSSSPSSSSRGGRGQRGRGGRIGRGNDWRKPK
FT                   EDNKVDDKGEAKDEPEEKQLRGAPPKGADIDEWAERQRCQQPQYINGTECTHCRLDGHP
FT                   AKACFHLMEEFVFDGWEPFPEVWCYATARMEKKDAKDAKDGKK"
FT   CDS_pept        18329..18562
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        19853..21018
FT                   /pseudo
FT                   /gene_family="HOG000024136" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(22280..22495,22556..22775,22833..22901,22956..23558,
FT                   23609..24051)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171616" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945508"
FT                   /orf_name="Pc16g00090"
FT                   /product="Pc16g00090 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="CAP92679.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0001831CCF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R7"
FT                   /transl_table=1
FT                   /translation="MLGYALNGSLPGDVVVAVGVILLAGYVLQFAFAVGSKLPLINQNS
FT                   ILDFGSMKSRRSYVTGAADLIKSGFAKSAKGFRLVTDNGCQVVLPPRYLNEIRNHPDMS
FT                   RDKASAKELHSHLPGFEPFREGSKDERIMHDVVLTKLTRKLGRVTEDLSKETAEVVRKY
FT                   WTDEKEWHALSLRSTITPMLARMSSRVFLGELLCRDPSWLHITINYAVHVIRATDELRQ
FT                   WPKMLRPFVNRVLPSCRMIRSDMKQALGLITPILNKRRADREAAIKAGTPPTQYNDAID
FT                   WMEDVAKGRPYNPAISQLLLSMAAIHTSADMLTQILFDIAAQPDLVKALREEIITVTRE
FT                   NGWNKISLYKLVLMDSTIKESQRLKPVAITPMRRLTTADVELSDGVFIPKDTTILVSAN
FT                   SMWDEKNYENPEKFDGYRFLKMRDVPGQQTAAQLVAPSPIHLGWGFGQHACPGRFFAAN
FT                   EMKIALCQILLKYDIKLDEKRLPQVRRFGVSMTADSTANLLIRRRQEEVSPEELGCQV"
FT   CDS_pept        join(complement(25105..25931),complement(24640..25048))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217399" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671084"
FT                   /orf_name="Pc16g00100"
FT                   /product="Pc16g00100 protein"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92680.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI0001831CD0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R8"
FT                   /transl_table=1
FT                   /translation="MTSTISSLFGYKPDDYGAPKAPAEPVKALPASWYRSPEIYELERR
FT                   AIFSKKWILITHKLRFEKPGDFYRFEMTGFSFVLCLNRQGNLSGFHNICRHRAFPLVSQ
FT                   DQGNSPVVSCKYHGWSYGLDGKLTKAPKDDDVPGFKKEEQSLFPVHIHVDALGFVWVNL
FT                   DSSRTPIPWEDDFQGVDTQERFREFDFGRYMFDHTWHMNGNYNWKTLADNYNECYHCSV
FT                   AHPDVAKLADLSYYYTVSKAGHIQHFSRPKQDKVKDDIKNASTYYFPNACMTVSPHFFY
FT                   LMRCVPTSVGTCSMEYEVYRNKEASDEDFEYIDSFFKRVLNEDKHLCNAAQKNLDAGVF
FT                   VNGQLHPDLESAPLFFQNTVRGLLRNHRDEEKRQNMELWPARQSSPGSATAEDINFCAE
FT                   LTCSGKYGDLEW"
FT   CDS_pept        join(27016..27068,27211..28095,28146..28869)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945509"
FT                   /orf_name="Pc16g00110"
FT                   /product="Pc16g00110 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92681.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831CD1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R9"
FT                   /transl_table=1
FT                   /translation="MSFNRKRAALACTFCRSRGLCWFTIQGECPLTGVDRIDTSGGTRE
FT                   ILSRLHDIETILKAQSDQISNVAKSHIGAFAVPEASPSGLTTAPPRELPNATMPSPWLF
FT                   SGFNMQPDLPELPPLTIPVKHKTSSSYLLSLPPVKSLIGEYPTDLFFLLESRAHLPPEL
FT                   SFEKWPVPKPSVEIESDVATNLVSIFFASAHHDHPILDPGKFEDIFRRFLENGPDSSTA
FT                   SALCMVVLALGAVAASPLDAHTFLHSPPGMQYMQHAMPTLLSQSAWSLSCSLMLPQALV
FT                   LASVYFAYIVRPLQSWRLVYSATTIIQLKLSGIDTQQKESWWRESLIRLFWSCFLIECD
FT                   RLAELELPRSGLQQLTDEISLPECTNLGTMQSTCYLAEISIRRLLNRVHNSLYPNKKHG
FT                   LALSSTTFATPEEFAMDDISSISAVCDELRSQLELWHSSIPDIFRPELNFEASMQESND
FT                   RQAILRIRYFATRHIIYRPFVLFIVTHDVTSISHDIIEKAGICLESCRCYIHSTARILK
FT                   TPSQYTWTFSLSYVRWTEALPTSADKANLTDHSVPL"
FT   sig_peptide     join(27016..27068,27211..27214)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R9 "
FT   mat_peptide     join(27215..28095,28146..28866)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R9 "
FT   CDS_pept        join(complement(30437..30616),complement(29516..30379),
FT                   complement(29128..29460))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113757" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671085"
FT                   /orf_name="Pc16g00120"
FT                   /product="Pc16g00120 protein"
FT                   /function="catalytic activity"
FT                   /biological_process="cellular amino acid catabolic process "
FT                   /protein_id="CAP92682.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009063"
FT                   /db_xref="InterPro:IPR001354"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR015654"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="UniParc:UPI0001831DAA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S0"
FT                   /transl_table=1
FT                   /translation="MSAAPVHVQDITVTSFEVIDLRFPTSLDGVGSDAMHVGTNGSHPY
FT                   IRLKTNQGTLIGEGIAFSNGRGSELICMALDIFARRVVGKSMHELTRDMGKTWRYMVSD
FT                   SQYRWIGPEKSVTHLAVAGVLNAVWDLWGKILGKPVWKIVCDMDPEEVVRCIDFRYITD
FT                   VITPEESVEILKKTQKDKETRLQEALENRAVPAYTTSPGWLAFSGDRMREVLQETIAAG
FT                   YTTFKFKVGTNVEADRERLAAVREVLGYDQGHQIMIDANQVWSVPQAIEYMKRLVEFKP
FT                   VFIEEPTNPDDVLGHATIRRALKPYGVGVATGEAAQNRVTFKQLLQAEATDVCQIDAVR
FT                   LGSVNECLAVMLMALKFNVPCVPHNGAMGLTELTSHLSTIDYIAISGRKSMLENADSHR
FT                   ENLRHPSKIENAHYVTPLDPGYSTGYTHTALEKYTYPSGSFWKSDIGLEIIAQPTGGEL
FT                   "
FT   CDS_pept        join(30942..31187,31248..32021)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167998" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128153"
FT                   /orf_name="Pc16g00130"
FT                   /product="Pc16g00130 protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAP92683.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831DAB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S2"
FT                   /transl_table=1
FT                   /translation="MVKFILVTGATGFIGAHIVDVLLARGIRVRGATRSLEKGDSMIKA
FT                   RPQHSGRLEFVQIDDFERPGGLVEAVQGVDGVIHTASPFTYNTRNNERELVRPAINGVR
FT                   AVLEAASTNPKIRRIVITSSFASVLDANRKGPLYFTYTGDDWNPLTYEESVDPATNAII
FT                   AYRGSKKFAELEAWKYVQEHSPKFDIVALCPPMTFGPVVHPVSHVDKLNESNLMLWKIA
FT                   NGENPLPVARVPFWIDVRDLAIAHVESLLRNEVGGKRYVPSSPERFSYGLAAKIIAEEF
FT                   PDLKTKVTQEDQVIDESCGLDGQTAAMELGYTYHLFHDTVRDLVSQTISLSERSPSCR"
FT   sig_peptide     30942..30989
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S2 "
FT   mat_peptide     join(30990..31187,31248..32018)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S2 "
FT   CDS_pept        join(32657..32779,32837..33645,33713..33813,33866..34072,
FT                   34128..34384)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977033"
FT                   /orf_name="Pc16g00140"
FT                   /product="Pc16g00140 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92684.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831DAC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S3"
FT                   /transl_table=1
FT                   /translation="MAWFGYDQGVFSGVLISADFKKHFPQTKESNISGITSSCFSLGAF
FT                   FGAIFAFTLGDRLGRKKTITLGLVCNTIGAVLQIVSWHLPQLIVGRIINGFGMGLTSST
FT                   CPVYQAECSKPRVRGKLVVVGSLSNTAAFCLSNWMNYGLFFQGEALQWRFPLGFQLIFP
FT                   CIVVGALIFVPESPRWLLLQDRHEEALAVIARLEGRRKDVHDPDVTAQFLSIRSALEVE
FT                   RQSQVPMADVLMCRDKTQNLRRLLLSCGTQFMQQFSGVNALGYYLPTLLQESVGLAEEE
FT                   SRLLTAVNGTTYLFSAFCCLAIIDRFGRRKLMLYGSVTMGACYLIAAMCLKTGEGDPSR
FT                   KQQVVTTAMFFLYYFFYGTSFAKVPWVYNSEMNSLGWRTRGAAAATATNWMGGFIVTQF
FT                   TSVGVNTLHWRFYLIFAVIAWSFFPIIFCLYPETSRRTLEDMDEIFIRHPSPIVCGKQE
FT                   LTQRKRPQTFVDAERDRIMENKEFGKETAKGGTTAHYEHV"
FT   CDS_pept        35978..37264
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076645" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945510"
FT                   /orf_name="Pc16g00150"
FT                   /product="Pc16g00150 protein"
FT                   /function="ATP binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP92685.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniParc:UPI0001831DAD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S4"
FT                   /transl_table=1
FT                   /translation="MVVELDTTLAELYANNGLPGPIVVDLYRTYTHIDLHDNFPRERMF
FT                   VEDEDPSTYCSEEEDLPRFKKWALNSRTIRHLPMVGPADVILYLPYNSRDNIDRALDQF
FT                   PKHQRPMVKYVDLDSPCMAKDRRMAIKDKKLVYWRPKSWMVGEDCSVPPELSYMLNDKR
FT                   FLIHPEIPTPSLEMVSLLHEDQRDYLVKLQLPFVVKFCRCSSGQGTYIATTEEERRQML
FT                   EAVRRYRERGGVDIQVSEFVGSRKPHYGVNFFVGRDESLQPCFLGATEQVVAKNGVWVG
FT                   GVIDYQAQGDLERRLRNTIAVVARTLQQYSYVGWIGIDVIFDSDDRPLVVDLNARIAAG
FT                   IGIVLFSKHFMSMGLPFAGMETVSFTGPASGIYAALSASIESGKVIVTLSAEVTDTESV
FT                   ASVVFGGRTRDDLNAVADWIRDVLRTCLN"
FT   CDS_pept        join(complement(39295..39348),complement(39200..39244),
FT                   complement(39097..39144),complement(38137..39030),
FT                   complement(37998..38071),complement(37863..37944))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000116440" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977034"
FT                   /orf_name="Pc16g00160"
FT                   /product="Pc16g00160 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92686.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI0001831DAE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S5"
FT                   /transl_table=1
FT                   /translation="MATSLRNIIVVGGSFVGRTTAQELARIVPSTHRVLLTEPHSHFHH
FT                   LFTFPRFAIVPGQEHKAFIPYSGIFNASPNPSSHGVVQARVLSVKPTHIELDREWQGSK
FT                   DVPFDYVVVATGTRLSKPAAMDDDDKASSVEYLQKHQAGVKRSQSILIVGGGAVGVQMA
FT                   ADLKEYYPEKEVTVVQSRPRVMPNFHSGLHDLIKRRFDELGIRLITGSRVTIPPNGFPN
FT                   DGSTFDVQLTNGTTESTQFVILATGQTPNNQLVADLKSSRPDAESVVNPDNGFIRVRPT
FT                   MQFLDEQYSNLFAVGDIADTGAQKAARPGSAQAAVVAKNIQALIEGRAAEDTFAKGPGA
FT                   IHLTLGMKHNVIFRNPNTAEGQTEPWINPKDDGREDMNVEAMWERLGISVDNPRQYHL"
FT   mat_peptide     join(complement(39200..39235),complement(39097..39144),
FT                   complement(38137..39030),complement(37998..38071),
FT                   complement(37866..37944))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S5 "
FT   sig_peptide     join(complement(39295..39348),complement(39236..39244))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S5 "
FT   CDS_pept        complement(39905..40996)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181391" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945511"
FT                   /orf_name="Pc16g00170"
FT                   /product="Pc16g00170 protein"
FT                   /protein_id="CAP92687.1"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="UniParc:UPI0001831DAF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S7"
FT                   /transl_table=1
FT                   /translation="MPGHFGQKILNTLGLNDHIHHQSSSVRLPGRPALSNDERGLSSPP
FT                   NNGTYPRLCRLSDGTILSSFTRFPDGQRSLRVAKSTDNGRTFEDFSEVTRAAGDVDNMF
FT                   LCEVAPGTILAAFRNHDTGPNGPTHFRITVCRSTDGGRVWQYASQAAEKRPPLGIWEPF
FT                   MRVGRQGEVQLYFSQEFAHNNQCTMLVISRDQGSTWTQPTCLHGDQDPLRDGMCGIAPT
FT                   FDNGREALLMVFETTRYGPFSVEALLSYDDGATWGWRHEVYRPRQGHNAGSPQIASFAD
FT                   GSMATIFMTDEDSNRVEWVKNASIKVVFAGPPVEGRVQWSSPTLVSPASSFWPGIMALD
FT                   HHNVLATYDRGGPLTKTITWHPA"
FT   CDS_pept        complement(42245..43294)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169597" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945512"
FT                   /orf_name="Pc16g00180"
FT                   /product="Pc16g00180 protein"
FT                   /protein_id="CAP92688.1"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniParc:UPI0001831DB0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S9"
FT                   /transl_table=1
FT                   /translation="MHFHSTLLSGLAILPVALASWPFFEHTAKLSATPYRNERPNVKVE
FT                   TLFQFPNNGSWIDNMVIRSDGNLLLTRLDTPEVWLFDTTTGNATLAYSFPNVTSCFGIS
FT                   EIDDDVFAVVVGNFSAKTFQPGPASFSVQKLDFTKSDSEENARALGSPTASEIVAMPDA
FT                   GALNGMATLSRGSNLVLIADSPKGVIWKVDTKTGDYSVALNDTTMAPAKGQGLPLGVNA
FT                   LTVLGDYVYYTGTTQMVYCRVKVDKEANPVGDFEVIASGFLPDNVEMTEDGVAYIPTAP
FT                   QNSVVRLTPSGQISLVTGGQVSTQLAGPSSVRLSKDRQILYVGTNGGQIAPVLGSFIEP
FT                   AKIVKVSFE"
FT   mat_peptide     complement(42248..43237)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S9 "
FT   sig_peptide     complement(43238..43294)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S9 "
FT   CDS_pept        complement(43746..45080)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116236" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945513"
FT                   /orf_name="Pc16g00190"
FT                   /product="Pc16g00190 protein"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP92689.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001831DB1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T0"
FT                   /transl_table=1
FT                   /translation="MSPRFPSENVDVSPLGAPLQFEFSQRKASNRFLKAALTERMASWS
FT                   PADLSARGIPSQNLINLYRRWGEGQFGLILTGNIMIAYDQLESPGNMIIDLENPLSGER
FT                   FEAFKQLATAAKKHGSLIVGQVSHPGRQTFEKLQPNPVSASDVQLVMEKFGAFGKPHAA
FT                   TEEEIQDIIRRFVHVAVYLQKAGYDGIQLHSAHGYLLAQFLSQTTNKRTDKYGGSLANR
FT                   ARIIVEIAQAIRQAVSDPGFIIGIKINSVEFQEHGFTPEESKELCEILDQTNFDFVELS
FT                   GGTYEAGAFQHKRESSQKRESFFLEFADLITPALKRTRSYVTGGFCTASGMVQALKTVD
FT                   GVGLGRTITQEPRLPRELLSGSVKGAIQQKIDPQDFFKTSPAAGAQMLQIAQDEEPIDL
FT                   SCDANMEVFMKSLGEWAQQMQKDGAAMNMYGYAQLPKGQPFQSHL"
FT   CDS_pept        join(46042..46202,46251..47143,47202..47391,47444..47643)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(48729..50006)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945514"
FT                   /orf_name="Pc16g00210"
FT                   /product="Pc16g00210 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP92691.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="UniParc:UPI0001831DB2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S6"
FT                   /transl_table=1
FT                   /translation="MRLLSSLASRPHALSGAVQPARRSHLTWRLYSSTPAAKNRPLPLA
FT                   GVTVVSLEQAIAAPFCTRQLADLGARVIKVERPGVGDFARHYDTRVGGLASHFVWTNRS
FT                   KESLALDLKHEKDHAVLMKLLEKADVLVQNLAPGASARLGLSHEALKGEHPDLIVCDIS
FT                   GYGQDGPYRDKKAYDLLIQNEAGMLSVTGTGKEPVKVGISIADIAAGMYAYSNILSALL
FT                   QRGKDGQGCHIDISMLESMVEWMGFPMYYAFDNAPGPVPAGASHAAIYPYGPFEAGDGQ
FT                   SVMLGIQNEREWVSFCNGVLSQPDLATDPRFSSNSQRTQNRDELKSIIHDAFSKFTTTE
FT                   TIARLDEASIANATVNDMKDVWGHAQLQARDRWTKVQTPVGAIPALLPPGSTNSAGRDG
FT                   HGAQMGSVPRVGEHNEAIFAELGLSN"
FT   mat_peptide     complement(48732..49961)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S6 "
FT   sig_peptide     complement(49962..50006)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S6 "
FT   CDS_pept        join(complement(53280..53403),complement(52751..53250),
FT                   complement(52620..52700),complement(52038..52558),
FT                   complement(51683..51871),complement(50594..51590))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671086"
FT                   /orf_name="Pc16g00220"
FT                   /product="Pc16g00220 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92692.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831DB3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S8"
FT                   /transl_table=1
FT                   /translation="MLRRTTRASTACSWCHHRKVRCDASILGSPCTRCRQDGRSELRLQ
FT                   KGLLSRTHLMTSIRTSSSANPLPTHQSSGSDVTTGRKSNDQHQSPNHPALTSQLRAHGL
FT                   SLDDRSTSSPQSPNVPYTEYAFVDSQQLLSLPSEDVAFLASKGCLSLPASDAIDEFARQ
FT                   YFKRIHPLVPVLDEAKFWRIYRNNQPTGAKMSLLVLQSLIFTSCPFMSLETLRQCGFND
FT                   RRDARKQLYHRAKLLFELRTEKLPHANAQGAVLLTHYISAEDPQAGSLWVTRAIEHAIL
FT                   IDAQPSLLVEDVAISLKKRLWWSILLRDRSLCIGLRRRPQVTSSFYRWSDWLSIEDFGE
FT                   ELYQSRVYDYNTKRRLFGALQGQCELAVLLTDLVSLVFTHRKIPRRLLSMIEFQGLLSR
FT                   IKTIKKSLDDAARVDLAQYAAFVVEENLFYAEDMYNNLVREISNDLRDGVDGLSLVMEY
FT                   FSVNGYANSLPLSVLGYVGMPLVLAAIDLKLSPSRQEIEVRQRRLNSLSQIIRHSETLY
FT                   DVTDFVAVGTNHILQLAYMTTQNLFLGEKTAPLLSLDGVARQDSLVRTQRQERASDESM
FT                   SPKPNRSTSWQDAFIRCPRAYLLISACVDYSLEIGRLPSASGLPEIVRDLPIARLPWTS
FT                   DIPSSDSTTSLLSQMNQVQRESYPTSVRASVEERDVLETTTIESQPEKSFTPKTAQINH
FT                   YSSPDAFPYSTTPSLVTDEQLQYINGVAGQTTCESTAPNLDFMDFGDCERVSDNTTGAC
FT                   AVSIPLELIGHMQAECRFEQAAFDYGTTLPLPVEAIDSTLFDSFFYEAFE"
FT   CDS_pept        join(54928..55051,55111..56228)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671087"
FT                   /orf_name="Pc16g00230"
FT                   /product="Putative uncharacterized protein Pc16g00230 "
FT                   /protein_id="CAP92693.1"
FT                   /db_xref="InterPro:IPR022190"
FT                   /db_xref="UniParc:UPI0001831DB4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T1"
FT                   /transl_table=1
FT                   /translation="MQDPVPAAPSLRAPSAVPEDPSADIECIDLSGEDATNQDPGTSTG
FT                   LRFVDAKGNDVTNSMPAGVTQTGQLILDGVERTGQAAEMAEAIKANGGFLDWSTTADGA
FT                   FILRSVVSEKKQLAALGQTLGHNIPGVVCDGCADGSAFLTCRVAAFRDRQGVGHIVLKG
FT                   SCMNCQFKKQAPVCSIRTSQPPSALDLFRSYEPNFQWGPTSAGSAALSTSPAPPTSPTS
FT                   PTSPTSPAPSAPLGPSVRFTRQQPGRHGSQSSMSVAKRPRLPSPSLSGSGTPTLRQKSN
FT                   TGSTVHVTPRSPLAGGGPQPSTPAPIVKSNQTQREEACPQIHEILSQASPDGPHRYNSV
FT                   LSRELYEASLEARVTAECRLRRQIAQANIDVEHMNRDLDALVKDRLRMDGYVSQGADQD
FT                   PCWLGHGSSSAPGE"
FT   CDS_pept        56975..58183
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128154"
FT                   /orf_name="Pc16g00240"
FT                   /product="Pc16g00240 protein"
FT                   /protein_id="CAP92694.1"
FT                   /db_xref="UniParc:UPI0001831DB5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T2"
FT                   /transl_table=1
FT                   /translation="MALVTAKEANEAQYPTTPRASMDEALMPGLVSKSLDRQCRKGFCD
FT                   FVDAVFPNIYYTYSTRVELPWFEIAQYDRGAGIAMQWAFRSLGTLQIGRVNGDQRQILA
FT                   SQEMYGRGLRYLVQAVKNPATVGTEDTLGAAILLGIYEAMNETGQNSWLLHSRGISHLL
FT                   RLRGAKSHASGYGRTLLLSFRGLLVYEAFTRGEACFLESEEWRSTLPETLEDEERRGTS
FT                   CGLGQLMDYAFNEIAQCPGFLAKTKSLVASSRTTDAEREDLISAINSSREVLSDVEIQI
FT                   MAGVKADHEGNKKESQAFFGLIPPSIKDASVKFTLEGVHSGIALLRQLSVVLMSDRNRQ
FT                   KAVTPWLKVDPCKNEWKLIKNAGEIAQAQKDNRLHPTGPQQQGSATIWHDRIALAMGMP
FT                   EMV"
FT   CDS_pept        join(complement(59480..59499),complement(59176..59386),
FT                   complement(58891..59073))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945515"
FT                   /orf_name="Pc16g00250"
FT                   /product="Putative uncharacterized protein Pc16g00250 "
FT                   /protein_id="CAP92695.1"
FT                   /db_xref="UniParc:UPI0001831DB6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T3"
FT                   /transl_table=1
FT                   /translation="MATPVDRTPNGQPRFCWCPAECLAFVVATLTGRALQGPRKHRWLE
FT                   SWDAPGTRKDSQVPVSHCVFEQSYTWKTCVAKERPSIPPPGTIHHTLRVIRANLDFTWF
FT                   CRAVLANIPSQRMFQGPYTRYGDLHNMKGMKWR"
FT   mat_peptide     join(complement(59176..59304),complement(58894..59073))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T3 "
FT   sig_peptide     join(complement(59480..59499),complement(59305..59386))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T3 "
FT   CDS_pept        join(59741..59858,59917..60000,60057..60166)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169497" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977035"
FT                   /orf_name="Pc16g00260"
FT                   /product="Pc16g00260 protein"
FT                   /protein_id="CAP92696.1"
FT                   /db_xref="InterPro:IPR018809"
FT                   /db_xref="UniParc:UPI0001831DB7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T4"
FT                   /transl_table=1
FT                   /translation="MPSSLSSSEHSGSVESNHSPSNSLQTKADPNMALHEQEPTAVNLQ
FT                   PGSRDTFSLRSIQHRDREGKVITDPDLSNPTRSRFERPLDTIRSFDAAIDAHRKQQRM"
FT   CDS_pept        join(61674..61748,61808..61845,61975..62711,62765..63471)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000164982" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823843"
FT                   /orf_name="Pc16g00270"
FT                   /product="Pc16g00270 protein"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP92697.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001831DB8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T5"
FT                   /transl_table=1
FT                   /translation="MKFSLVALATLAGVAVADLDPIVIKGSKFFYSSNDTQFTTSSGYI
FT                   DPLADPTACARDVPMLAKLRTNVIRTYAINASADHSECMKLLADAGIYVISDLSQPKLS
FT                   IDRSDPTWETDLFARYTSVVDELAQYNNTIGFFAGNEVANSVNTSDSSAFVKAAVRDTK
FT                   KYIKDKGYRPMGVGYATADVADIRADMADYFNCGEADESIDFWGYNIYSWCGESTYAKS
FT                   GYKDRTEEFANYSVPVFFAEYGCNEVTPREFTDVKALYGEPMADVWSGGIVYMYFQEAN
FT                   NYGLVSVVDSTSVSTLADFKYYSSQIASVNPTGVKKASYTPTNTALRSCPTVGSSWSAE
FT                   PSPLPPVADIQLCDCMYDASACVVADSLSSTKYSKLFSTVCGYTDCSGLTANATTGEYG
FT                   AYSMCSTKQQLAFALNKYYVEQNRAADACSFAGSATVKSVTKATGTCATQMKEAGTAGT
FT                   GTITTENTGIAGSGSASSTGSSTTSSSGAISMHSSSSFGSFQVAAYIATALLAGVGMIA
FT                   L"
FT   sig_peptide     61674..61724
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T5 "
FT   mat_peptide     join(61725..61748,61808..61845,61975..62711,62765..63468)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T5 "
FT   CDS_pept        complement(64000..65000)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(65728..66138,66198..66557)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000133453" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823844"
FT                   /orf_name="Pc16g00290"
FT                   /product="Pc16g00290 protein"
FT                   /protein_id="CAP92699.1"
FT                   /db_xref="UniParc:UPI0001831DB9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T6"
FT                   /transl_table=1
FT                   /translation="MSVNPVFVFVPGAWHTADSFDVVRDLMHNRGLATEAISTPSVGAF
FT                   PPDKGLHADIEHTHAVLKEMVEAGCQIVLVNHSYGGMVGAGAVKGLGYTERRKAGLPGG
FT                   VIMVVWMAAFVTPKGKTLMDMLGGKHAPWMVINSPDDGYCWSSDQETIFYNDMSPEAQQ
FT                   EAISKLKPHTYRSFNEPATHEPWREMPSMYMFFDKDGAISLAVQENFAQTLGNPVTYHV
FT                   DASHSAFLSVPEKVIEGLEIALKEGRQQSGIAVN"
FT   sig_peptide     65728..65784
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T6 "
FT   mat_peptide     join(65785..66138,66198..66554)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T6 "
FT   CDS_pept        complement(67094..68347)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076647" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823845"
FT                   /orf_name="Pc16g00300"
FT                   /product="Pc16g00300 protein"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP92700.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI0001831E8F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T7"
FT                   /transl_table=1
FT                   /translation="MYPRTIKITLSLPRGRLSICTNAQHQFHRLSGTLRMTQPMQSIPS
FT                   CGRRGIVTLPNKSHHVIQEPDMKKEASFNQNVFNLSLALSKSRINDATELRCMVLGLDG
FT                   SVKESDIRGTRDGLAKEWGLDGRDLRNVDLVSEGIPHLLVRPSVIFISMFTLRLLVRAH
FT                   GVLLFLLPIEDCHVKVQDVFMTDLQRRLHPGSGSGLLAKLPFELRVVDAALASVIATLE
FT                   AEHVLIRREVQDSLQDSTREDVVYAVLRDLQDHRKRLVAIQQRASQFRSALREILENDE
FT                   DMATMFLTDRQAGRPHEVEDHLEVEYLLEAYYKNTDAIAESANALLGDLERTVETIHSV
FT                   LDVRRNQIMVFEAQLEICMLGFAVPTFVAGLFGMNVANFFEESTSAFVVLVAVCVMGTV
FT                   TIAKYGLWKLDKFRKLRF"
FT   CDS_pept        join(complement(71528..72116),complement(71318..71476),
FT                   complement(70732..71265),complement(70393..70670))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234827" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128155"
FT                   /orf_name="Pc16g00310"
FT                   /product="Pc16g00310 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP92701.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI0001831E90"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T8"
FT                   /transl_table=1
FT                   /translation="MAKMTSIVGILMGVLTTATAASIPTGSSVAAAAALRSLGVSPPSG
FT                   NVLIGNAGYTCSLLNRVFSKNETFTVTSPYYNVLIDEAWSENCRLNASCIVTPESAQEV
FT                   SRLLQILSILRTKFAIRSGGHNTNPGFSSIGSDGVLIALEKLDRLSLSADRGTVTVGPG
FT                   NRWESVYKYLQPYNLTALGGREAVVGVGGYILGDSGGLSTFYNTHGLAIDSVTRFQVVL
FT                   PNGTIVDATPTEHADLYKGLKGGLNNFGIVTEYDLTTNPGVDIYYEIKTYTAANTPAVL
FT                   AAYATYLLDADINSNVEIQVNPSYTLVFYGYLGHVSAPTDFDSFSDIPVASTIYPPTNG
FT                   SLTELLLTIGSTGLTSEGVSYSGTFSFKVTGSTFLQDTYSTYLEAAASLPSGAVLSYVP
FT                   QGVIPNLVTQGKSQNGGNLLGLEATPQIWANIFAQFPATLSQSEVAGAVDSLLANLISS
FT                   AKSEDLFLPYIFVNDAGAKQKPLQSFGEKNIKYIDTVAKRYDPKRVMQKLQDQAYFVSE
FT                   EL"
FT   mat_peptide     join(complement(71528..72056),complement(71318..71476),
FT                   complement(70732..71265),complement(70396..70670))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T8 "
FT   sig_peptide     complement(72057..72116)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T8 "
FT   CDS_pept        join(72462..73015,73073..73295)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671088"
FT                   /orf_name="Pc16g00320"
FT                   /product="Pc16g00320 protein"
FT                   /protein_id="CAP92702.1"
FT                   /db_xref="UniParc:UPI0001831E91"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U3"
FT                   /transl_table=1
FT                   /translation="MGFFALEEWAAANRDYENTRAPYWHVKSVPDGFTAISGILWSISY
FT                   TLMAKKAFKDRSYAMPLHCLCLNITWEAVYGFVYGPGLLNQVVFAQWMIVDVVLFYAIL
FT                   RSAPYVWKQSPLVAQHLAGIIVVGCVICLWLHLAIAATFIPSIGRQVVFMTAWPMQVLI
FT                   NFSSIAQLLSRGNTLGHSWGIWWTRMLGTIAAACCFFWRIHYWPERFGYAWTPYGQFLL
FT                   LGSIGSDMVYAVVYIYVQRMEKQLDTLVSTKAQKAR"
FT   CDS_pept        join(complement(73846..74340),complement(73504..73791))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185387" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945516"
FT                   /orf_name="Pc16g00330"
FT                   /product="Pc16g00330 protein"
FT                   /protein_id="CAP92703.1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI0001831E92"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U4"
FT                   /transl_table=1
FT                   /translation="MAPCKPRTFTAGQVPLTKFDGAISVRNLPRPPDRLFLFHGIMRPS
FT                   RGIYAKLIATGQKPPTHFHPSQWEFFRVLRGNLTIDFNGRAIHRTASDGELAVPPFTHH
FT                   VIYGTPGTEMNEVEFVVSASDPAAEQQGATVMDQPFFENWYGYQEDVFQRGEKLDFIQV
FT                   LSMFDAGGTYLSPPWWVPFRSWVGLFLGIVVGRWIGGLLGYAPFYPEWTTDWEAACETM
FT                   QQSWFQRRFADPQAQERARERFRGQLEQEASAKGGKSV"
FT   CDS_pept        join(74801..75681,75748..75859)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196153" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945517"
FT                   /orf_name="Pc16g00340"
FT                   /product="Pc16g00340 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92704.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831E93"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U5"
FT                   /transl_table=1
FT                   /translation="MVNIIQPKVDPLPTGIDLTGKTVVITGASAGMGLEATKQLLRLRA
FT                   STVILAVRNVAKGEACATSLRQDRRIQTHNPNPTIKVMALDVDDYHSVQRFTKQLREEI
FT                   PVVHILILNAGIGLLKLERSASGHDRTTQVNYYSNVLLIAELLPYLQAGAEKTGFPARI
FT                   SWVGSRAHEVTSLEKKAPIKPGEGVLAHMDKEEAFVPFQRYGDSKLLCVMFMYSLAPRL
FT                   DPKKVIINMMCPGMVNTNMSDVLPMHLRLIVNVVKSFRARPVEVGGWIILNSALVVGPE
FT                   SHGKFLNDKTISDKSAFIKSPAGQEIQKKLWEETIAEIGTLTPLPAEFK"
FT   CDS_pept        complement(76039..77334)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671089"
FT                   /orf_name="Pc16g00350"
FT                   /product="Pc16g00350 protein"
FT                   /protein_id="CAP92705.1"
FT                   /db_xref="UniParc:UPI0001831E94"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U6"
FT                   /transl_table=1
FT                   /translation="MAETDASSWKPTTLESKPFSLDSGHYTALAFVLAVCVPQAPHGTL
FT                   LRYGLLLLQITCAVQAFLVQPPPVSDRAVLYTSGVLMGNLLARYFDRLYTTVPERTFHR
FT                   IIDSQSPEDTVRLSAPKRLFWALELFSVTRGIGWNWRVAGIPKSPVSTTRFQFAAAQLL
FT                   RWTAMYAGLHLVNVTCQVVSSNPNASPSLPGNLHIYALIVCGFAITIYSHFAILMLPLS
FT                   ALCVGLQVGPRSWQDIASWPPNFGSVREAYSIRRFWGYTWHQQLRRQAGAPGAYLISLL
FT                   PDSVTTSKQTSVRLARRYSLLMMSFVISGLIHACGTYQVTRALGLPLSDGGEMKYFTLQ
FT                   GMAIIAEDFGCWVLGIDDRGTQPGVMRRWMGYAITLSWYVWSRVQLKGVPVALAMGIED
FT                   ERGDLFAALELVRLSAAAVPGNFVATAWELIW"
FT   CDS_pept        join(77542..77690,77743..78155,78223..78431,78491..78811,
FT                   78894..79174,79226..79385)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234826" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128156"
FT                   /orf_name="Pc16g00360"
FT                   /product="Pc16g00360 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92706.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0001831E95"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T9"
FT                   /transl_table=1
FT                   /translation="MTLLSVLPVSLWLIAAGTFAVYHAIRAVYLIFFSPLAVFPGSPWA
FT                   ALGEYWEAYWNIGLKHGRKGQTLFKLEEMHKRLGPALRMGPNEVHIYDPAFYHELYRPG
FT                   SRYYKDPSMHKVLGAPSSTLAESDPVRHKQRKAPLEPLFSKKNILSLEPMLMEHVDHCS
FT                   QRFDELFAQAKPVSMEWALKSLAMDMVSQFAFGQSLNALADPEFKSLPVRVFQQYLPSL
FT                   HVIKAFPFVRLLNSLPLWIAKRISHSVEMGHELEQFATRRIDEYMAEAAAGKTPTFPTL
FT                   MERLLIPIPEKGYAVPDKQGLRDELLTVISAGDDTTGIANTVTLFNIFNNREIHDRLLA
FT                   ELKTVMPTPDSHVSYPRLEALPYLTAVIKEGLRYSSPAASRTPRLVPPGGVRLPDGRFI
FT                   PAGTRVGMAIYHIHYNETLFENPRVFDPERWLQGPEVTAERAKFLVPFSRGSRSCLGIN
FT                   LAYMEMYMAIAYIVRRFDLDLVGTTEEDMKWDDMVVPQFHGEFMALTKRRED"
FT   sig_peptide     77542..77601
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T9 "
FT   mat_peptide     join(77602..77690,77743..78155,78223..78431,78491..78811,
FT                   78894..79174,79226..79382)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T9 "
FT   CDS_pept        complement(79583..84934)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000046292" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671090"
FT                   /orf_name="Pc16g00370"
FT                   /product="Pc16g00370 protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAP92707.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="UniParc:UPI0001831E96"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U0"
FT                   /transl_table=1
FT                   /translation="MITSTSSTEVLTPANGSNDSKGTTTPATSSGDPEMHEDLLRNDTH
FT                   DDVAIIGMACRVPGDVNSPSALWQFLLEKGDASGDMPSWRWDPYRQRHPRNAAVLAETT
FT                   AKGYFLNEIDQFDAAFFAVSPREAEQMDPQQRIALEVAWEALEDAGISPSRLAGSNTSV
FT                   YMGVNSDDYAKLVLEDLPNVGAHMGVGTAYCGIPSRISYLLDLMGPSVALDAACASSLV
FT                   AVHHARQAIRAGETDLAIAGGVNALLGPGLTRVLDEAGAISADGKCRSFDDSANGYGRG
FT                   EGAGVVILKRLDKAFADGDQVLAVLKGSAVASDGKTLGIMAPNAQAQLLVAQKALKEAK
FT                   VTSDSISYIEAHATSTSLGDPTETNALAEVYGVGSGRHPSDPCYIGSIKPNIGHLEAGA
FT                   GVMGLIKAVLVLRHGEVPPQANLQTLNSKIAWKENLLRPAHELVTLPRGTISRPLRAAI
FT                   ASYGYSGTVSHAIVEAFAGQSLFAERLAQIPDKGAVPVLLLLSVPQANRISATAAGLNQ
FT                   WLRDVDGAVSLATVASTLSQRRMHHRFRHAIVADSVANAIATLDDLAKDVPSRWAISDR
FT                   IGSEAGKGAVWVFSGHGAQWPDMGRELFHSSPAFGEVVRNLEPIIQAELGFSAIETLHA
FT                   GCPDRTDVIQAMTYLMHLGIAAVLEAESGPPTAVVGHSLGEAAAAVVSGALTWHEAALV
FT                   VCRRARLYREFMGEGAMALVRLSASEARASIATHPGASVAIEASPTACVVSGTVDAVQR
FT                   LTEQWREEGVDVRAVATDVPFHTPLLEKLAGPLRGALKNELHPQVPHRALYSTSLSDPR
FT                   SEVLRDAEYWVMNMVQPVLLQSTMAALVDDGFRAFVEVASHPIITHSIAETISEQTKDR
FT                   FIATPTMVRKQPALKSILAAVGRLHCFGCAVKSTDLDPTAPWSSSVPGTIWNHQSFYRA
FT                   VSGMTAAQLASTHKPPANDLLGTRTALWGTDEVLYQTRLEEDNRPFPGRHPLHGSEIVP
FT                   AAVLLRTFLRALSPRSVEEVSLQVPVVVSPAREIQVRHNTRNITITSRLEESTSNEDNS
FT                   WLVNTTATVGADATPSISHIDIAEIRKRLPQKQSDSFSVDYLASVGVSAMGFPWRVAHH
FT                   VASENEMLARVDANPDSLPGMDDLLTSVMDAATSIASTLWHSEPRLRMPTAVRRVVAVD
FT                   VATPKVVYIHCTKAQSSVDVADVIISSEEGTVLMEIQGMAFAGVEGESLSRKTTSGLVH
FT                   QISWPPAALAEEPLEFAHIAFLTADATKTHLETYQRLLKGRGISTSIHERASDLPLTTH
FT                   LSMAVVYLPQVTDQIFDTATRSCNDLVTAAQVILSFSDKPTMRLFVLTSECNLGHSALT
FT                   GLGRILHTEHPDIWGSLIDLEDPSVFPLMAMRYVRNADVIKIEDGVPRTARLRPLRSAP
FT                   PHSTIGPPTLTFSPASTYLITGGLGSLGLSVAQWMVTQGARRILLLSRRSLPPRSTWTA
FT                   SHEPGTRSIIDNILSLERLGATIHPVAIDISHPSAVTNLRSALTTLSLPPVAGVVHAAG
FT                   ILRDQLIEQITPDSFEAVLAPKIAGALALHTVFPPSSPDLDFFVLFSSCGQLLGFPGQA
FT                   SYASGNSFLDALARSRRKEGDNAISLLWTSWRGMGMGASSNGALEAELYARGITDVTPD
FT                   EAFLAWSSISGTEGADHGVVLRARPLESGEPLPHAILMDIAPRKERAVDEGNGENGEQR
FT                   KKLSGKELAEYLRIVVKKCVSTTLSIPEDEVDETVALPEMGMDSVMTVNFRMSLQQTLT
FT                   VSVGPTLVWKYPTVHHLVEHFCQVLDK"
FT   CDS_pept        join(85399..85516,85672..86411)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234825" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128157"
FT                   /orf_name="Pc16g00380"
FT                   /product="Pc16g00380 protein"
FT                   /function="prenyltransferase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92708.1"
FT                   /db_xref="GO:0004659"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniParc:UPI0001831E97"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U1"
FT                   /transl_table=1
FT                   /translation="MTVSITPKPQRNVARGVWELARLHTREAWLCWYPAIWGALCISDI
FT                   CDQKLDKHVERCKVRPLPSGMISTSEAVVAFICWLPVTLAITWGTLGPAVTAGFIPVWV
FT                   LSTIYPFMKRIMPFPQVVLGAIIGGAVFPGWVGITGDLKDLDQALPLFFATASWVVYFD
FT                   VFYATQDRPDDEKIGVKSLAVLLGKNVQILLAVLGALQVLLFAVTALRADMSLIFWVLG
FT                   LGVWMVNVPWHILSLDLKDRHSGGRIFKSNIKLGLYLTGVSLLELFVVRVYDISLANMK
FT                   MELH"
FT   CDS_pept        join(86693..86744,86795..87762)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000244351" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945518"
FT                   /orf_name="Pc16g00390"
FT                   /product="Pc16g00390 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP92709.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI0001831E98"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U2"
FT                   /transl_table=1
FT                   /translation="MNRIDVHHHFIPPAYVKAFNSTPGDPSGWHLPKWTPESTLSLMAS
FT                   HSTRTAILSLTAPGTSILCNFPVESANLARQINLYGSQLHQESPTRFGFFASLPHLTPE
FT                   TIPSAIEELAYALDTLQADGITLYTRYSGTGYLGHAAFAPLWEELNRRKAVVFIHPTNT
FT                   AADAQNKPEMVNPKLPQPIIDYPHETCRTAVDLITSGTISKNPDVKIILSHGGGTLPIL
FT                   ATRAANLLYDAGLTDITPEVFLEQARSFYLDLALSGNRGNLELLVGNNGFAKPGHVLYG
FT                   SDFPYAPVETINKYVGMMEEFFAQGGNKEEEVARAAAVELFPRFRIEDNKEMIPQNGL"
FT   CDS_pept        join(88167..88269,88331..88394,88448..89894)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185376" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977036"
FT                   /orf_name="Pc16g00400"
FT                   /product="Pc16g00400 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92710.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI0001831E99"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V2"
FT                   /transl_table=1
FT                   /translation="MALLYISTVAALALVLLFLRAVLNSWRIQRKLPPGPPGLPLIGNI
FT                   HQIPAVRAHQKFTEWAKVYGGLYSFRIGPATAAVITDRGLVKELLDKRSALYSSRPVSY
FT                   VGQNLITGGDHLLVMDNNEMWRLFRKTVHQHFKASMCEKEHVKLLEAEHTQMMRDFLLY
FT                   PEKHMLHTKRTTNSIIMSLLYGIRTPSWDTPHMQELYEIMEQWSKVMETGATPPVDIFP
FT                   WLKWIPQRWLGNWVDRSVEVGSGMKALYGSFRRRAIEARRQAEQSSQSRARTFIDHVLD
FT                   LQEKASLTDNQVDFLGGVMMEGGSDTGSTMLLVMIQALVQHPEVQERARAELDAVCGED
FT                   RSPTWADFSRLPYINMVVKETMRWRPVTPLSFPHALNQDDWVNGYLLPKGTTVFLNVWG
FT                   LHHDESVFPNPERFDPSHYEGRHNLASDYAASPDYMQRDHFIYGAGRRLCPGIHLSERS
FT                   MFIGAAKLLWGFQFESEMDESGRPVAIDTDPITGYTEGFLVCPRAYKCKVSPRSAARAE
FT                   TIMREFAQAEFEVLCQYATP"
FT   sig_peptide     88167..88238
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V2 "
FT   mat_peptide     join(88239..88269,88331..88394,88448..89891)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V2 "
FT   CDS_pept        join(complement(92618..93205),complement(91329..92518),
FT                   complement(91058..91126),complement(90386..90942))
FT                   /pseudo
FT                   /gene_family="HOG000213033" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(93753..93767,94044..94208,94371..94586)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945519"
FT                   /orf_name="Pc16g00420"
FT                   /product="Putative uncharacterized protein Pc16g00420 "
FT                   /protein_id="CAP92712.1"
FT                   /db_xref="UniParc:UPI0001831E9A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V3"
FT                   /transl_table=1
FT                   /translation="MASGQDKMQNHDYRTPTSRRLGVRYKISIAMRTLEELNVGAGYNS
FT                   FQKRIPKKASCKMAELRLGDTRFTYLFPSTSGGSVKVPPPEEAWPLIVRLVNVGFLDTG
FT                   RWPIGPFPPLKTYWHIPSSLTFLVYFS"
FT   CDS_pept        join(95191..95608,95822..96138)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179103" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945520"
FT                   /orf_name="Pc16g00430"
FT                   /product="Pc16g00430 protein"
FT                   /function="homocysteine S-methyltransferase activity "
FT                   /protein_id="CAP92713.1"
FT                   /db_xref="GO:0008898"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="UniParc:UPI0001831E9B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V4"
FT                   /transl_table=1
FT                   /translation="MASQSKLPQLTSSNLFVTEGGIETTLIYRNNLDLPSFSTLPLLNT
FT                   EDGRQTISSIYQEYVNIALAHSTGVVLETRTWRGSPLWSPEIGLSIPQILDLNRTAVKI
FT                   LHDIRNKTPSTSVVISGALGPLQDAYQDSTGTVSFVDRLTENYTTYFGVNCAHPRYIIK
FT                   AVRGMHTDVRSRIGSIRGNSSLKSHDELDNSLVLDRGDISVWVREFNELLNMLPGLKVV
FT                   GGCCGTDEEHIDAIASRINSVG"
FT   CDS_pept        complement(97348..98151)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945521"
FT                   /orf_name="Pc16g00440"
FT                   /product="Pc16g00440 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP92714.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831E9C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V5"
FT                   /transl_table=1
FT                   /translation="MGAEYCPVDDDGNYIQVDTIVASGDAALVVHREDMAIKMAIVYRH
FT                   YTLEQAEENRGIIRREQEVWRRIQPDFNTPVQGIIQCLGLRGDTIEMRYMPGGTLLKWL
FT                   QHRARPSIQLQKRWFRQLAIGLHNLHQHRVIHGDILSRNILMDGSLNVAICDLGASSLM
FT                   PMDTVMADAVDAYNCSIWTDLCQLGLVFYDIATGRTTGISLYDNGGSDNSVASFPSRDM
FT                   LPALSKRLWARDIIETCWREGGYGAAGAAGILAKLDKVKAPRRRR"
FT   CDS_pept        join(complement(100521..100697),complement(99550..100455))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945522"
FT                   /orf_name="Pc16g00450"
FT                   /product="Pc16g00450 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92715.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831155"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V6"
FT                   /transl_table=1
FT                   /translation="MSSTDYKFEGWVGLGPEAAQGKMVWQEFEPKPWEETDVDIKVTHC
FT                   GICGSDLHTLRSGWGPTNYPCCVGHEVVGIAVRVGTQVKGDIKVGDRVGVGAQSGSCEN
FT                   KDGDCESCASGLEQHCSKMVGTYNGTYANGGKSYGGYSTYNRSPSHFVIKIPDAISSAD
FT                   AAPMLCGGITTYSPLKRNGCGPGKTVGIVGVGGLGHFAILFAKALGADRVVAISRKSDK
FT                   KEDALKLGADDFIATGEDEDWATRHASSLDLIISTASSSKMPIVQYCGLLRVHGTFIQL
FT                   GAPEDGALEIPAFVLIIKGLKLGGSLIGSPDEIREMLELAAAKGVKPWIQERPMKDANQ
FT                   AIVDMDKGDARYRYVLTNEQ"
FT   CDS_pept        join(101051..101171,101481..101532,101633..101659,
FT                   101996..102197,102685..102882)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945523"
FT                   /orf_name="Pc16g00460"
FT                   /product="Putative uncharacterized protein Pc16g00460 "
FT                   /protein_id="CAP92716.1"
FT                   /db_xref="UniParc:UPI0001831156"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V7"
FT                   /transl_table=1
FT                   /translation="MTWISTYPGDLRWLVLTCCIGVKGMPSPWFMPAYARQGKGVGILM
FT                   GFGFLKEENSRTGRKKLAQLVRLSVGRLALVPGGSAEWLPLSLSTCTACILNGVITPTR
FT                   SLFDFENIEHGQQSRQVFSARIITLSAAYGAWLDFALAFVFVICPGLAVPPTVPPYSLA
FT                   FALAHDQNPAPLLQLKVRELNKVLRHAKLGHLYPLA"
FT   sig_peptide     101051..101122
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V7 "
FT   mat_peptide     join(101123..101171,101481..101532,101633..101659,
FT                   101996..102197,102685..102879)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V7 "
FT   CDS_pept        join(103308..103392,103448..103643,103715..103779,
FT                   103830..104356)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076648" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945524"
FT                   /orf_name="Pc16g00470"
FT                   /product="Pc16g00470 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="transition metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92717.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0046914"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniParc:UPI0001831157"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V8"
FT                   /transl_table=1
FT                   /translation="MKLTNIALTSAAIGLANAGLVSKRAVSDADILNYALTLEHLEASF
FT                   YEEGLKNFTQEDFVKAGMKDPFYANLKEVASDEKEHVDFLTSALKGMSLCTYNFPSADV
FT                   NGFLALASVLEGVGVSAYLGAAASIMSENYLTAAGSILTTEARHSAYLRAAVGEVPFAQ
FT                   AFDNPLGLNEVYTVASPFIASCPSSNGALPVKAFPALTMSSMDAVMTGSEVQLVAGSGF
FT                   DTSVSGIHAAFITVTGPVWTPLKSMGGGKFTVTIPEGISGQSYVVLTQGNKQATDDNIV
FT                   AGPAIVEVN"
FT   sig_peptide     103308..103361
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V8 "
FT   mat_peptide     join(103362..103392,103448..103643,103715..103779,
FT                   103830..104353)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V8 "
FT   CDS_pept        join(complement(105319..105400),complement(104779..104981))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671091"
FT                   /orf_name="Pc16g00480"
FT                   /product="Pc16g00480 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92718.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="UniParc:UPI0001831158"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U7"
FT                   /transl_table=1
FT                   /translation="MWDLEICTLGLDKSRSTGAVTALGPWFARQTVVHRSSLVKVRSDT
FT                   DLALFPPLGYGLQTAAGAILNTLNMQAGKTVAIFGLVGMSVPYWIKPGT"
FT   CDS_pept        join(complement(106277..106396),complement(106085..106218),
FT                   complement(105607..106012))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000157839" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671092"
FT                   /orf_name="Pc16g00490"
FT                   /product="Pc16g00490 protein"
FT                   /protein_id="CAP92719.1"
FT                   /db_xref="UniParc:UPI0001831159"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U8"
FT                   /transl_table=1
FT                   /translation="MRIQSFALLAGATAAIAAETVSLFLIGIDEQPLEGKVIGTTDSMT
FT                   KYLIKCAAGVDSTECGLPSNGITVAQGSSTVSMAYSTGRMSIAENCNYDSVSVTCAVSL
FT                   DEEGLTTTFASAVALTEIPGGGALMPVTITGTGTEKAAPTTGASVSASTAASTGGATLT
FT                   TSASTTGGASTIESSDSSSAAATSQTESGNAAMPMITGNARWAAGGVAAALALAAL"
FT   mat_peptide     join(complement(106277..106342),complement(106085..106218),
FT                   complement(105610..106012))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U8 "
FT   sig_peptide     complement(106343..106396)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U8 "
FT   CDS_pept        join(complement(108693..108823),complement(108292..108629),
FT                   complement(108073..108243),complement(107605..108001),
FT                   complement(107398..107550),complement(107077..107347))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169242" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671093"
FT                   /orf_name="Pc16g00500"
FT                   /product="Pc16g00500 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP92720.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183115A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U9"
FT                   /transl_table=1
FT                   /translation="MADQDIFDEKHRIGEQVNDSPPSESELDHIVKDWDVEESAVRRKV
FT                   DFILIPILAVAFFALQMDRGNISAVLTSTITKDLNITTNQINIGSQLLSAGIVLSEIPS
FT                   NIIMQRIGPRVWLSGQLFAWGLVATFQAFVQSYPGYLVTRILLGFCEGGFIPGALYYLS
FT                   TWYKKDETSLRTSLFFYGQMFASATSSLISAGLLQLNGTHGMEGWRWIFLVEGLITLFI
FT                   AIVFTLLVPPSAGDGRPLIAFGRWSYFTERESHIIRNRVLLDDPLKAKGHIQISGSDIW
FT                   QTIKQPRILQHVFVTLVAMSGFSGLTQYTPSMIKSLGFGAVRANALASVPVYCSMIWLI
FT                   GLSFAADKTTHRGPFVLLAITWNVISYACLRTSNPHDSQWHRYGVIAVANISYCSMHIL
FT                   NVGWLSFYCRTPQERSVAMALVVMAANCAGIAGSQIFRTSDAPKYLHGLTAICSIAGAS
FT                   WILTFVLCVQYYFRRQKAVSSDTAEAKP"
FT   CDS_pept        join(complement(110494..111423),complement(109952..110420),
FT                   complement(109752..109873),complement(109350..109700))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169239" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945525"
FT                   /orf_name="Pc16g00510"
FT                   /product="Pc16g00510 protein"
FT                   /function="arylsulfatase activity"
FT                   /biological_process="phenol-containing compound metabolic
FT                   process"
FT                   /protein_id="CAP92721.1"
FT                   /db_xref="GO:0004065"
FT                   /db_xref="GO:0018958"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012083"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI000183115B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V0"
FT                   /transl_table=1
FT                   /translation="MDGIIRSTFPLSTLDLYNYALGSAREYVVIDSYLHPSPLHLMKLN
FT                   TALVGLIAEGVIALNLQSMQSALQSVLKHSEAEPRKPNILFIITDDQDLQLDSISYTPL
FT                   ITKHIRDQGTFFRNHFVTTALCCPSRVSLWTGRQAHNTNVTDVHPPYGGYPKFVERGFN
FT                   DDFLPLWLQGAGYDTYYTGKMFNAHTVDNYHSPHINGFNASDFLLDPYTYSYRNSTYQR
FT                   NHEPPVSHEGEHTIDVITGKALGFLDDALAGERPFFLAVSPVAPHSNVDPGNITSENFY
FT                   MSAPIPLERHEHLFQDVRIPRTANFNSDQPSGVSWVHDLPLQNQSVVDYHDHFYRSRLR
FT                   ALQGVDELVDGLVTRLEESGQLDNTYIIYTSDNGFHIGQHRLPPGKTCGFEEDIRVPLF
FT                   IRGPGVTKGYVQDAVTTHVDLAPTLFHLAGIPARDDFDGTAIPVTPEFEGERHEHVTVE
FT                   YWGSAVVEGPGGSTMIPNNTYKSVRLLGEGYNLYYSVWCNNEHELYDLSTDPYQLNNLY
FT                   PTTSHAGINETRILGRSLNQAINRLDALLMVLKSCQGVTCIQPWDVLQPVDPVSTLQHA
FT                   LNKEYDGFYGAQPQVSFDWCDSGYIVEAEGAQVPLTSRHGVSWDVWV"
FT   CDS_pept        join(113357..113813,113886..114283)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200302" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945526"
FT                   /orf_name="Pc16g00520"
FT                   /product="Pc16g00520 protein"
FT                   /protein_id="CAP92722.1"
FT                   /db_xref="UniParc:UPI000183115C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V1"
FT                   /transl_table=1
FT                   /translation="MEDADNNNDATTGAGSTPTLGRGTAKSKDWYAYLDTVRTNGTQAD
FT                   KLPKIGSFVLYKLEPPLKNKEDFDNWYNGVYKILRGYHLYRLIDKNIERPDTDVENAED
FT                   WVTLSIQVAGWLTQCIDPDIANDLTNSGERIELADDFMYQLKLYMRGEEFIDGVKQRFK
FT                   AANDLKAKLHPYIALVIMMSELEQVTEMKNAIEIKTNEMKNIKDPATEISMTDYLKICT
FT                   EMNDKAKALGVDGGMGASATKALKASRQPAPSSDGKKDKLMNAPPPGKYAKKHVEEWKN
FT                   HKT"
FT   CDS_pept        join(114680..115923,116071..116271,116359..116401)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213030" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945527"
FT                   /orf_name="Pc16g00530"
FT                   /product="Pc16g00530 protein"
FT                   /function="DNA binding"
FT                   /biological_process="DNA integration"
FT                   /protein_id="CAP92723.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI000183115D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W3"
FT                   /transl_table=1
FT                   /translation="MPSRQLRTGVDWVLDSGSSWHICSNRDLFISYKAYRSDEGLGWDS
FT                   SASQRAKAEGAGDIILPIRRPDGSRYELQVQCLYKPGNRFNLLSLLAIRQQKGIRWNPD
FT                   DMIIRDENRAEIGYTFVGMNVPFIELADEPNPVIYKNQMTNQALTHQTSVQNQQFGPQQ
FT                   QANGAISYALISAELAHRRLGHIGSYKGRINKDKLGEDVDTKECFDCEPCHKAKSKKIV
FT                   SREKQARATKVGQLVYVDLHPYKPKGLSKMGKQDREHAMIITDDASRFRTTMCIAKKGE
FT                   ASPTLILWAETFKNHTGYYLMEWRFDNGTEFLHFQKWAKEKNLTVSPSSAYAHEQNGVA
FT                   EFSGHYVMQIARTMHIDGGALRELWTEACYAATYVINRLIRHGEEAPILAWRRAMNLRG
FT                   DEATNLSFLRVWYSKADVVFWEPKAPKTYDGAADFRIGETTDVMTPKTQFKLGKALFKT
FT                   ARQAAKDLGSTDIGQHVSLGEEHRVQALRDRRETPDR"
FT   CDS_pept        117077..118711
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076649" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823846"
FT                   /orf_name="Pc16g00540"
FT                   /product="Pc16g00540 protein"
FT                   /protein_id="CAP92724.1"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniParc:UPI000183115E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V9"
FT                   /transl_table=1
FT                   /translation="MKSEFKDKWHEAMKVQLGKLQDAKAYEIAPRPPSGCTVLPGKWVF
FT                   DLKINKDNEVQEFRARWVICGNRQRPGFDFQESYAPVARGETMRLFLSMVAVNKMIIEQ
FT                   VDYTAAYLNAMIDDRVIYMRQLTGFETRGLDGEKKDEICLVLQALYGLRQAGHLWYETL
FT                   ANALRDMDFQPLLDEPCIWIHREKQIWILLYVDDTLIAAFKAAEIDWFKTMIPFRYKDL
FT                   GKPARFLGSSLSRNNENGAIFLNQAAYTEEVVVKSGLQDASHVYLPMKTGYKCPDITRD
FT                   PKDKDVRGQNNKDIQREQNDDDDVASWAYDKPSVSKEEASAFMEDIGELGWLADKSRPD
FT                   IAVAVNKLQRRTSAPRQEDIDALKQLIRYLKGTKNLGILLGRNGDNNDLVGYVDASYQD
FT                   CEDGKSTEAYIFFHAGSPISWNSRKEEIVARSSTSAEYVAMDGAVREAMWLYKVMKQMG
FT                   IHQDLPITIFTDSDNAHTIMKKDNFAKATKWLDARYHFVRHAVRTGIISFTLIPSAENV
FT                   ADALTKPLGREQFERMREIMMYSEGKK"
FT   CDS_pept        join(119655..119718,119777..120797,120856..121078,
FT                   121249..121270,121513..121791,121848..121957,1
FT                   22006..122206)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945528"
FT                   /orf_name="Pc16g00550"
FT                   /product="Pc16g00550 protein"
FT                   /protein_id="CAP92725.1"
FT                   /db_xref="UniParc:UPI000183115F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W0"
FT                   /transl_table=1
FT                   /translation="MLGLFRASLIAPLLTVWICCSNAFAANCSSTWIKSVADADKLRQN
FT                   CRIVYGHVGIGPFADNGTVHINLDGVEMIAGTLGESPLMQSDDVTQPYYTLSSSSLEVV
FT                   DAVEIGYYGTKVVNLSLPSLKSARDYFEVGKRAYNLTYLDISSLNFAPSITLSPPNLTT
FT                   LHHTGLRNVTAMSIDAMKIDSLDSLTDNQLNMSQVFIQGPFPNVNEIAIGFISAKHLHI
FT                   NDNSSLTLGGSSTTAMTIKELSLHGITDLKRSAQLQTLKVDTLKLSSSISITDLEIPFD
FT                   DLRSLNIQQRWETHPMKSITLPPKAVDWTGGFDLDIVGAPDLNLTSIYGVNDKGNHVQT
FT                   WYWPKNVSRIRISDVTVGNAFFDPFVAQQKGPWDSQFPPSAVRSFGVSPSVNSSFNCTP
FT                   FVELQSMGRLPDVPFMCDDSKPPTSGVPVHLPIPLSLVILLNVVDSTYLLQQPTSLHHG
FT                   NKNLKAKRATKNDALNKHITRTCKKSVKWKGKTRMLSGSPDYGIWYGEEEDLDLNVVIM
FT                   EAKRPNSASEGVPQALAYMGCVHKQRKDLGKADTTVYGISTDAMNFTFMKLDNKSQWSF
FT                   KLVGVVANGFEQVLGLLVYLMTKAALMSPASSRHASRRAQQGSGGSELSFDHDPENYDQ
FT                   MDIA"
FT   sig_peptide     join(119655..119718,119777..119787)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W0 "
FT   mat_peptide     join(119788..120797,120856..121078,121249..121270,
FT                   121513..121791,121848..121957,122006..122203)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W0 "
FT   CDS_pept        complement(123639..125285)
FT                   /pseudo
FT                   /gene_family="HOG000234520" [ FAMILY / ALN / TREE ]
FT   CDS_pept        125314..129012
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(130406..130685),complement(130029..130352),
FT                   complement(129863..129912),complement(129619..129810))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671094"
FT                   /orf_name="Pc16g00580"
FT                   /product="Putative uncharacterized protein Pc16g00580 "
FT                   /protein_id="CAP92728.1"
FT                   /db_xref="UniParc:UPI0001831160"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W1"
FT                   /transl_table=1
FT                   /translation="MPSSKKVTKRSSDSRSLLHRILVAIYDFTGRMIDQEQLESTADEI
FT                   EKALDKNYPTLAISSLFINDIEKIIKLKWTRKDTELADLRPMECPPVLVQQIDKITRAL
FT                   GRSHPSEENGRWILNSLLLEAYEIATVICPHAAQPLNIQAERGWKYGPVKWHRRKYFLT
FT                   GRPDYGVWYGEEEAVSLNVVIVEAKRELGGMEQALGYMASNGYDFVFLKIDNDSKWSDR
FT                   KITTRDGNYDEVLGVLVHMFTKAAVMSPAHSKEPPRQQQSSGESAATKLSVQEDVEMAG
FT                   "
FT   CDS_pept        join(131067..131269,131330..131493,131588..131829,
FT                   131889..132059)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076650" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945529"
FT                   /orf_name="Pc16g00590"
FT                   /product="Pc16g00590 protein"
FT                   /protein_id="CAP92729.1"
FT                   /db_xref="UniParc:UPI0001831161"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W2"
FT                   /transl_table=1
FT                   /translation="MSDNTRPPQPSSLITQRSCADFQDLESFKDCLASIAQVKEHHEFV
FT                   LLDIPRDWADIVFEVLDEVVSARKMYNSRTDVLRVLTMPTAIQNCIQPWLYNQLFNWGI
FT                   TGAITPSEENMIHGEAGTKPDFLFMIRGRLLPTVAVESGWSDPMPRLQDDLNMLLVGGD
FT                   GSIKVVIIIKWSRHAPNRVSGVAELYKCDRNGIPVRDQREVIFPHNPTTGNQQLVIKRR
FT                   DLLGSGHGNPAGSLFFDLDLLRDFASRALGRMNLVPA"
FT   CDS_pept        join(132601..133028,133090..133357,133409..133659,
FT                   134166..134325,134407..134532)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945530"
FT                   /orf_name="Pc16g00600"
FT                   /product="Pc16g00600 protein"
FT                   /protein_id="CAP92730.1"
FT                   /db_xref="UniParc:UPI0001831162"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W5"
FT                   /transl_table=1
FT                   /translation="MTPTSSPSPKIKDVVVNILHTLKSIDHAHLTKSEIQRLGVSVDIF
FT                   DPNDEDSSDEDSLDPETQWLFKPISKEDIKPWKISPSEAKAVQSSLDIPELVRASQHRP
FT                   DWDVTGATQEVLHFITTQFDFRRKSKTPLRDTFGWNDIDFDEFAGGNVGLLFSIGGKFR
FT                   GVDTPGWRTGLIEEWWDGEDLAGPSVRLIICTDSNGKEGNLLLSELGSIAQVVAFRRNQ
FT                   PGFETYRLFPVLLISLFGPRHGRIIQACYDRRSNKFELRISRVFCFVTKEDAVFDTFLR
FT                   FTASYPPEIANPQFSRLARATLSQRPLAHRPARRGRDDNPMEPEAPLSEAYQDTGYYDD
FT                   MGPAYGDYDPGVRDGAFDDGGGYYDDDDRINHHVCAVRSRLFESKNKLFRHLPNCDTAA
FT                   QPAGDQAGHCR"
FT   CDS_pept        join(complement(136641..136818),complement(136456..136592),
FT                   complement(136320..136402),complement(136050..136268),
FT                   complement(134978..135999))
FT                   /pseudo
FT                   /gene_family="HOG000234839" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(139044..139275),complement(138706..138992),
FT                   complement(138563..138659),complement(137878..138515),
FT                   complement(137184..137825))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000182646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945531"
FT                   /orf_name="Pc16g00620"
FT                   /product="Glucoamylase"
FT                   /EC_number="3.2.1.3"
FT                   /function="carbohydrate binding"
FT                   /function="glucan 1,4-alpha-glucosidase activity "
FT                   /biological_process="polysaccharide catabolic process "
FT                   /protein_id="CAP92732.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0004339"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR000165"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR008291"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniParc:UPI0001831163"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W4"
FT                   /transl_table=1
FT                   /translation="MAPRFWTALWALTLGHAVVATPQILAPRATGSLDTWLASETVVAR
FT                   QGILDNIGSAGAHAANAKPGVVLASPSTSDPDYYYTWTRDSALVFKNLVDMFRSGDSAL
FT                   LEVIEEYISSQAYIQTVSNPSGGLSGGGGLGEPKFNADETAFTGSWGRPQRDGPALRAT
FT                   ALISFGQWLIDNGYTTYATDIVWPVVRNDLSYVSQYWNQTGFDLWEEVSGSSFFTVAAQ
FT                   HRALVEGSTFASQVGSSCLYCDSQAPQVLCFLQSFWTGSYILANFGGGRSGKDANTLLG
FT                   SIHTFDPEAGCDDTTFQPCSARALANHKVVTDSFRSIYSVNSGIAAGKAVSVGRYPEDS
FT                   YYNGNPWYLCTLAAAEQLYDAIYTWNRIGSLTITSVSLSFFKDLYSSAATGTYSSSSDT
FT                   YSSIVAAVKEYADGYVSIVEKYAASSGSLSEQFSKSDGSQLSARDLTWSYAALLTANER
FT                   RNAIVPAPWGETSASSVPGQCQYTSAIGTYSSATNTAWPTTLTSGSGSVTTTKTTTTTS
FT                   KPTTTSCTTPTTVAVTFNVIATTEYGQNIKLAGSISQLGSWSPSSAVALSASKYTTSNH
FT                   LWFVTVTLPVGTSFSYKYIQVASDGTIKWESDPNQSYTVPATCGTTAVTVSDTWR"
FT   mat_peptide     join(complement(139044..139215),complement(138706..138992),
FT                   complement(138563..138659),complement(137878..138515),
FT                   complement(137187..137825))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W4 "
FT   sig_peptide     complement(139216..139275)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W4 "
FT   CDS_pept        join(140375..140533,140588..140626,140677..140792,
FT                   140844..140952,141001..141229,141274..141436,
FT                   141484..141630,141686..141926,141976..142644)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000165530" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823847"
FT                   /orf_name="Pc16g00630"
FT                   /product="Pc16g00630 protein"
FT                   /function="alpha-amylase activity"
FT                   /function="calcium ion binding"
FT                   /function="carbohydrate binding"
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="CAP92733.1"
FT                   /db_xref="GO:0004556"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013777"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR015340"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001831164"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W6"
FT                   /transl_table=1
FT                   /translation="MKKVIFTATILLWQMVMGLTPAEWRSQSIYFLLTDRFGRTDNSVT
FT                   ANCNVDDRAYCGGTWQGIINQLDYIQGMGFTAIWITPVTKQLPQDTGYGMAYHGYWQQD
FT                   IYDVNDHHGTSDDLLALSKALHARGMYLMVDVVANHMGYAGAGNTVDYSVFTPFSSSSY
FT                   FHPYCLISNYNDQSNVENCWLGDTTVSLPDLDTTQNSVQTIWNDWIADLVTKYSIDGLR
FT                   IDTVKHVQKSFWPGFNDAAGVYAVGEIFDGNPAYTCDYQNYMDGVLNYPIYYPLLRAFQ
FT                   SSSGSISDLYNMVGTVASSCADSTLLGNFIENHDNPRFPSYTSDYSQAKNVISFLFLSD
FT                   GIPIVYAGQEQHYSGGHDPANREAVWLSGYSTTAELYQHIATTNKIRKAAVAADSSYIT
FT                   SKNVPFYQDSHTLAMKKGSGSSPVITVLSNAGSSGSSYTLYLGGSGYSSGTKLMEMHTC
FT                   TSITVDSSGKIAVPMVSGLPRVLIPASSVSNSGLCGSSVPSATATQTTTATTTGAGCTQ
FT                   ATALPVLFKELVTTVYGQDIYISGSISQLGNWDTSQAIALSSSSYTASNPLWQTTITLP
FT                   VGTTFQYKFLKKTTGSSTVTWESDPNRSYTVPTGCTGATATVAASWK"
FT   sig_peptide     140375..140428
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W6 "
FT   mat_peptide     join(140429..140533,140588..140626,140677..140792,
FT                   140844..140952,141001..141229,141274..141436,
FT                   141484..141630,141686..141926,141976..142641)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W6 "
FT   CDS_pept        complement(142868..144571)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945532"
FT                   /orf_name="Pc16g00640"
FT                   /product="Pc16g00640 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP92734.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI000183123A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W7"
FT                   /transl_table=1
FT                   /translation="MPSILKLILLFALPLVWAVPAQRRAPSANPTVIISKPETTVVGST
FT                   GLNKIDQFNGIPFALPPTGSLRLKPPQPIQTSLGTIQATSAARSCPQFSFSTDEKDLPS
FT                   SIIAKLINIPLFQEITNAGEDCLTLDVRRPSGTQADAKLPVLVWIFGGGFEQGATTSYD
FT                   GSHIVTSSVKLGMPVIFVAMNYRLGGFGFMPGAEIRKDGSANLGLRDQRLALQWVADNI
FT                   AAFGGDPSKVTIWGESAGAISVFDQMAMYDGDNIYNGVPLFRSAIMNSGSIVPANPVDG
FT                   TKGQTVYDTVVKNAGCSGVSDTLACLRHLDYTKFLNAANSVPGILGYNSVAESYLPRPD
FT                   GTILTQSPDQLVIQGKYASVPFIIGDQEDEGTIFALYQSNLTTTDDIVDYLQNLYFFDA
FT                   SRQQLESLVATYQDIKEDGSPFRTGSLNNWYPQYKRLAAILGDLSFTLTRRVFLNYAKK
FT                   VRPDVPSWSYLSTYDHGLPFLGTFHGSDVLQVFHGILQNYGSKAIHSYYLSFVYDQDPN
FT                   TRACDYMDWPQWANNQSLMEFSIDRGGLLPDNFRQDSYNQIMADPPAFYI"
FT   mat_peptide     complement(142871..144517)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W7 "
FT   sig_peptide     complement(144518..144571)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W7 "
FT   CDS_pept        join(144728..144838,144960..145038,145126..145289,
FT                   145687..145857,145967..146102,146196..146283,
FT                   146378..146438,146490..146651,146746..147063)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823848"
FT                   /orf_name="Pc16g00650"
FT                   /product="Putative uncharacterized protein Pc16g00650 "
FT                   /protein_id="CAP92735.1"
FT                   /db_xref="UniParc:UPI000183123B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W8"
FT                   /transl_table=1
FT                   /translation="MDRFHNSIPQARRASVRPIEFRYPFGFGTRYVLPTNEGRGHEDAT
FT                   VLDMAIHREGSRVTERNARVKGALRGITLLFSANGQRDIESDVTERTPWLGFALLSGFI
FT                   SANLLRMKLKQAVATFAMVPSHLKNWQDTAAFSADDNGITLESIESIESIVVMQSPFDR
FT                   YQSSLLATTFERAPGELLEIFRLLPVKVDELDMGIIKANDHYVDDVELLIDSPYLAPKD
FT                   AHGWADRCNNKCDRSGFLSRPANIGAARAPGLVVPRIDQNTSEKPNRPGLPLKVLISHF
FT                   GALGVTNKIGLSNNVFMTKLSAWLGGNGLNIFVKLGRDDQDRAVSQPSLSKKSFSRGKS
FT                   TKVPSPVPPGHLRAPQGTMTDLHSMKGNRSFTKTLSKTARTGCQSILEGSQADLQENLE
FT                   GILGVWEGTIMMILARSIHIRERAIGANWY"
FT   CDS_pept        join(149167..149461,149516..149650,149707..150298,
FT                   150351..150505,150557..151233)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161421" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823849"
FT                   /orf_name="Pc16g00660"
FT                   /product="Pc16g00660 protein"
FT                   /function="transporter activity"
FT                   /biological_process="oligopeptide transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP92736.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006857"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="UniParc:UPI000183123C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W9"
FT                   /transl_table=1
FT                   /translation="MNASDPAEVAEIAKSKAISHNISADEKVPVVDDLTIDNAPPVRAG
FT                   SIEGDDYALEKTAPTDEELATLRRVAGKLPAAAYSVAFVELCERFSYYGTTAVFVNFIQ
FT                   RPLPDQSTTGALVPGVSDWSNESPGALGMGQQASTGLTLFNSFWSYIMPLFGAIVADQY
FT                   WGRYRTIMSAIACALVGHVILIVSAIPQVIENQKGAAACFSIGLVIMGVGTGGFKSNIS
FT                   PLIAEQYTDDRPYVTTLASGERVIVDPAATVARIYLYFYMMINIGSFVGQVAMVYAERY
FT                   VGFWLSYLLPTAMFCLCPAVLLLFKKNYVLTPPSGSIYGKALKVWGLALKGNWSLNPVR
FT                   WFQKSDKDIWAAAKPSHFGDNKPAWMDFDDAWVDEVRRGLMACRVFLWYPLYWLAYNQM
FT                   LNNLTSQAATMKLGGVPNDIINNLNPISLIVFIPIFDHIIYPGIRKMGFHFTPLKRITA
FT                   GFIMAALSMVVAAVTQHYIYKLGPCGSNANHCIEVEKQYTNISVWVQALTYIMGGISEI
FT                   LASVTSLEYAYTKAPKNMRSLVQAVALLMNAFSSAIGQAFIGLAKDPLLVWNYTVVAIL
FT                   AFVGGVGFWATNYKLDAEEDAMNMLPDSSFTPHAAEDEERK"
FT   CDS_pept        join(153944..154439,154828..155231)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128158"
FT                   /orf_name="Pc16g00670"
FT                   /product="Putative uncharacterized protein Pc16g00670 "
FT                   /protein_id="CAP92737.1"
FT                   /db_xref="UniParc:UPI000183123D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X0"
FT                   /transl_table=1
FT                   /translation="MTDSQVTKEATAPKKSVTMTRFSAHEKEQMKSGNRTAYVALPKNV
FT                   KAKRATKNDALNKHSVPTERGSPSRVGPSPTTLGALRGSSRRRRKPSRMKYSPTRSNLV
FT                   PRKRFLIEEQMFGNTIGPRKRIVFEKPPGFTKMDVLFREFYHQVLARGLVGPVPLLPVP
FT                   AHRYKSLTMTRFSANEKEQMKAGNRTAYVALPKNLKARRASKNDALNKHIWRTYKKLEL
FT                   EAVLQSGDSYFAVVLKTPENRDRALETLRAKKVRLDSEVVSLQVMPFGVPDEAANTVWT
FT                   VRGWYGDTAEKIAGAIRT"
FT   CDS_pept        join(157270..157357,157411..157904,157967..158308)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161299" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945533"
FT                   /orf_name="Pc16g00680"
FT                   /product="Pc16g00680 protein"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP92738.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI000183123E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X1"
FT                   /transl_table=1
FT                   /translation="MTGPMICRVLAVLSLGMIVNASPVQLARRAISSELLERFTLFSQF
FT                   AALSACDQNINHTGQSLTCDYGTCPLVAADNTTVINAFHSDHGPTGYIALDHTRELIVL
FT                   AFRGTVSKSDGDTDLDIALTPIDEVCTGCRAHHGFWVYWSAVASQATSRLRDATSAYPG
FT                   YTLSVVGHSLGGGISALAGTVLRTQGFNLDIWTFGGPKPGNMKLAEFITNQQAPNSIYR
FT                   ATHTTDPIPKVPINLPFLDWSQPSPEYWITQATGVQVTPDGVQYVEGINSKEGNAGSDR
FT                   DLRWPNPEHGWYFGNMSACATPIDAS"
FT   sig_peptide     157270..157332
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X1 "
FT   mat_peptide     join(157333..157357,157411..157904,157967..158305)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X1 "
FT   CDS_pept        complement(158480..159982)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000143616" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977037"
FT                   /orf_name="Pc16g00690"
FT                   /product="Pc16g00690 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92739.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000183123F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X2"
FT                   /transl_table=1
FT                   /translation="MNGLNGINENHFDVIIVGAGISGINAAYRVQDQLPGYTYTILEAR
FT                   ADLGGTWDLFKYPGIRSDSDLFTFGFQFNPWSRDNPIAEGSAIKQYVRDTAAKYGIDQH
FT                   IRYNHRLSSADWSSDENTWSLSVNHNDSEQTYTARYVIFGTGYYNYKDPLKADIPGLDA
FT                   FQGQIVHPQFWPENLQYKDKKIVIIGSGATAITLLPNLADHAARVTMLQRSPTYILSVP
FT                   NRSASRWLSYLLPNSVYCKLQRMIWIYTTRIFFLFCQRFPNFSRWLLKLNVRKQLPNHI
FT                   PYDPHFKPRYNPWDQRLCVCPDGDLFRSLRQGKADVKTDTIREVTKNGILLNSGEELDA
FT                   DIIITATGLRLQIAGGSALSVDGTKLDIGDKYLWNGVMLQDLPNASFVIGYTNASWTLG
FT                   SDATAQFICRLLKKLESQKSVAAIPRLKEKDAATLQDRPLLNLQSTYVSVAQRTLPKAA
FT                   DRGPWQPRDHYIKDLKFAQSGDIDTGLEFVQGPNLRLRPKMS"
FT   CDS_pept        join(160585..160948,161013..161737)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169196" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977038"
FT                   /orf_name="Pc16g00700"
FT                   /product="Pc16g00700 protein"
FT                   /protein_id="CAP92740.1"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI0001831240"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X3"
FT                   /transl_table=1
FT                   /translation="MSITKITKVTKVKLSLKEKLDFFPAVVSIVIAYIYALLTGLRRSE
FT                   RQAKSLSLHLGYAVFRKATARLTTTQMQYILPPSHKIYERHSKKTGRLPESVELGDGAL
FT                   GHWVGDRNADNVLVWFHGGGFGLPANMGYFKFYAQLLRDLKASGKSVAVFSLTYTLAPI
FT                   AVYPTQLRQAVNCLRYILSQPNRDPATVFLGGDSAGGNLVGGVLSHLAHPHAEIDSLQL
FT                   HSNLGGAVMIAPWTLLEKDFPEIEIYHGGDIITTAVAGPWSAAYIGAGKRDYYTDLSTA
FT                   PADWFTTFPVNSVLITAGGNEIMLPLIQDFAAKFKEGFENVELFVGHRECHVAPIYHLE
FT                   LGNATKTEQGKKVEAVLAELMV"
FT   CDS_pept        join(complement(162368..163086),complement(162027..162312))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945534"
FT                   /orf_name="Pc16g00710"
FT                   /product="Pc16g00710 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92741.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0001831241"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X4"
FT                   /transl_table=1
FT                   /translation="MSTLNLITQYTQTALSHLPEPAQDLLHHPTAQKAIGVLAALTLLR
FT                   ITNRFLSKRTLQNWTSNQPWIPARELILLTGGCSGIGKQVMEDLARTGVRVIILDINEP
FT                   TFSLPANVTFYKANITSSADIAQVANTIRENHGDPTVLVNNAGIGHEGTILDEPEEKIR
FT                   QTFEVNTLSHFLMVKEFLPAMVKANHGHVVTIASMASFVALGEIVDYCCSKASALAFHE
FT                   GLRQELKYWYNAPNVRTSVVHPFWVRTPMIKMLTDHEAHLKQPIMTPQVVSDAICKQIL
FT                   TQTSGQVILPASQSVARLVRAMPTWMQEGVRTFASGALRRMRIAQQAEKEAQA"
FT   CDS_pept        join(163768..163887,164023..164462,164524..164908,
FT                   164986..165600)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169440" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128159"
FT                   /orf_name="Pc16g00720"
FT                   /product="Pc16g00720 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92742.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI0001831242"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X5"
FT                   /transl_table=1
FT                   /translation="MALGDSVLAVGAFTLAEAYFLQRTILTDTTFQRICLSALGGSHVE
FT                   LVFDSPRGTKPLQWMKTVPNEGLIHMRDTFNRSYVIPTNHQALLDVMSTNTYDFEKPWR
FT                   MRNFLARIIGFGMITSEGAAHKKQRKALTPAFNIKNIRSMYSLMWSKTGQLLDELEKEI
FT                   KVQPMDGTGPEDQEGKIEMSEWASRLTLDIIGPIAMGRDFGSLQNKRNKVADSFAKILE
FT                   PTKEKMAFLMMNFALPQWMARRVPWRQNDVLNAETAYLRSTCDEIVREKRASLAGSKVS
FT                   AQDLEADILGTMMLGGDFSDTELVDQMLTFLAAGHETTASALTWACYLLHLHPEYQTRL
FT                   RDEIRSKIPSGNSPITYQDLESLPLLNGVCQEVLRLYPTVPTTIRESVRNTVIAGKYIP
FT                   KGTRVVLCPWAINRSPLFWGENGEEFVPERWIDTDKNGHCIPNNNGGASTNFAQITFLH
FT                   GQRSCIGKDFARAELRCAVAGVVGRFLFEMQDPKQEIHVAGAVTIKPVEGMHLRMRRID
FT                   EW"
FT   sig_peptide     163768..163821
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X5 "
FT   mat_peptide     join(163822..163887,164023..164462,164524..164908,
FT                   164986..165597)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X5 "
FT   CDS_pept        join(complement(167388..167600),complement(166819..167313),
FT                   complement(165956..166756))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203105" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671095"
FT                   /orf_name="Pc16g00730"
FT                   /product="Pc16g00730 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP92743.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831243"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X6"
FT                   /transl_table=1
FT                   /translation="MEKADSQHQHIESANSNQMESGKQCDFYVEDRITHLSEGHRQYIL
FT                   AKHGTLDLEPIPDMTDTDPYNWPQWRKNLNLTLVAFHAMMGTFTASSIQSVFENISEDL
FT                   DVSMQRTSYLVSLFIAVLGGAPLFWRPLCNRYGRRPIFLISLICSLVGNVGCAKSPSYA
FT                   TMGLCRAITAFFISPAAAIGSAVVAETFFRKDRARCMGAWTVMVTLGVPAAPFIFGFVA
FT                   LRVGYRWIYYILAIVNAVQFVLYFFFGSESLYVRSNVPPDNVIAAKRSLFRFRRIDPTP
FT                   LKLWDFFQPLIYVMKPCVIIPAVAYAMIFLWGGIVLTIEISQVYPAKFGLNTQQVGLQF
FT                   LGIIIGSVVGEQIGGFISDRWMLIRQKRTGEPSPPEYRLWLSYIGHALTICGIVVFAIE
FT                   IRDSGGAWTIAPVIGTAIGACGNQIVTTVDITYAVDCYREDAASVGVFITFVRQTWGFI
FT                   GPFWFPEMFEIVGWAGGAGIAVALIVGVSVIPTILVQWRGAGWR"
FT   CDS_pept        join(complement(169525..169866),complement(169309..169476),
FT                   complement(169080..169253),complement(168781..169026),
FT                   complement(168345..168728))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217379" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946580"
FT                   /orf_name="Pc16g00740"
FT                   /product="Pc16g00740 protein"
FT                   /function="polygalacturonase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /biological_process="cellular cell wall organization "
FT                   /protein_id="CAP92744.1"
FT                   /db_xref="GO:0004650"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI0001831244"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X7"
FT                   /transl_table=1
FT                   /translation="MKFLAIGALLLSTVSALATEHIIKGAQIIPASDKAGLKKIGAHGH
FT                   HKHHDRRTVTIRSSKSDTDDISDDFLWGIKAANHGGRLLLQKGKTYVIGKKLDLSFLDD
FT                   IEVQLEGEVKFTDDIDYWQANHFYYSFQRSITFWVWGGQDIKIFGKGTLNGNGQEWYNA
FT                   FAGMEILDPDNVFYRPVLFVTDNATRVSVEGITQLNSPCWTNFFVRTKDVSFDDVYINS
FT                   FSTNASALPKNTDGFDSFNVDGLRVTNTRVDVGDDCFAPKPNTTNIFVQNLWCNNTHGV
FT                   SMGSIGQYPGVEDIIEHAWIENVTLVNGQNGVRLKAWAGPDVGFGRINNITYKDVRVEN
FT                   TDSPIVLDQCYFNIDAATCAEYPSSVNFTNINFENIYGTSSGKNGKVVADLTCSPNSVC
FT                   TDIHLSDIDITSPAGGPPIVTCDGIDGDVGVECQSSSA"
FT   mat_peptide     join(complement(169525..169818),complement(169309..169476),
FT                   complement(169080..169253),complement(168781..169026),
FT                   complement(168348..168728))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X7 "
FT   sig_peptide     complement(169819..169866)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X7 "
FT   CDS_pept        join(169977..170051,170143..170487)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824068"
FT                   /orf_name="Pc16g00750"
FT                   /product="Putative uncharacterized protein Pc16g00750 "
FT                   /protein_id="CAP92745.1"
FT                   /db_xref="UniParc:UPI0001831245"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X8"
FT                   /transl_table=1
FT                   /translation="MAPTLFPRLPMSGERHGQGEEISPPAMESFLRISPRVSDKREDAE
FT                   RQDEPNELRRWVIQIPNCYGRVLWPGFIFPRLGLISAWRVGFFHQSAAQFVIQRSRRGL
FT                   AVFPGWGDCRGLLSSGFQFSLDIVFVVAGAQSWME"
FT   CDS_pept        join(complement(171416..171420),complement(171063..171352),
FT                   complement(170767..170966))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169174" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128401"
FT                   /orf_name="Pc16g00760"
FT                   /product="Pc16g00760 protein"
FT                   /protein_id="CAP92746.1"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="UniParc:UPI0001831246"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X9"
FT                   /transl_table=1
FT                   /translation="MSALFTTLGLRAPDQPPANHASALLMVNWFFAYILSSPRGAKIRM
FT                   GLDHNANPREDLTTYGEAAVQSGKITRRTLDKLKRQTSAHANAQEGYTLFVAAILVSLY
FT                   AGLPNETINTVGVWYSVSRVAYHLLYCNVESHSLSFLRSAAWWSGNISCLYALVQASKE
FT                   L"
FT   mat_peptide     join(complement(171063..171249),complement(170770..170966))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X9 "
FT   sig_peptide     join(complement(171416..171420),complement(171250..171352))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X9 "
FT   CDS_pept        join(173745..173926,173981..174008,174058..174684,
FT                   174754..175296)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000070228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946581"
FT                   /orf_name="Pc16g00770"
FT                   /product="Pc16g00770 protein"
FT                   /function="glutamate decarboxylase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="glutamate metabolic process "
FT                   /protein_id="CAP92747.1"
FT                   /db_xref="GO:0004351"
FT                   /db_xref="GO:0006536"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001831247"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y0"
FT                   /transl_table=1
FT                   /translation="MGSIEELPKLSGQSKCSYVYGSRFAARPLPSHQLPDGGMPKDVAY
FT                   QLIKDDLTLDGQPILNLASFVTTYMEDEALKLLAESANKNIIDHEEYPKSVEIEHRCLN
FT                   ILADLFHSPVSDGAPTAFGTSCIGSSEAIMIATLAMKKRWEINRKAQGKDASNPNLIMS
FT                   SGVQVCWEKAARYFDIAEKLVPCTETRYVIDPVQAVDMVDENTIGICAILGTTYTGQYE
FT                   DVQAISELLIKKGLDTPIHVDAASGGFVAPFVNPDLVWDFKLPNVVSINVSGHKYGLVY
FT                   PGIGWALWRSPEYLPEELVFNIDYLGAEQLNFTMNFSKPASHIIAQYYQLIRLGRSGYT
FT                   SIMKNLTRTADYLTSQLREMGFVIMSEGGGRGLPVVAFRLGSTQNAFLDEWALARKLRE
FT                   RGWIVPAYTMAADCETMGMMRVVVRTDFSMGRCMSLVQDVRDSLGALAGLEIQNIQRYQ
FT                   A"
FT   CDS_pept        complement(175996..177183)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217687" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946582"
FT                   /orf_name="Pc16g00780"
FT                   /product="Pc16g00780 protein"
FT                   /protein_id="CAP92748.1"
FT                   /db_xref="UniParc:UPI0001831248"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y1"
FT                   /transl_table=1
FT                   /translation="MDPFAKLPTEIICHILDSCCDFTSLEGLQQISPRMKEAFSGWFKN
FT                   VTETVLRNCSLTSPGLHRYFTLLASILSRSFTPQALLEELASWDHRPRRRIICLSTTHS
FT                   LAAVQQTVNIAAKIHVTACACLQHFMSRLESAEPRRPMASGVNVVDWVNGGLPPPKGGE
FT                   LIQFDVDPPSWIETYRTHRALWKLELFHQIHNAATNRWLWSTCDLNNFTKQYLKWCQCR
FT                   EGIEELPTISECVVDLCSSKPTILSHLASYLVAIPSPTDLTIQACWPLPNIQNTRVDEK
FT                   WRRSPKFRNCRNPMLRYFNVLRVTEEGRSHHALWTANFKAFRRLGIPLWDRWRLYQMKL
FT                   VGQSRSVLSPRGNLVGGGSERTEWSHGIVAYVWFSLAEEGDLSVQYIKNEDWRRQ"
FT   CDS_pept        join(complement(181204..181800),complement(179358..181154))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169163" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977299"
FT                   /orf_name="Pc16g00790"
FT                   /product="Pc16g00790 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92749.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831313"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y2"
FT                   /transl_table=1
FT                   /translation="MENNDHSSLDHEEIESQSRTTQRRRRPPLSCTVCRKRKLKCDRSL
FT                   PCRQCVRSKTTAQCVFVGTQPGIVSDSSQRMSPPQLPYGGGEEQPGRKSGMFVFDSKLG
FT                   PNPTSNRVSKRGRSDELSELRSRLRVLETSLGKPSHLQTPETSVCDVFSEVDTANSSEN
FT                   VGVDDRVRYLPDSSFRGKKAKTRYFGRSHYTTTVSFFKDIGAFMRRDRCRGEGKDKEYT
FT                   EMKKFKTELWSRETQDHQRAFREQAFKLNEMVPQRNVADHLLQLYLDTFETTYRILHTP
FT                   TFLRQYADYWANTQPTDMAFVAQLLAVMAAGSCFYVPRPGQDDRDIFQKPAMKWIMAVQ
FT                   SYISCTFVSPDIDFRMLQTQTLLLVARLGVASDGDVAWASAGSLIRSAMTMGLHRDPTR
FT                   FRKARPFYSELRRRLWATVVELDLKISLDRGVPPSVDLDECDCDPPSNWDDSDLIPDME
FT                   NDPSPLSTALYTQNFYQTLLIKTLPLRYRIAKKINSLRFNLSYDDALRMGDELSRSIQR
FT                   ASSLFEDNAPSIAPGESGRHRFAQSIHLFIMRKFLLALHRPFSLSVVRLPKCSYSRKIC
FT                   LEESLGILSQMELPLSTEDVLYPHITQLGSGMFCDETFHAAITACVELSLQANEMSASA
FT                   TSGMDGVNSSVLMSMIQSQQGVMMQAVERTADNFGRRIGPDGKGCKPFFFLNIILASVK
FT                   SRVKGEDPLCNVDTASKRSIRICRAILNGLTYQEAKISVDNRPFQVGTSVCRYVSVIPN
FT                   VPVQTSVPSGTTPASKTPSDIDPASLLSTDFSDFTVGYCSSDAV"
FT   CDS_pept        join(complement(186750..187189),complement(185365..186688),
FT                   complement(184497..185313),complement(183143..184445),
FT                   complement(182730..183072),complement(182527..182670))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946583"
FT                   /orf_name="Pc16g00800"
FT                   /product="Pc16g00800 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92750.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0001831314"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y3"
FT                   /transl_table=1
FT                   /translation="MPAPLHPHLKHTSSFATEKHNNEPPRVQVSHEDEDALADIHQTLT
FT                   AQTQPDPKYPEPHSSFDKFLEEQVQGKKPANLGVCFQSLSTWGDGDSHADVKTFSTALW
FT                   RTLTLQDIYEWTIQPWIAKKKPEEGRPLIRDFSGVVQSGEIMLVLGRPGAGCSTFLRTI
FT                   AGHHSSFLGVTGSIDYSGLSPDEVRKHYRGAVAYVPEDDVHFPTLTVRQTLEFALQSKT
FT                   PKRYRERIPRYLEIYGRVFGMSHTMNTLVGNEYIRGVSGGERKRISIIESLATDSSVAC
FT                   WDNSTRGLDASSALDYARSLRIMTDTCGKATLLTLYQASDAIYELVDKVLLIDEGRMLY
FT                   QGPANEAKRYFEDLGYECADMQTTSDFLTSITLPERRRFRAGWEHRAPKGPIELEAAFR
FT                   QSAAFSKIETDVESYEDQKLTGRSSAYPADSECDSVEVFKNTVHSDKSRFVSSKSPYTI
FT                   SLFRQVVLCAKRQMWQLKGHLGPLYVKLISCVVYGLLIGSMFYDQPQTTEGMYSRGGVL
FT                   FYSSILLAWLQMSELEEAMQGRDILSRQKKFAFVRPSAVCLARVLSDMVITAVLTFLYL
FT                   IVMYFLSGLRSDAGPFFIDALFIYACTVCLTAQFRVFAALSQNFEVALRYCGVSVMFCI
FT                   VFGGYVLSVDKMIQDVPWVGWLAYTTPALYTYEAVMAAEFHNVNFTCAAASIIPSGSEY
FT                   TDLAYQTCAYAGSQIGSTVVNGDDYLAVKYGFYYSNVWRNFGILCLFTVAFIGITCWLS
FT                   EVLEWELDSAGPIQYKGSRKLFKREKKVQSDEEKSPVSVDSSAPPAGHETKHDQTLTAT
FT                   ESTFSWSDLELNVQIGKETRKLLDGVCGYCKPGSLTALVGASGAGKSTLLTALTQRESP
FT                   GTLSGSLFVDNRSIDQSFNRQIGYCQQMDIHDESSTIKEALQFSALLRQSREVPTAEKL
FT                   AYVETVIHTLDLVELQDAVIGSLDIEKKKRVTIGVELCARPKLLLFLDEPTSGLDSQGA
FT                   TSIVALLRRLANQGLAVLCTIHQANQQQFEEVSATHSDQESILTGSQFDRVLALSPGGS
FT                   TYYFGPVGESGHAIFEYFARHGNVPENVTNAADFLIEVVVGGMKASGNQTNWPAIWRNS
FT                   EEFAEVKNEIASIRSDKNTRSPSLAPTPPPISQQIKLLTQRTCRQFWRTAEYPYSRLYS
FT                   SFLHALINGLTYLQIGNSTTDLQSKAFSCFLVLMLVPEFINAISMRFILNRDIWLAREG
FT                   PSGVYGWVAFCTAQIISEIPYSVIGGVVFFVLYYFMVGLPLGFAAGYCFLMFFLFFLFA
FT                   TSWGQWIAALSSDSMIAATLMPFFIIMCELFNGILRPQSQMPAFWKYTMYYATPFTYWI
FT                   GGVLTSVLRGTPVVCSQSELTIFESPPNTTCSEYADAWLNAKGVGYLSNPDGMGECGYC
FT                   EYSFGDDYLTGLGLDSSKIWPYFGIFLAFTITNYLMVYLLVYVRSVMKPFWRSK"
FT   CDS_pept        join(complement(188550..188693),complement(188422..188520),
FT                   complement(188202..188352),complement(188047..188124),
FT                   complement(187806..187857),complement(187719..187751),
FT                   complement(187665..187689))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946584"
FT                   /orf_name="Pc16g00810"
FT                   /product="Putative uncharacterized protein Pc16g00810 "
FT                   /protein_id="CAP92751.1"
FT                   /db_xref="UniParc:UPI0001831315"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y4"
FT                   /transl_table=1
FT                   /translation="MAPNSLTLSTSSSPTARPNSFPSFFSPFRFPVPCFPRPSSSSSTT
FT                   PGLSTHNIYPALHRVLPALHVHDPWTSTGAQEDGALSVIEGLHFAEEERGEGEEGKFEA
FT                   ETRSLELGALNWIGKLSWDIILEMRELELLCIICTEEKKTDILLSYHRHLRHQCIRICH
FT                   GRIRVECSISRLLRLASTYLATPYSVNYTG"
FT   CDS_pept        join(complement(189752..190220),complement(189043..189683),
FT                   complement(188951..188989))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946585"
FT                   /orf_name="Pc16g00820"
FT                   /product="Pc16g00820 protein"
FT                   /protein_id="CAP92752.1"
FT                   /db_xref="UniParc:UPI0001831316"
FT                   /db_xref="UniProtKB/TrEMBL:B6H700"
FT                   /transl_table=1
FT                   /translation="MPPNKPTFPYRRSSNASEDDFFDIPDEPCLSIVKRQLRHVRTWIA
FT                   VALIILFILWQRRERPPPPPLPHIHYDEVDWSRFAYTQYATNEVYMCNCLMVFEALHRL
FT                   GSKADRVLFYPEEWDLIVEDDYDRVSQLLLEAKLKYNVMLIPIKIEGVQDPSTAGSRAS
FT                   WDTSTAKLMAFGEHEYDRVIHLDSDVILLQTMDELFFLPPTTAAMPRAYWLLPEKLLSS
FT                   LLVVIEPSLREYLALTDATTLAQNGQVDMNLTDHRYDMELLNRRYGDSAMVLPHRQYGL
FT                   LSGEFRKKDHRNFLGNDDEVWDPDHVLAQAKFVHFSDWPLPKPWIMWPQEMLAEEQPKC
FT                   DNNPGTPQESGCRDREIWKMLYDKYRRQRKDVCKLLSYPAPV"
FT   tRNA            190623..190714
FT                   /gene_name="tRNA-Val (AAC)"
FT   tRNA            complement(191226..191317)
FT                   /gene_name="tRNA-Val (AAC)"
FT   CDS_pept        join(complement(193534..193573),complement(193440..193465),
FT                   complement(193209..193381),complement(192887..193157),
FT                   complement(192731..192839),complement(192461..192675),
FT                   complement(192339..192406),complement(191856..192267),
FT                   complement(191452..191568))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048500" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128402"
FT                   /orf_name="Pc16g00830"
FT                   /product="Pc16g00830 protein"
FT                   /protein_id="CAP92753.1"
FT                   /db_xref="UniParc:UPI0001831317"
FT                   /db_xref="UniProtKB/TrEMBL:B6H701"
FT                   /transl_table=1
FT                   /translation="MDIPNPGEGDVNIGTSTFQACWILTAIVGVALLFRYAIKIWVRWA
FT                   LPEVTAPGRIWGTEDLLFFVAWGFDITHMVFIQMSANWGLGRHFFYLTAEERLNSMKWD
FT                   FLSQPLAVASAMVSRAGMMWFLLTCFAASDKKIRLSIIICAVVQVVVNMVTIVQIIVQC
FT                   GPNPYQTTNRVQYFHYMWTPLPEDGSVKCQSPTVQTTVGFVQGGFNTVIDYFLAVLAAV
FT                   ELWQFFLRTLHRNPETSFWSQFCKISATVRSRRIWQTITLSGPLILSGCASIVKTYKLK
FT                   SLGDRHDFTYNIVTFVLWVNILLASCAPVARLFLRSFVDHRREGRTHGYWSRSRSTDHK
FT                   EPETELKRRANAKEQWLDSATATNMTITCAHDEENPPTGWSEHGHERSISQVSKAEMPE
FT                   HIDDGRVTVKTDIVVQIDDGRSISSGGTRLLPDGGESHSYRAPVNDTQQAANSVYMIIS
FT                   DQARLLSSSSLWAKGVIE"
FT   CDS_pept        join(complement(195792..195887),complement(195594..195741),
FT                   complement(195526..195540),complement(195334..195460),
FT                   complement(194477..195257))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216830" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946586"
FT                   /orf_name="Pc16g00840"
FT                   /product="Pc16g00840 protein"
FT                   /function="O-methyltransferase activity"
FT                   /protein_id="CAP92754.1"
FT                   /db_xref="GO:0008171"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="UniParc:UPI0001831318"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z8"
FT                   /transl_table=1
FT                   /translation="MPLLTRLASLLGLSSPAPAVPPGAALAATVTVPASLGFVPVAIHF
FT                   DLFNILVSHGGPATADEISATCNARIKARGENEPELSTRLASDTLYIMAGLGLVERVAE
FT                   DCFTANAITNHMVAMPSAQHGALHFTTEGLMAGAFLMKKLQDTRFAYPFADADGPLQYA
FT                   YRLMGQPELAEQHTYSIMETQGRMDSFNHFMVGKFLKFGTFPERVKSMGYDLDAALAGD
FT                   NSTGTRTGSATMVDIGGGRGELLLEVQAMYPHLGAEDLIVQEFNADIDSVPGVRLMEWN
FT                   YKEQDEQPVRGACVYALQHILHNLPDLDAVALLQKISRAMAPGSRVLIIEYAKNLNYTS
FT                   LHASMIALFGGRERSSVEWRQMAGLCGLQVTFEVYVRAGESLVEMRRK"
FT   mat_peptide     join(complement(195792..195806),complement(195594..195741),
FT                   complement(195526..195540),complement(195334..195460),
FT                   complement(194480..195257))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z8 "
FT   sig_peptide     complement(195807..195887)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z8 "
FT   CDS_pept        join(196604..196803,196872..197021,197084..197253,
FT                   197307..197331,197383..197678,197736..197779)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946587"
FT                   /orf_name="Pc16g00850"
FT                   /product="Pc16g00850 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP92755.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831319"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z9"
FT                   /transl_table=1
FT                   /translation="MEKPSPVYFTHEMAASASSSLGTHELKECDNNSDVEARDPLNPRN
FT                   WSSARKTMLFVSLMTSSLLADGAMVWGGTLVTDQAMEWDISIAHSATSMNYGILLQGFG
FT                   GIFAVPLIEAYGRLPIWLWPQVITMFMVLGATLSNDWSTFTTFRSLQGLFGTVPQVIGL
FT                   PIIHDMYTSAEWPRMINIWGTTFLVGPFLGPAIAGYIGAGSDWRTSFGVLTAIYGVSTV
FT                   MVILFGYETYHTPGRTTNQSRIASYFGIGNTLLPKGTTLRYWSRTVAVYVFKFPLLMTG
FT                   IAILVTFTWPIGK"
FT   CDS_pept        join(197921..198189,198249..198504)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946588"
FT                   /orf_name="Pc16g00860"
FT                   /product="Pc16g00860 protein"
FT                   /protein_id="CAP92756.1"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000183131A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z7"
FT                   /transl_table=1
FT                   /translation="MWYVFSHPRYLRILTIFPGWAFGHFFNGWIFKRHSSTWRTELRLH
FT                   GVWFPIGSLASGLLTYGLTMHFGKHWIGIAIGWIMVNIGMVATIVAISAYALEKYPEKA
FT                   TCVSAILNMWRTCGGFAVGYFQPAWIQRNGLGLVFGIQAAIVCVAVVLTITPVFLWEQK
FT                   RRLRVGDEAEA"
FT   CDS_pept        join(complement(198994..199132),complement(198771..198907),
FT                   complement(198629..198691))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946589"
FT                   /orf_name="Pc16g00870"
FT                   /product="Putative uncharacterized protein Pc16g00870 "
FT                   /protein_id="CAP92757.1"
FT                   /db_xref="UniParc:UPI000183131B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z3"
FT                   /transl_table=1
FT                   /translation="MARNKAKKGSVIAVPEPNQFDTASALIVDNPSSRNDSVEPLNGTN
FT                   GDSCPTGSVIACGTLHSEAMIGCVECWLVGEGSGGEDQGYLIKFEIDGEQRTRTCSDRQ
FT                   PDCGLIVA"
FT   CDS_pept        199246..200643
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946590"
FT                   /orf_name="Pc16g00880"
FT                   /product="Pc16g00880 protein"
FT                   /protein_id="CAP92758.1"
FT                   /db_xref="InterPro:IPR003014"
FT                   /db_xref="UniParc:UPI000183131C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z4"
FT                   /transl_table=1
FT                   /translation="MSSSPRRWLFVGFPILTFCFIYYLFRLPESNPSILNNSEELSQAG
FT                   GEPILVGGQKQERPPPPPPKEETLEEKCGHLLHALDDVMVVIRTGATESLEKIPVHLRT
FT                   TLQCVPHFAIFSDYEETINGVRTYDVLRNISETTMNHEPEFDIYRRLQEVGREGLTEAE
FT                   WGDDTNGPLGKVNNPSWKLDKWKFLPMIDEALEVMPDAKWYVFLEADTYMVWPNLINWL
FT                   AHLNPDRQYYLGSPMQIGETLFGYGGAGIVLSSWTMNLLHEYQIEAKEDLEAMTAHEWA
FT                   GDCALARALQGVKVDLTWAWPMMMTSRPWEIDHFSEGYGRQPWCYPVISYHHMAPKDIE
FT                   EMWEFDRAFFASGKNALMLHADVYQKLIYDGTFSARDDWDNLSGIQIDFAAGTIPTVEV
FT                   CAEVCARNDECLQYSFNHADGVCKHASTTFAGVATNGTQSGWITSRVNKLLRAFQSSCH
FT                   EVQYIFD"
FT   CDS_pept        join(202591..202723,202820..204200)
FT                   /pseudo
FT                   /gene_family="HOG000166180" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(205057..205250),complement(204745..204988))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217358" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946591"
FT                   /orf_name="Pc16g00900"
FT                   /product="Pc16g00900 protein"
FT                   /protein_id="CAP92760.1"
FT                   /db_xref="UniParc:UPI000183131D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z5"
FT                   /transl_table=1
FT                   /translation="MKFTVFSLLLSASAALATPFVERDSSIQISDFWARASAGSSATMH
FT                   FVVTDPNYPDDTPTDCNLIWSYGSSPKESARCNNSQYYIRFPEGAVDFNRFTLELERVS
FT                   GPIAENGQVLLRSGTQWSCVDNPESGVHLSCSYDGVLSMPV"
FT   mat_peptide     join(complement(205057..205199),complement(204748..204988))
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z5 "
FT   sig_peptide     complement(205200..205250)
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z5 "
FT   CDS_pept        join(205697..206029,206081..206302,206357..207571)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671364"
FT                   /orf_name="Pc16g00910"
FT                   /product="Pc16g00910 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP92761.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020648"
FT                   /db_xref="UniParc:UPI000183131E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z6"
FT                   /transl_table=1
FT                   /translation="MAQIPDLIRDSKLETYFLPDCTVETVHRFQESDSASGQRLVTRLE
FT                   HWRRQRRVGNGGFGTVWLEECIKAGRPGGTQDGTVRAVKQIDMDTRFGSIEYNRELEAI
FT                   AKFSHSRYERCFVKSFGWYEGPGQLFIAMEYLETGDLFAYLYQKPLPPLPEAEAKEIAY
FT                   QILDGLCMMHENGFAHRDLKPNNILIKSHPPDKWWIKLADFGITKRIEESHGQSTTIKG
FT                   TPRYFAPEIWGFAERGSAYAIDIWAVGEIVFEILTKKPAFATPGLLAGYKAKQDFPVIM
FT                   LTDAGIRQPGVDFVLSLMCPRPNDRMTATSAISDAWIQSPMLQPLGSTKAIEGEPRVPS
FT                   PATIMTDVSTSWTTRTYSEAPGDVSHDISSSTTTVELVNAARDKTIVPQENNLTLTLAF
FT                   RAADFRSQHRAGDSFYRQKRYKEAEIEFRRVLQGREETLGYDHEDTLYSAHALGLSLHP
FT                   QKCYEEAETVFRRALHGRDRVLVHNHEETLYSTYRLGLTLYHQEQYKVAAPMFRQAFLG
FT                   REKTLGYDHRHTLCSAYWLGLSFYRQKRYKEAETMLRRTLQGREKTLGHDHEETVNARE
FT                   CMDRAHARALGLE"
FT   CDS_pept        join(209148..209365,209439..210052,210119..210368,
FT                   210433..210555,210622..211183)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159237" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946592"
FT                   /orf_name="Pc16g00920"
FT                   /product="Pc16g00920 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP92762.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR004896"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000183131F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y5"
FT                   /transl_table=1
FT                   /translation="MEKTNVSDQVTPATTSRDAEKMGEFDVHQGVDKPSDEASMSDRDS
FT                   RDFQGGVQRVRAITSAWSTKTLVLMFILLYLVSFVDALLSTVETSLNPYITSSFGKHGL
FT                   LTVVSVLSTILGGSSKLTLAKIIDVWGRVEGFLIMLVLVAIGLIMKATCKNIEMYTAAH
FT                   TLYWVGHIGLTYVVDIMLADMTSLRNRMIMLGLNGTPGIASTFAGPKIAALFYANLDFH
FT                   WAFGAFAIMQVGVCIPVAVVMLFMQRRAEKSGALEKTYSGRNWWQSIAHYVIEFDVVGI
FT                   ILVTAVFTLILLPFSIAPYGPKGWATGYIIAMEVLGVACIPAFYVWERYAPVQFLPWKY
FT                   LKQPTMIGSCMLYGVMFISVFTWNSYFSSYLQVVNRLDITSANYVLNAFSLTSYIFSPI
FT                   FGLVIRWTGDFRWTAMAGIPIFLLGTALLIPFRAPDTHVGLLTMVQILVGLGSCMFTVC
FT                   GQIAVMAIVTHQEIAVVLAIWGLFGSIGAGVGSAIAGGMWNNMFLKELTERLPLESKHL
FT                   AATIYSNIVTQMKYADGTPEREAIVGAYADIQRKMVIVGVCFVPLCIVCTWFWRNVNVK
FT                   KLQKEQTSGNVW"
FT   CDS_pept        join(complement(214249..214323),complement(211736..214177))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169096" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671365"
FT                   /orf_name="Pc16g00930"
FT                   /product="Pc16g00930 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92763.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018313EC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y6"
FT                   /transl_table=1
FT                   /translation="MDEGSDKAPRRKRVSRACDRCRSKKDKCDGIRPTCSACQASGQSC
FT                   SYDPHAKKRGLPEGYVRGLEKLWALSICNIDGFEDTMLAMLGNTAESTGRREKLMSVWS
FT                   DDSASESLHESWKTSRLFGALEKMLSNSDTPGLATGKRSRNPQDDGSDGQWGFRVARTS
FT                   TPLDPGAPRVVEPFAASPGVKRARLSKESDGRGTAASPHTLQLPPQTSQLLDIYFAVTH
FT                   SWFPVVAKHNILRASYLYANTPLSIATASPGSGDHAALWAILSYTITQSRTHSRAGPAG
FT                   TVALAKEYYAVSRNLIPTEKERYEPGHIQALLLLTLVNMGLEDWTAAWLLSGQAVRMAI
FT                   AMGLGSVSDSRRSDELRQGKAVFLGCFVVDSLLSFRLSRSPAMPPSDITAVGLLEEDGL
FT                   EEWNSWVDVLPPTGAPQGSKNPPRRGPLLALSCFNRLVELASVLNKISRHVSSGYNMAT
FT                   FAQQLVMELKQWDDCLPLGCRLIGPESIYPERHSALLPHQSYLGLTYVATLLWLYLQLI
FT                   SGEQGLHRSQRPATEGAKKLLYRGLSMLTQHLENFSMCGFPPLFELSLRTMAEQAFRLR
FT                   SIVDSSDTFPFARWTDEFRQKTAAFVSVWPAYGSLVSAVERWQHSKDVVGGLSTFPGAV
FT                   GRPFSGAPMADSMQYPGGARSLPQNGEGDYTSSILGISMPVDGQSLTPKDTVMENTDLG
FT                   MMDVSPHHPREGRSVLLDKITPRSRADSMYAAASAQHQQPQPQTPDSGASNPMIPGNIT
FT                   SAGDIDAIFKDLAYLDTTEWSTNREAGLKDFGFLDDSTFQAFCHDPDRLGASQPLVHPP
FT                   SIADIWPPPGFFPETFQEVPEESMGG"
FT   CDS_pept        complement(215273..216325)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217671" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946593"
FT                   /orf_name="Pc16g00940"
FT                   /product="Pc16g00940 protein"
FT                   /protein_id="CAP92764.1"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniParc:UPI00018313ED"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y7"
FT                   /transl_table=1
FT                   /translation="MWNKTKTYGKKGFDKGWDALDKLGAPVNRLSNKLGSEAFWPMTLD
FT                   KESEKVARILRSFCKDGVYVEDSPPVALPPGNRKENQIDRPRGKQKVLKKIPKEVIRDA
FT                   KGLVIFTAMRTGLWVSGASGSGVLIARMPETGEWSAPSGILMHTAGVGFLVGADIYDCV
FT                   MVINTYEALEAFYNVRVTLGSEVTVAAGPIGIGGVLESEVHKRRAPIWTYVKSRGFYAG
FT                   MQVDGSIIIERNDENERFYGRKVPVKDIMSGQVRTNAPGARMLTHTVHSAQGDSHFDRV
FT                   PTGVQAPTGPTPSDFAPGDLPEYSAQPPMMSGVNAAPHGPYAAPNNAPYADTHWAPNGM
FT                   NYGPGSGKQD"
FT   CDS_pept        216712..217245
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076651" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946594"
FT                   /orf_name="Pc16g00950"
FT                   /product="Pc16g00950 protein"
FT                   /protein_id="CAP92765.1"
FT                   /db_xref="UniParc:UPI00018313EE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y8"
FT                   /transl_table=1
FT                   /translation="MRNKRQVFLSLHHRNSLSLGGNRQRFGYAAYHWGILISSKGPSRP
FT                   DCYAFDVSNGVVLDPVHRVNLNEEGNWHFREKVNDPDQDSLLGRVMIGKVPHEVTYAQI
FT                   RDLLESIPLPQRDALPEQNCVTWTRAAIRKLQENGLAEQFDLNRFMDESLAFADQRLHT
FT                   RSTPTSINYTTRPM"
FT   CDS_pept        join(218357..220588,220652..220924)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169107" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946595"
FT                   /orf_name="Pc16g00960"
FT                   /product="Pc16g00960 protein"
FT                   /function="3-dehydroquinate dehydratase activity "
FT                   /function="ATP binding"
FT                   /function="shikimate 5-dehydrogenase activity"
FT                   /function="shikimate kinase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP92766.1"
FT                   /db_xref="GO:0003855"
FT                   /db_xref="GO:0004764"
FT                   /db_xref="GO:0004765"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018313EF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y9"
FT                   /transl_table=1
FT                   /translation="MLDPKPTIPPTADAKSDIPACATKESSSPMLRPEAAPRTFAPDAS
FT                   LVLIGIRGCGKRSLGFVAATALKRRFITEDHYFREVTGITRQEYLKQYGSQEFQRRDIE
FT                   VLKMMLDNHRTGCVVECGLASLTRPVQDHLRRYARSNPVVHLLRDIDRIQQLLGLEDQA
FT                   VRLFREGDPMHRICSNFEFYNLEDRTRTSDDGSPDRRSADYSFKLQEVKEDFTRFVQFI
FT                   TGLDVNYSSYDSPFVLLETPPELRSFTHAIFVRSSDLIVDNVNLTELESGGDAIELCVD
FT                   RWSPDMAATISKQVSVLRRNARTPVILSVDVSCIGTGSPEPATSSSRLYFDILEHGLRL
FT                   GVEYLVVDLTQDRSGLAATIRSRGNTKIIGQQVFEPSSPTTWDSAGCVAVYDEAEKLGC
FT                   QLVRLLRVATKREENAAVIEFSNKIRSLPGDHPPLIAYNIGSLGRTSQVFNSILTAVTH
FT                   PAITQSAENKHDPQITSRDAVRALFQSYVLDPLKFYIYGENVAYSLSPAMHNAAHQHCG
FT                   MGHTYSIPDSPSLAVLDRLGRDPHFGGSSVVQPWRVQVYQKLASKSRHAEAIGAINTIM
FT                   PLRGHEDGTMFPLQEQASRRNQAGRVLGWYGENTDWVGIMTCIRRHLSPRNAISAKTTG
FT                   LVIGAGGMARAAIYAMLRLGCRKIFIYNRTQSRAEEVARHFNSWASSQVDSTEVVRVLQ
FT                   SLQEDWPAGVAQPSLIASCVPADPDRDEPPANFEMPVQWLGSPTGGVILELAYKPLDTP
FT                   LLRQMRRVRSETGRPWVLSDGLENVTEQGIAQFELMTGRKAPRRLMTYEVLRNYVGDNG
FT                   RFDEKTIQARLDGVGSPMTGKE"
FT   CDS_pept        join(221215..221309,221366..222101)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946596"
FT                   /orf_name="Pc16g00970"
FT                   /product="Pc16g00970 protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP92767.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="UniParc:UPI00018313F0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z0"
FT                   /transl_table=1
FT                   /translation="MPGFSPEQPDSITATWKKRKWDHEESRTLARPPTYVPSYRVDRPE
FT                   YDGSCSLPLSRHPDGTDISFRPRCLPRKRRHVQGPYLTLPSHQHQHQHQLQQPHGLQHQ
FT                   QSPTHLSPNIYGTPNQDPYSPPVSPKTLVPLHYPTQQSASPSALRPCHICHRRPTTRQV
FT                   LDAYADCDLCHERACFICLRQCDSASCGGAFGLSKDSSIHMHMHSGSTDDASYDASEAA
FT                   RRKICSGCAVEEVTDTGAEIVRCLDCVRGAGSWAAATIPSDWALDDMQHEDMTG"
FT   CDS_pept        join(complement(223311..223815),complement(222684..223252))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169041" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824069"
FT                   /orf_name="Pc16g00980"
FT                   /product="Pc16g00980 protein"
FT                   /function="transferase activity, transferring alkyl or aryl
FT                   (other than methyl) groups"
FT                   /protein_id="CAP92768.1"
FT                   /db_xref="GO:0016765"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="UniParc:UPI00018313F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z1"
FT                   /transl_table=1
FT                   /translation="MVSQRDREILRDDLRARGTKLSAAERESLLKGYLPDPAELGTKPA
FT                   PQPTASERRKAQRKTPIRTFLKSQTHYLAYAFTHIIFGIVVRLLQAYHAVVDRIFAIVY
FT                   HHHRTPELIRKDVKNLKRLPQHLSTILTLRKEDDALAVLMDEVAELAAWSSCSGISQLS
FT                   VYEKSGVLKSCIPTLHQIITTKLASYYGTPSHQPILQVFAPHHPVHRSAPISNTTDNTA
FT                   QHQTLTILLLSSTDGRETLVDLTKTLAEMSQNGKLSPEDITPDLVDAEISEITTQPLSM
FT                   DPSLPDTVLKPEPDLLLVFGPFLKLDGYPPWQLRLTEMYCTGGRSHGLSGDGEAVEYQG
FT                   YMRGLWHFAGAQMRFGR"
FT   CDS_pept        224209..226896
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169052" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977300"
FT                   /orf_name="Pc16g00990"
FT                   /product="Pc16g00990 protein"
FT                   /biological_process="exocytosis"
FT                   /biological_process="vesicle docking"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP92769.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006887"
FT                   /db_xref="GO:0048278"
FT                   /db_xref="InterPro:IPR009976"
FT                   /db_xref="UniParc:UPI00018313F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z2"
FT                   /transl_table=1
FT                   /translation="MDNASINTSSARTVFPQGPSFTLEDFSSRDFIVKEFIESLSDAAI
FT                   SSRRSLAGLAGAANQPFDPKPLIRTFESAQRRLSELSGDLELRENELSAAVRRAEAQHG
FT                   QNLNTLGQKLRHTIENFQQLDTSLNAPGRENPAGTGNMAVETGKRLEELDRQRRRALDA
FT                   HFLIQCWDGVCNRGEISLLESLRRSGTGEAKVRSAHIARQLLRISQRLDPQSWQEHRVR
FT                   PNGGYGNSSSSEDLSESSTPRRNTREIIEKFSETLEKDLLKQFDDFYRKANFDGMRDCA
FT                   TVLQDFNGGASVIALFVNQHQFFIERSQLVTEEVGGDPESWEKLADPDAELPGVESSLQ
FT                   SLIDEVKVVVQDESAIIRRAFPYYEQVLGKFLQRVFQQSIQQRLEMVLEKAAGVSSLAF
FT                   LRCLQSSRGYIGALIEDLKSHGLTEHPEPVSSQTAILLDQQLEELFVPYFVGSSYIERE
FT                   KRTLEELFNAVLFKFTSYHARRKKAATTFMASLSRAGSELLSTTRDAFISRLDSPEVSP
FT                   IQRKVLLGVAKVGDTLETTRLTEIKLTEEDGQPNLGDAKRMLKWLAEAVGRGLELSVNS
FT                   DTPKDVSALLNLLLLAMGEGYVDVCLDAALEAATSQESSKAEPDFSYLFSARTTISITT
FT                   LMVMCIHAVLLPLSAASITTRRDMEKRTSQTTSRIEDKINTIEQKTIDATFAWVSRLLS
FT                   GQKKNDFRPRESDNTAWLEMLHTPVRSIQHSTLKKALLIPRQTCASITSFLTRLHNIAR
FT                   TSLPSSGANVRQVLTEIALGIRGLLLEHFKRFSVSGPGGLMVTKDMTQYADLFRSWDID
FT                   EETKGPGGALDVLLEVGSLFVIGPEALRERIRGGAASGTTGGSGGPGRNPTQEGKLSVQ
FT                   EVRAYVSRREDSNTFAMQQVLNAL"
FT   CDS_pept        join(227898..227942,228073..228194,228252..228277,
FT                   228319..228375,228412..228455,228591..228716,
FT                   228844..228869,229059..229122,229168..229179,
FT                   229657..229696,229817..229959,229994..230056)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977301"
FT                   /orf_name="Pc16g01000"
FT                   /product="Putative uncharacterized protein Pc16g01000 "
FT                   /protein_id="CAP92770.1"
FT                   /db_xref="UniParc:UPI00018313F3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H702"
FT                   /transl_table=1
FT                   /translation="MDSYCRLCPPLITTLLVGVEWKNVLQHGDVLSSTYNRNGAKEKRG
FT                   AIIQDRQRVELIPVRPRSHIITRTSQKVLELARTVIIQSYRFTSSKTGGGPPSLSIPSL
FT                   ESVHSLVSGPSAPTIRDLHVCGLLSRVPGQFGFTDPRFSMLFFIFESPTLDQEQANYLA
FT                   EYYLPTSLLPWAGRHSPGELPILEVRDLEGLKWPHRITYSASYGTSSFGTDSHPHYNYE
FT                   IEYHQPTRDKQLEEGTMAITTLDFCGSYGSSSA"
FT   CDS_pept        join(230820..231078,231170..231551,231603..232521,
FT                   232582..233070)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824070"
FT                   /orf_name="Pc16g01010"
FT                   /product="Pc16g01010 protein"
FT                   /protein_id="CAP92771.1"
FT                   /db_xref="UniParc:UPI00018313F4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H703"
FT                   /transl_table=1
FT                   /translation="MAEENPRKSIVEDVFIPKELLTTAKFNSPWELARWEQSLPDNDRI
FT                   ISLPEPRTSSNRPLSLSALRSVARPKSAIRSRGRSDPPAFQGTFDYFEKPATFEPPSPI
FT                   PEKGQVTPVQNALLSPQPLSKTSSQTISSEQSHLQEVYEKAKLRGVAIQRKHWVRLLFE
FT                   YSIYALLVLFVYFVLVGMPLWKGAVWWLYWVVRTKFVITGGYAIIIGLAALYAFCPLLI
FT                   LFEKDPPAPDSESESESPDLENNISKVKSTALLIPCYKSASIVGATLEAALKIFPKENI
FT                   FVIANGNSKTPLDNTEEVCKPYGVNHLWVPIGSKIVAQFVGCYAAKDFENAVLIDDDCL
FT                   LPPNFPIVSDRLKKNVKCIGYTIKSVGPNSSKGTFCQQAQDLEYKMSGLQRDFFGKFGS
FT                   ATFPHGAISLWNIEFLKQTFHEHPGFSVSEDWFFGDACRRLGGRITMCSQVFVETETPA
FT                   SVFWSGSGGSRGGFGEMTIFQQRFKRWNFFFVVGVYYDLKYILTSWKLGWWEFGAKLCV
FT                   FQEVYETLIYLFAPFILPISFIVRPSFCGMLLGVTIAMYILNVIIFNEIHLRLKKERVD
FT                   WKVLLFYYTFYKIALTVVNVFSCYWSLYKYARYFAQRHPKVIEDRDAVEVILSLEKESI
FT                   SRRTSVEDDVIPLDGALGRGVGRKLTLTKVQTGKRKMTEESEKGGWV"
FT   CDS_pept        join(234899..234943,235350..236765)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076652" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128403"
FT                   /orf_name="Pc16g01020"
FT                   /product="Pc16g01020 protein"
FT                   /protein_id="CAP92772.1"
FT                   /db_xref="UniParc:UPI00018313F5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H704"
FT                   /transl_table=1
FT                   /translation="MSEDFESLPPAVRRKFFSNVERLRIRLAQSDHGSPTCSTSNYQTD
FT                   NRVYRAPRLGDYHSRGLRTGSRKRGLEKRSSPSKKLRKPGSLQLAYLAAQADSQCFHSL
FT                   PAKIQQKLFSPEERRRLRNAYRQSLIYDAADEAYRRDSGRDSRKSRPSIDTHPSQTIVP
FT                   VVQPSTAFYSDSDSDDEDPNMDQTFHDSFRWLDEDGDLDLSLDEYHAHVADAATKKRTR
FT                   PSFRRSLSFSNHLRKTLEITPTSTRGLPPVSQSQPLTPLSNRTSESRPSSNHRFQHGPK
FT                   SSTSSIDPCAQYYQDPDARLKLRVYLASPQKFDEAIEFGFPSLDQNNKENIGPEPTTPK
FT                   PSSPKFTLVDWDFGTFFEDDDGTMVGSPGGSVENEPIRSPVLTQRDAPRPSMESSALFQ
FT                   RRQSWLPGAKGVPQRLPGNREMTLKMTLTRPDLRTDSPTPPASSKEKEDPLRLAELPPA
FT                   DRSQSIWDSDLDERGVVRKMWRKLRRRV"
FT   CDS_pept        join(237423..241267,241326..241950)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169063" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946597"
FT                   /orf_name="Pc16g01030"
FT                   /product="Pc16g01030 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92773.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002860"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="UniParc:UPI00018313F6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H711"
FT                   /transl_table=1
FT                   /translation="MIPRWLLLTLSLLLVWASHPAAAKGNEPNIVTHELDAPPADLFYF
FT                   HGTNTILYRDRRSLTAHVSFDGGEEWETVKGNDGTIEGTVDLIWRHPFDDNRAYILGEN
FT                   GKHWITTDQAKSWRPFQVDVLPFASMRSFPLEFNGWDPKKVIFMGLDCTILGCLPQTFY
FT                   TTDDFETVKPLREMTLQCMWAASRPQFALDIDMPKSTGDRILCVVPGLKGPFEHTRTER
FT                   LIYSDSFFKDDAEGTEAKLDHGKPLSGVSLQIRSVSKYIVARLQSRGTQEQALYVSDDS
FT                   NVWHRAEFGKHRIEEDAYTILESTNYSIQIDVQTTWQDNRMGSLFSSNSNGTYFTQNIE
FT                   HTNEDLNGLVDFERVTGIHGITIVNTVKNWEEAKKSDSNKKKLISSISFDDGRTFQPLK
FT                   ADKDELHLHSMTTYAALHEMPLPDHRMFSSPAPGLVMGVGNTGGHLEDYSKGDLYVSDN
FT                   AGLTWRRALKGPHRYEFGDQGGVITAVLDSSQTDKVQFSIDHGKEWESISLGQKIRPLF
FT                   LVSTPDSTSLKFLLVGTSSDDTTKTLMFFIDFDGLHERECGSGDLEEWTARLNEKGEPD
FT                   CLMGQKQFFQRRKANADCFIKKEFAISGPEFQLCKCSAEDFECDYNFVRSEDRKECVPA
FT                   VPLTPPAGKCKDPSDKYMGPSGWRLIPGNACIREGGEDLEREIERSCSNVTGPPLITDG
FT                   KPRAGKPQTISAKWTNYFYLERQASNNGVDETIMMLTDKYELHVSRDHGRNWKQIHPDE
FT                   KFIEMVQHPYFSDTAFFLTDGKRVYYTINHGDSFHFFDAPSVPNKEYIRKLAFHEKFQD
FT                   SLIWIGHKDCEGKNCRSQAYVTDKRGASWEPMLIGIADGGCNFGYQEGRNNSEKLVICE
FT                   QYKDEEKNNNRQLVISDDYFSTMEVKFENIARSATKNGFEVVAWYEGDQKEYLNASVSV
FT                   DGRTYANAHFPFNIKVPQYTVLPSSPHALFLLVMVNGGGERSFGSLVKSNSNGTYFVQS
FT                   LEGLNVNDRGYTDYDELQGLEGVAIANVVSNREEVLNKGAAKKLRTMITHNDGGQWMLL
FT                   APPSKDVDGKNFDCSVTEGKGTEKCALHFHGYTERRDYRDTLYSGSAIGLMLALGNVGE
FT                   HLTSASEADTYLTRDGGISWTQVKKGQYMWEFGAAGSVIVLVSDRKATKVVHYTLDEGM
FT                   SWHEFQFAEKELVIDDISTVPSDTSKKFLLWGIDGGKRVIVTLDFSGIWSRDCNDDESD
FT                   YYNWAPTHPFQEENCIFGHVEEYHRKKPAAECWNAWREPHIHSIGRNCTCTRADFECDY
FT                   NYEIQTDGSCGLVPGLQPQDHVAQCSQDPDKVEYWEPTGYRRIPQTTCEGGLLLDQDVS
FT                   KPCPNKEEEYQKKHGISGTGLFFAIVTPIAVAVAVGWYAYTHWDGKFGQIRLGDSGGSQ
FT                   SWLSRDSMLVAVPVALIAGIVAVAQSLPLLVKSLARSSSGLFGRRGMQRPYATRGSFAA
FT                   RRGDYSSVVDDEDELLGADDFDDEEDQA"
FT   sig_peptide     237423..237491
FT                   /db_xref="UniProtKB/TrEMBL:B6H711 "
FT   mat_peptide     join(237492..241267,241326..241947)
FT                   /db_xref="UniProtKB/TrEMBL:B6H711 "
FT   CDS_pept        join(complement(243017..243092),complement(242787..242920),
FT                   complement(242581..242666),complement(242314..242512))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000014707" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977302"
FT                   /orf_name="Pc16g01040"
FT                   /product="Pc16g01040 protein"
FT                   /function="cytidine deaminase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP92774.1"
FT                   /db_xref="GO:0004126"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI00018314D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H713"
FT                   /transl_table=1
FT                   /translation="MAHTITAQELTTLSTKAIDAKATAYCPYSKFRVGACILTASGEFI
FT                   TGANVENASYPVGTCAERVTIGAAIVAGHRDFKALAVATDIKPAASPCGMCRQFIREFT
FT                   SPSFPVYMYDGEGNHKVMTMEEVGFLSFFSFLFGYISVLYLVDSLLISPVAPRLFRPQP
FT                   S"
FT   CDS_pept        join(243613..243667,243720..244396)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182400" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977303"
FT                   /orf_name="Pc16g01050"
FT                   /product="Pc16g01050 protein"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP92775.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="UniParc:UPI00018314DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H714"
FT                   /transl_table=1
FT                   /translation="MFNLGVQVINGQKTFIPLENNPEVHTHLCKNLGVSPSLTFHDILS
FT                   TTPEMLSWIPRPVNALILLCDKPIYLAARSRVEHSIPEYLGSGADEPVLWMKQTIGHAC
FT                   GLMALLHVVTNLENGKYVLAGSELEKIVKRAVGLGPVERARLLYDSRFLEEAHMDAASE
FT                   GSSIVPLPQEECGFHFIAFVKKDGKVWELNGGMNGPLLRGELEGDLLGEEGLDMTVREF
FT                   LSAADTEVHRGMSIIAVNNTM"
FT   CDS_pept        join(244675..244911,244973..245623)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000035269" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824071"
FT                   /orf_name="Pc16g01060"
FT                   /product="Pc16g01060 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP92776.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018314DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H715"
FT                   /transl_table=1
FT                   /translation="MTSILVTGATGKQGGSLINNLLKKNASFKILAVTRDINSASAKEL
FT                   AQKSSSITLIQGNLDDPAAIFKNAERVWGVFSVQTTNPRNDDERRQGIALIDESIKQGV
FT                   KHFVYSSVDRGGEKSDRNPTAIPHFIFKHEIEKHLMEKAKGTDMQWTILRPVAFFENFT
FT                   PDYFGKVFTTAWQMTLKGKPLQLIATSDIGFFAARAFMNTGESKNRAFSLAGDELTFEQ
FT                   MSEIFKDLTGKNVPTTFRIPVWLMMAAVKDLGVMFRWFRDEGYGADVPAVKRLNPSLKT
FT                   FGDWLKEDSQFETL"
FT   CDS_pept        join(complement(247276..247671),complement(245744..247219))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209860" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946598"
FT                   /orf_name="Pc16g01070"
FT                   /product="Pc16g01070 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92777.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018314DC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H709"
FT                   /transl_table=1
FT                   /translation="MSDVERNISASSSGQLNKRSCLRCSQRKVRCDKVHPCSICVKAGV
FT                   QCTFPGPKRTRQTLNRPPVSELLTRLKHLEEEVEQLRSTRCHPDTDHTDLDDDPNLQKT
FT                   VKKTELLVLKEGKSRYVSDEASVALGQKISELRDIIESPSDDEPYSLDATYNPTILVEG
FT                   GILGDHDFTWSLDYFRLHYFQPARMDALWRTYQENVAPLIVILHQATMARIVQDACAGS
FT                   DLSPSDEALLFSVCYAAVASMKAHICPSVLDVDRDTAIQDCRRAVSQGLRRANFISSQS
FT                   LSALQAAVLFLLCYRVGGDTRLVWAESAVVIRVAQAQGVHRDGRNFALPPFETEMRRRL
FT                   WWHICMLDMLSSGDQGVDTQIRPEMFDTQFPSNIDDDDIALCMTDWPLPKTGFTNITIC
FT                   IMTCQIMTGILWPRQCGYSDMSTHDRENLVTALGKRLHEQYIDHFNLDIPIHWVVATVV
FT                   RLQLSKAWLATQFQSGASDVKSFRHDDRVFETALELAQFSYLLHTNEGTPQWSWLCTSF
FT                   KEWHVVAFILSELCLRPLSPETDHAWDVVTKIYSSWQHDMPRTDAMLQKPLDRLMARTA
FT                   ASRASRQEQDGQAPFSQEALSDEFLGLGDTDSGLLFSGLDWLSGSLF"
FT   CDS_pept        join(complement(249327..249425),complement(248410..249270))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946599"
FT                   /orf_name="Pc16g01080"
FT                   /product="Pc16g01080 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92778.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00018314DD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H710"
FT                   /transl_table=1
FT                   /translation="MAAEHAIISEPMELPSLPPNQGLEAMKDIIFGSSAGMAGKLIEYP
FT                   FDTVKVRLQSQPEHLPLRYTGPLDCFRQSFRADGLRGLYRGISAPMTGAAVETSCLFFS
FT                   YRLIQDALRATVYPGVEHLPFVALIASGALSGSVTSLVLTPIELVKCRMQVPAESAGLK
FT                   PGPVAIVAGIFRHEGLAGFWRGQMGTLIRETGGSAAWFGGYEGVSSLFRKYNKSDPQFT
FT                   SDSLPIHQQMIAGATAGISYNFLFYPADTIKSRMQTVDISQLPVHAQQQTFWGETKALW
FT                   KQQGLKGMYRGCGITCARSAPSSAFIFTVYEGLRQYFG"
FT   gap             249792..249891
FT                   /estimated_length="unknown"
FT   CDS_pept        join(250273..250327,250416..250561,250731..250871)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217382" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946600"
FT                   /orf_name="Pc16g01090"
FT                   /product="Pc16g01090 protein"
FT                   /protein_id="CAP92779.1"
FT                   /db_xref="InterPro:IPR005579"
FT                   /db_xref="UniParc:UPI00018314DE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H712"
FT                   /transl_table=1
FT                   /translation="MSTSTATPVAPPTGMRKNGKNWHGTKKAFRPTAGLTSYAKRQELK
FT                   KHNDAVKELEREMKEEQEAERKARIQRIKDRREAKEEKLRYEKMAEKMHHKRLDRLKRR
FT                   EKRNKLLSS"
FT   CDS_pept        join(251292..251932,252003..252732)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977304"
FT                   /orf_name="Pc16g01100"
FT                   /product="Pc16g01100 protein"
FT                   /protein_id="CAP92780.1"
FT                   /db_xref="UniParc:UPI00018314DF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H705"
FT                   /transl_table=1
FT                   /translation="MEPPYKYAPFSTSRAASATFPSTQTPTRSQDQNQQASGLQSKSED
FT                   FSRFSSQESRQTDRRKSRRSRRNGSDDRQISPKGEHRIGPSPSPRSQEPSTFDSLRSNR
FT                   HKYSKSRDLRFPNPMSHLTSSASARGLLPTWSGGKDKDREGDDGLLRPITRETTRSRWG
FT                   SESTTAMSDGRKGNMLDTPGQHEQLAPICRHEILSMDDLEKVKKRRKLGEEYLRSALTS
FT                   IGTLATDVTRRLDYTYYNLLEKITALNSTISSFQDLSDSASTLLNDFEHETADLDQDIR
FT                   KQLNDLKGFEPQIQKADALEQRMKAGRQRVEELGKRLETVRHEIDNWEQRETEWQTRTS
FT                   RRLRIFWGIVISALLVLVLALVLQNWPQFWSPHPEASRLTASNHSSPSVPPQSEAWDEV
FT                   LGLAGRGSGSDAGPARYPTNLADRREGLDKAGPTSTVRSGHDAAAAKHDALSVLDEL"
FT   CDS_pept        join(complement(253822..253879),complement(253736..253755),
FT                   complement(253427..253514),complement(252899..253323))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000237611" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128404"
FT                   /orf_name="Pc16g01110"
FT                   /product="Pc16g01110 protein"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAP92781.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005873"
FT                   /db_xref="UniParc:UPI00018314E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H706"
FT                   /transl_table=1
FT                   /translation="MAEVETAPVVQARHVVYCGVCTLPPEYCEFGGTAKKCEEWLKENE
FT                   SDLWDKLYSEDALNANLSTLSVSAQERAAKDAAKKEAKAAANEARDSERKAASKILIKR
FT                   VERNKRKFVTVVIGLEVFGLENKKIAKDLGKKFATGSSVTRSPAGIEEITVQGDVSDDL
FT                   REWLLEIHGKQIPASNIELIEDKKKKKSEAPMV"
FT   CDS_pept        join(254050..254274,254497..254562,254811..254933)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671366"
FT                   /orf_name="Pc16g01120"
FT                   /product="Putative uncharacterized protein Pc16g01120 "
FT                   /protein_id="CAP92782.1"
FT                   /db_xref="UniParc:UPI00018314E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H707"
FT                   /transl_table=1
FT                   /translation="MAAVSSGRLSQSGSYVVLNCSLWDHVTCSARNGFFNLTPSPDFWT
FT                   NVTHHDIAYHCQSLLCPTSPEWRGHVPYPPTGFRQLACVIKTLGSEAGEDRVVSSSSSR
FT                   YKGSEHKYLARAVITGLRFASTASPKNQEGFGQ"
FT   CDS_pept        join(complement(256094..256195),complement(255928..255931),
FT                   complement(255852..255863),complement(255741..255807),
FT                   complement(255485..255629))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977305"
FT                   /orf_name="Pc16g01130"
FT                   /product="Putative uncharacterized protein Pc16g01130 "
FT                   /protein_id="CAP92783.1"
FT                   /db_xref="UniParc:UPI00018314E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H708"
FT                   /transl_table=1
FT                   /translation="MTVPGFLGGFWGIGGIGEVKGKKANNKFGFKEDQEVLYLDHLDRT
FT                   INRFFSTGYASGFLVGIFEDGYYKLPTYVTGIIYGIIGVSREPGPEPMHQGLSTLVFER
FT                   ESDPF"
FT   CDS_pept        join(256421..257010,257089..258076)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977306"
FT                   /orf_name="Pc16g01140"
FT                   /product="Pc16g01140 protein"
FT                   /protein_id="CAP92784.1"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="UniParc:UPI00018314E3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H716"
FT                   /transl_table=1
FT                   /translation="MTTLLTPRETHSPFSDPLRCPTGPTAQRYFLEDHAIPRKSPMQDD
FT                   YRARDSSPVASNLPSALPSPGFAPIPEQLAYASTLNSLSPENELALPSYDTESLHNPKG
FT                   PEDVSDASTDSHPPSWTLQAPSADDTLIEDEPSRHVDYLSHDWKEEDIWSSWRYVTSRR
FT                   NDYSNGVRLENASWRTWAKAKHNLKTVSPESLNWLKDCDVTWLYGPLKSSVERATSLSP
FT                   PPSRLETPNSYLDRKPILKKKTASEAILQRSLSQHTLLQHAGAILKAQEAENNWARPPF
FT                   PRSNTDLDHLHHRTGSSTYSLGGTLTASSSSGMTSPSERRHIHFNNEVVQCIAVEAKGY
FT                   EDDWPATFEDEPSSDDGVVLMRQISSRSSLSNCTTPRNSFNDGKTIAPLPSTTLKYRGD
FT                   PPGAQTILDRWSTPTRTLSPTPSVETIRPSEPSGQSEPSEPSANFLLDECEDPSLDFTG
FT                   NYPDRDRAWFIEDDPASGRPLRLTASGMIMPEGESESPSSSILDRVVDTVNTARDIAHV
FT                   IWNVGWRR"
FT   CDS_pept        join(258658..258924,259016..260390,260471..260925)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169030" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128405"
FT                   /orf_name="Pc16g01150"
FT                   /product="Pc16g01150 protein"
FT                   /function="binding"
FT                   /biological_process="phagocytosis"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="CAP92785.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0006909"
FT                   /db_xref="InterPro:IPR006816"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018314E4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H717"
FT                   /transl_table=1
FT                   /translation="METVNVAELVERLGSDEDAVRKMAVFKLQGNIGDPSFADIFIAEG
FT                   GLVRLRYLTLHASGNTLAYSLASFSRLLDVDKGWECVDQELVERIVELIVTHPLVNILR
FT                   GAMSILVSIVSHPYTGNRTSQVNNFGFRALKPAIAIYPQFLEMLVSRLSSADHALCANA
FT                   LQLINSLMRDSITHDPEAEWPKFIQKLQDLGVIRAVYVLMQDSALQDLAHPLLEFQSLT
FT                   KVLLRKWRDIPVNQEKPEHRRALKGIYLASNPEKNSDEATENGDSARPSRRHHPEKWRR
FT                   LGFETESPAGEFYEVGFLGMMDLADYVRSHGDEFQNMLLEHSTKPSRQRCPIARASLAV
FT                   TSILYEHFEVEKSDMDDTKTYLISESRTGFDKLFQPLLLHWTRLHVAGLQAFFRLWKAT
FT                   AAEEEDLDKLIELVRILIGSVVGGAARIKDVQDVEEELADFEYHRLRGLQMELLELTYE
FT                   DAWGQHLRQVREELHHEALQFVKEQRIRSLLQGSWFALDSHPKSESGPVQKSTATYQYA
FT                   QLSHNRRYLHFGQFDLMGDRPPELDTLPEKIDLSIVSSVVSNVSTNPDHSSTATVKTAP
FT                   RQPTTKITIHGYVPSTATGHGKGHSHARSGSRTTQKEVVLLTLRPSSHIIASEWLDGLL
FT                   MLLNQQPITAETSKLIDLVSDYGLKIRLLNVRFDDATFAGEAPQVPARDGLDEDYYYDV
FT                   FGGV"
FT   CDS_pept        join(261254..261985,262052..263821)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169019" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671367"
FT                   /orf_name="Pc16g01160"
FT                   /product="Pc16g01160 protein"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="nucleotide binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92786.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004582"
FT                   /db_xref="UniParc:UPI00018314E5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H718"
FT                   /transl_table=1
FT                   /translation="MDGRPPKRQRRSKDSKDEPKIKPKRKPVISDSSSPIEPTEPFALS
FT                   SRPKPSYSRGTTPSTRPPSYSPSPNKKTEASPNQGPKSKSLHSFFQPATEGQRWAPQKT
FT                   EKQSLPPVRGTVDVDLIEDDYDSYDEIFTQHLANERAGMGLTAMSSSQIRQSAPKPAPK
FT                   PKAKAQVKPPRKTTKRFLLSTDRGDGTAKEPLAAQPANEPDRRPWAQRFAPANLGELAV
FT                   HKKKVSDVQHWLEDAFAGRRSERLLVLRGPAGSGKTTTVSLLSESLGYDIVEWKNPPVS
FT                   EFGARDYQSVSAHFEEFLGRGNKFGGLDLEDASELDSQKEEKPRDQRILLIEEFPTMLG
FT                   RASSALTAFRTSLQRYLAASANDHVRGSSGSNHPPIVIIVSETLLGSASSISDNMTVHR
FT                   LLGPTIYNHPGTTILDFNSIAPTFMHKALRSILDREARTSRRMQIPGPGVIDSISEIGD
FT                   IRSAISSLEFLCLKGDDTGRWGGNVAKTKKARGEVALTAMEKESLKMITQREASLGMFH
FT                   AVGKIVYNKRMDPSLIEGDVEILPPPPDYLRHYARPKASQVLVNDLADETGTDVSTFIS
FT                   ALHENYIPSCDGDDFTDCFNDCIDALSDSDILSADHRPGPGARAGIGTGITSFGSGVDV
FT                   LRQEEMSFQVAARGLLFALPYPVKRRVGPGAGRSRAGDAYKMFYPASLRLWREAEEIDG
FT                   LIDSWMNRSLDPFGQQQHLSQNGSDLSGVSSWKSLQVGRSASAYSKDKGDIPSVVTMMP
FT                   RHDLLLHQLPYMAAIRRQDPDCWQLDKITSIRVNQNLRDGIDDMEESPVPGSRMKSSSS
FT                   NGVGPRLAEEKLILSDDDIVD"
FT   CDS_pept        join(264059..264320,264498..265182,265258..265546)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234632" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946601"
FT                   /orf_name="Pc16g01170"
FT                   /product="Pc16g01170 protein"
FT                   /function="nucleotide-sugar transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92787.1"
FT                   /db_xref="GO:0005338"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004689"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI00018314E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H719"
FT                   /transl_table=1
FT                   /translation="MLNDHEPSKRGPDDSYLINRTRVSVNPSGNTNFASKSRSRKSDEP
FT                   NYAQLKKDAPGLIAAAAHAAVPSWTSMVLMVSLIFGGCCANVELIRRPPSHIPNQIRSM
FT                   HTGPLITFAQFVLCALFTIPSFLSPSAGPRALFLNRRAIPLRSWVVYTAYFVSVNLLNN
FT                   WAFAYKISVPLHIILRSAGPVASMVIGYLYNGKRYSRGQIASVGMLTVGVAAAAIADAQ
FT                   SKGVSIHIDSDTADTATTVTGFTILALAMVLSAFQGIYADRLYATYGRDHWKEALFYSH
FT                   ALSLPLFLTSCPQLLGQWRVVASSPSLLSHLDSGWALLTQLPVQVAYLAMNALTQYLCI
FT                   RGVHLLSAKSSSLTVTIFLNVRKLVSLLLSIYLFGNHLAGGVLVGAALVFVGGGLYGFE
FT                   GARLRRVAKKAQ"
FT   CDS_pept        join(complement(268278..268376),complement(266211..268190),
FT                   complement(265835..266149))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161068" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946602"
FT                   /orf_name="Pc16g01180"
FT                   /product="Pc16g01180 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAP92788.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR003130"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI00018314E7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H720"
FT                   /transl_table=1
FT                   /translation="MTSLGEDLLVTVNKLQDLVFNTIGNDSLDLPQIVVVGSQSSGKSS
FT                   VLENIVGRDFLPRGSGIVTRRPLILQLINVPSERDDKPETDEIHIPHTAASVAGQHEWA
FT                   EFHHLPGRKFDDFGQVKQEIEAETARIAGSNKGINRQPINLKIFSPHVLNLTLVDLPGL
FT                   TKVPIGDQPSDIEKQTRTLILEYIAKPNSIILAVSPANVDLVNSEALKLARQVDAMGRR
FT                   TIGVLSKLDLMDHGTNAMDILSGRVYPLKLGFIGVVNRSQQDIQSGKSLADALRAESEF
FT                   FRHHPAYRNMANRCGTHFLAKTLNTTLMSHIRDRLPDIKARLNTLMGQTQQELASYGNK
FT                   QFSGEEHRGSLILQQMTRFAASFISSIDGTSSEISTKELCGGARIYYIFNSVFGNSLET
FT                   IDPTHNLTVSDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLESPSQRCVELVYEEL
FT                   IKICHTCGNQELLRFPRLQGKLIEVVSDLLRERLGPCSTYVESLISIQRAYINTNHPNF
FT                   LGAAAAMSSIMQNKQDEERKAVLAEEKRKREKRRQKELGAPNGNTGGPDEEEHADKQNL
FT                   PVRSHSSKGSRSMSPHVGRTGENGIAATLNGAHSNHAAFGGGASNTARDSFLNYFFGKE
FT                   GTHNTAMSPAGMNTNRQGPHAGEPSISQSIRRAEVRAPIMPTEEYAAPPEYGGDLSAFP
FT                   HENTEPALTDREMLETELIRRLISSYFNIVRETIADQVPKAVMHLLVNHCKDVVQNRLV
FT                   SELYKEDLFGELLYEDDGIKAEREKCERLLETYKEAAKIVGEVL"
FT   CDS_pept        join(complement(271297..271498),complement(271052..271239),
FT                   complement(269089..270993),complement(268932..269018))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169008" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946603"
FT                   /orf_name="Pc16g01190"
FT                   /product="Pc16g01190 protein"
FT                   /function="actin binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP92789.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR000108"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="UniParc:UPI00018315D2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H721"
FT                   /transl_table=1
FT                   /translation="MASLNLSSNGPSISKSYQTVVNAPPPSGNAGSPTYGQWVVYSVST
FT                   PLVSAFQQDGGKESVLKVQSTGEGELADLIEEFSEGRVQFAYVKVTDSNTGLSKNVLIG
FT                   WCGEGVPERTKGYFTSHLATVAKFLHGYHVQITARADGDLTPEGIIQRVADSSGSKYSV
FT                   GDAPAPAPAPRPVVASKPAFTPTRSGGITPSPAARVQPAPSTSDVTDDGWGADAPPVTR
FT                   TQLEKVQSAYQPTRVNLQELKANPTATRQPAATTNDSSDVVKGGYQPVGKVDIAAIRKQ
FT                   AAASGQLTDERPTIVKGSYEPVGKVDIAAIRARAQKPEGTSDNVSPSPAVNRQPATLPE
FT                   RPAPSNAASERLTTLPKPRVANKFGSSPSFPGTKPPLPTGIQPKPSSSAQIGAASRTFA
FT                   DEGGKTPAQIWAERKAKERGMASSPGSTETVSTPASIQSQTSGQGEWKSSYAGKSWAPV
FT                   QTAQEKTHIPEQPVDAKANDQQEEEPQPHVSSIHEQFAHDTPAPAPLAPPAPPVPQASR
FT                   PVPVLGLSSGPVESEPEHDVQQALPSPPPQPRSPTPPTPPVRESSPIQIAMPVGHSVAD
FT                   SVADVHEEQHSPPPAMPVHSLQEAVPDERDIEDDSHDLGRAAAEATAPQQHQQPQGGPR
FT                   AQIQYDYEKAEDNEIELREGEYVTDIEMVDPDWWVGVNTQGERGLFPANYVELLEDKEP
FT                   ASHATAGSHHYEPEPEPAAAPVPAASTPVTAAASSAATPSSKGVTATALYDYEAAEDNE
FT                   IGFPEDAKISNVEFPDDDWWLGEYNGKRGLFPANYVRLDE"
FT   CDS_pept        join(272479..273876,274024..275144,275208..275296,
FT                   275361..275647)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000092200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977307"
FT                   /orf_name="Pc16g01200"
FT                   /product="Pc16g01200 protein"
FT                   /function="AMP deaminase activity"
FT                   /biological_process="purine base metabolic process "
FT                   /biological_process="purine ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="CAP92790.1"
FT                   /db_xref="GO:0003876"
FT                   /db_xref="GO:0006144"
FT                   /db_xref="GO:0009168"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006329"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR016297"
FT                   /db_xref="UniParc:UPI00018315D3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H722"
FT                   /transl_table=1
FT                   /translation="MGPPQPDLSSSRNANDSSNDESATSTPGLKSPMDSPLHESSDALD
FT                   QPTEDILPRDQQQKTATYDYAYEKSMSHAEARLFYQHHQLAARNDTTLPLSPVAPARSA
FT                   VELQPEEPPANITDPMNTQGQLSREGSMVLESEPSALRLQSASEPGPSASHFLEDDQDE
FT                   ANDPARNQAALLGAVYGQEPYSAAESLQSTGVGIRGPQVASGFASSGDAVTSELNAIYC
FT                   KIKKLLDRRSQYMDLSLQGPGNDPKDQPDWQIYPPPPEPAWDDGKEYQPGSLGDPSDVA
FT                   GKKRKMGQDIGEDFDMEELLPLPKESPWTYRLDGNSVYQVFDSEASADQQTPIVRIPSL
FT                   RDFYMDLDAVVDVSTDGPAKSFAFKRLSYLEGKFQLYTLLNEYQEMADSKKVPHRDFYN
FT                   VRKVDTHVHHSACMNQKHLLRFIKSKMRKSPDEVVLFRDGKHLTLREVFESINLTAYDL
FT                   SIDTLDMHAHTDSFHRFDKFNLKYNPVGESRLREIFLKTDNYIKGRYLAEITKEVISDL
FT                   ESSKYQMVEWRISIYGRSLQEWDKLAAWVVDNKLFSPNVRWLIQVPRLYDVYKASGMME
FT                   NFEQVITNVFQPLFEVTKDPSSHPKLHIFLQRVVGFDSVDDESKPERRLYRKYPIPREW
FT                   STKQNPPYTYWLYFMFANIASLNNWRKRRGFNTFVLRPHCGEAGDPDHLAVGFLCCHSI
FT                   SHGILLRKVPLLQYLYYLDQIGIAMSPLSNNALFLTYDKNPCATFFKRGLNVSLSTDDP
FT                   LQFAFTKEPLIEEYSVAAQIYKFSAVDMCELAKHSVDQSGFERSLKERWLGSNCSMPGV
FT                   AGNNVAKSNVPDIREAFRHETLLGELSLIERYSEGDVTGEQKSLAPSPPGVAVPSNHDH
FT                   HTSNLESQSELSSSAADTTDALPSETHGTNQMATSPSTPSTYLARSPRLGTGEFSSPSG
FT                   NPALGTGVGGPDGLPEQKIFPGIVHERARKGNMQ"
FT   CDS_pept        complement(275984..277843)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076653" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946604"
FT                   /orf_name="Pc16g01210"
FT                   /product="Pc16g01210 protein"
FT                   /protein_id="CAP92791.1"
FT                   /db_xref="UniParc:UPI00018315D4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H723"
FT                   /transl_table=1
FT                   /translation="MGHPPEAHGKPSMPTEGCRSTAKLQDLTTPYECQPISSDNGHRAL
FT                   GSALSRSQVSPRAPRRFLAQPIETVSRSSNIQQSTLSGANQSAPSKPEIHSKGPCEQRS
FT                   TRRFLPEPIETSKTSNRRSHSTYEVHERNSASQSKTSTAPRRFKPDLIESDTRSVRKGE
FT                   PVRFVQRHNAVGSSAPHTITSPDTTLWSDTKPNAPTYLPSESQFSFSSLLRRQQARRHS
FT                   FRVPDLPSIPSNSSEESDNSRSHSACTSPPGPSNKASRDLCTSELPREICDGEISEFLL
FT                   SLAARSAQIQLKEQALAAFPNEQVYEPVDHFAIDEDDGDSDDYDVSMKYHHIKSRRQSS
FT                   ADLSWELEYMRHHKEEAEMRVRAMGASGQPKSSSEHNKNGKTPPMLGSDIVLPRSDSPE
FT                   GTICEHSSTDAASRGVDDLCTGCGDLWYAAPPRGGGKGAGLWKGTCCKDDGQEREVHGL
FT                   LPGIVTPMPRVDEAGISMGLSPSPSYTNLDRFEASPGNHSSRKPASPNLQKAIESEFHD
FT                   GFVTQIYNYLSLGYPCLARYYDYELSRISGISVEDLRRDDLQTDARGYLVASGKDDLAD
FT                   ICTRWKALRLYIQEWARQEPGMAEEDTNLEGWGLPERRGSWAI"
FT   CDS_pept        join(278369..278905,279002..279196)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234984" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946605"
FT                   /orf_name="Pc16g01220"
FT                   /product="Pc16g01220 protein"
FT                   /protein_id="CAP92792.1"
FT                   /db_xref="InterPro:IPR022226"
FT                   /db_xref="UniParc:UPI00018315D5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H724"
FT                   /transl_table=1
FT                   /translation="MDSKDKRKFENDDPYPGSVSKQRKVIGPSLPPPREADAANSETSN
FT                   DDDDDDDDDFGPSLPPSGSVKGPVPPVPTVSTASSIPKPVERESQRDQWMLQPPSHSDW
FT                   SSKVDPTQLRNRKFNTGKSATAPKNMDSSWVETPEERMRRLQDTVMGVAASTNQPEDNK
FT                   GATKAKLMEDQIKRYKDMTGKNSRLETPGQAEKEDDDPSTRAFDREKDMAVASKISSAQ
FT                   RREMVKKAADYNTRFTKGNFL"
FT   CDS_pept        complement(279781..280620)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204724" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977308"
FT                   /orf_name="Pc16g01230"
FT                   /product="Pc16g01230 protein"
FT                   /protein_id="CAP92793.1"
FT                   /db_xref="UniParc:UPI00018315D6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H725"
FT                   /transl_table=1
FT                   /translation="MFEGILSIFDKSSASFQVLSDLHLEVNQQYSSFEIPVCAKYLVLA
FT                   GDVGRLVDYDNYRCFLQKQTDRFELVFLILGNHEFYSDTFAAGLQRARQLEQEHCLNGR
FT                   LILLHRGRYDIPGSHVTILGCTLWSRVPDEARDIVCSRIQDFKRIRDWSVNDHNRSHEA
FT                   DLAWLLSGIESIQIQSKTRSRKQSVLVVTHHAPSLQGTSSPQHANNAWSSAFATDVLSQ
FT                   ISKSSGIKFWVFGHTHYTTEFRNQGIRVVANQRGYVLPWTDSKGPKDGFDIGKVIHV"
FT   CDS_pept        complement(282424..284079)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(285975..287108)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   gap             288637..288736
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(289228..289818)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        291928..293138
FT                   /pseudo
FT                   /gene_family="HOG000234520" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(294318..295869)
FT                   /pseudo
FT                   /gene_family="HOG000200306" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(295939..296020,296055..296070,296209..296238,
FT                   296340..296352,296414..296430,296580..296616,
FT                   296972..296978,297070..297120,297323..297338,
FT                   297440..297452,297535..297564)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946606"
FT                   /orf_name="Pc16g01290"
FT                   /product="Putative uncharacterized protein Pc16g01290 "
FT                   /protein_id="CAP92799.1"
FT                   /db_xref="UniParc:UPI00018315D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H726"
FT                   /transl_table=1
FT                   /translation="MRSSLVKYVIGILGILVDFRIVAVSIINLGDRRLDFIVSYDYKSG
FT                   VRAIYPDSLYSRTIIKKLREVKDILGILVDFRAVAASIIIFSNYKSGVRVGFVLGRLS"
FT   gap             297582..297681
FT                   /estimated_length="unknown"
FT   CDS_pept        297739..298173
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(299037..300397)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   gap             301685..301784
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(302032..303114)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(304825..304827),complement(304518..304677),
FT                   complement(304378..304430),complement(304171..304181),
FT                   complement(303967..304024),complement(303717..303798),
FT                   complement(303449..303626),complement(303372..303394),
FT                   complement(303289..303302))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        304829..306463
FT                   /pseudo
FT                   /gene_family="HOG000234520" [ FAMILY / ALN / TREE ]
FT   gap             309185..309284
FT                   /estimated_length="unknown"
FT   CDS_pept        312834..313178
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        313180..314190
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        314416..315159
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        316205..316540
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        317072..317568
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        318203..318898
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        319082..319360
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(320074..321582)
FT                   /pseudo
FT                   /gene_family="HOG000234520" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(321732..322313)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(323737..325446)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   gap             329280..329379
FT                   /estimated_length="unknown"
FT   gap             332939..333038
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(333679..334449)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        337496..338527
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        339747..341297
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        345457..346377
FT                   /pseudo
FT                   /gene_family="HOG000200306" [ FAMILY / ALN / TREE ]
FT   CDS_pept        347221..347679
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        348937..349239
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   gap             349753..349852
FT                   /estimated_length="unknown"
FT   gap             352332..352431
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(352947..353960)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(356923..357258)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(357321..358058)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   gap             359066..359165
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(363086..363544)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        363910..365545
FT                   /pseudo
FT                   /gene_family="HOG000200306" [ FAMILY / ALN / TREE ]
FT   CDS_pept        366891..367520
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(370791..371660)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(371779..372568)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   gap             376268..376367
FT                   /estimated_length="unknown"
FT   CDS_pept        377283..377647
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        377847..378233
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        378930..379952
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        380596..380901
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   gap             382164..382263
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(383015..384169)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   gap             385085..385184
FT                   /estimated_length="unknown"
FT   CDS_pept        join(<385248..385297,385728..385747,385849..385857,
FT                   385934..385949,386088..386117,386210..386231,
FT                   386307..386313,386599..386640,386695..386761,
FT                   386819..386823,386890..386933)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946607"
FT                   /orf_name="Pc16g01640"
FT                   /product="Putative uncharacterized protein Pc16g01640 "
FT                   /protein_id="CAP92834.1"
FT                   /db_xref="UniParc:UPI00018315D8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H731"
FT                   /transl_table=1
FT                   /translation="TTTTTTTTVASLTLYLYSRYRVYNILDLRDRKLDFIVFSNYNLYR
FT                   SGVRFIGRKDVICVKQIKLRRGKSEIICDIFIIPLLSYYDTRSTGPRNPYRDYKDYSI"
FT   CDS_pept        388030..389661
FT                   /pseudo
FT                   /gene_family="HOG000234520" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(389801..390994)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(391042..391914)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(393451..393900)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(395529..396120,396196..397643,397697..397822,
FT                   397873..399034)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(400190..400420,400492..401394)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020323" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977309"
FT                   /orf_name="Pc16g01700"
FT                   /product="Pc16g01700 protein"
FT                   /function="metal ion binding"
FT                   /function="porphobilinogen synthase activity"
FT                   /biological_process="tetrapyrrole biosynthetic process "
FT                   /protein_id="CAP92840.1"
FT                   /db_xref="GO:0004655"
FT                   /db_xref="GO:0033014"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00018315D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H727"
FT                   /transl_table=1
FT                   /translation="MSFSNLVSDIAFRDARVDDGSSQISHARSHRSHATARSYASTAAT
FT                   SVSISGEVSSQLHSGYSHPLTRAWQADRQLTKDMLIYPLFITDNPDEETSIPSLPNQYR
FT                   RGINRLVPFLAPLVRKGLRSVMLFGVPLQPSAKDALGTAADDPDGPVIQAIRLLRSRFP
FT                   QLYITTDVCLCEYTSHGHCGILREDGSLDNAQSVDRISDVAIAYAAAGAHCVAPSDMND
FT                   GRIRAIKLKLIEAGMAHRVLLMSYSAKFSGCLYGPFRDAAGSCPSFGDRRCYQLPPGGR
FT                   GLARRAIQRDMAEGADIIMVKPASSYLDIIRDAKDLAPDLPVAAYQVSGEFAMIHAAAK
FT                   AGVFNLKDMAFESTEGILRAGAGIVISYFVPEFLDWL"
FT   CDS_pept        join(complement(403601..404396),complement(402172..403418))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209013" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824072"
FT                   /orf_name="Pc16g01710"
FT                   /product="Pc16g01710 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="transferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92841.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniParc:UPI00018315DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H728"
FT                   /transl_table=1
FT                   /translation="MTALAAGPVMNGGHDSGAETGTEHSPSRFTAVNGREPVNPGNTNG
FT                   KGNGPTPSSIPNGEHVPAQEKTNSDATQRDDRDDPANDQEKWSQRSSPSGSHNKNKRKR
FT                   SESRERDSVNASRSPVTRPMDSNQPNPNGSIPGSVSEMERGNHSATPSQRSEGNDAGQT
FT                   SANSPWSEYDSQLITQAQRAQQMDASDAHLADALQREAGQEKSITNRSTPGPQHPSSPG
FT                   YAPDRHGTMQVAPKRKRVFSNRTKTGCMTCRRRKKKCDEQHPACNNCIRGGFLCEGYSS
FT                   RSTWQKPSSTKTPIPLQSKEGYSDINGPYMQETSRPQDRQPGLVEHVDAAKIRPLVEEN
FT                   DRPVQQYSTSPTHTPSNHAWSKQAWPGAGPGATSNTGHPPYPSEPIAKVVDYREVPPIH
FT                   ELSREGRPKPDYPVISSLRDLSHPSHPKSSMPLFQNGPEQRTLPAAAVDTHSPQAQARM
FT                   ALSIEHQLSGRTVSSDETEKEKMIRGKLYRPFDVHLVEERDRCRGALWKFNNACNPLNG
FT                   ISSKEQNRLLKEVIVPPACSIVNSPAGTGVPRSVGSIGQGAVVEAPFSCHYGYNIHLGE
FT                   DVMISENCLFVDDCVIRIGAHTWIGPNVKIISSTAHPNMQERKGSQSRYQGRQVIIEED
FT                   CYVGAGCIIYPGVRLARGVYVAPGEIVNTNIAGYMFQGSKPSFAM"
FT   CDS_pept        join(406307..406372,406495..406524,406589..406661,
FT                   406742..406813,406875..407587,407656..408898,
FT                   408967..409196,409302..409680,409739..409910,4
FT                   09968..410208)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209012" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946608"
FT                   /orf_name="Pc16g01720"
FT                   /product="Pc16g01720 protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAP92842.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR014877"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018315DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H729"
FT                   /transl_table=1
FT                   /translation="MSISVQELDNTVRALFEGKGAVQNQAQQTLTEFKQNPDAWVTVGN
FT                   ILQEASYLQTKYIALQVLDNVIMTRWKVLPRDQCQGIRNFIVRFILENSESEEKIQAER
FT                   PLLNKLNLVLVSILKQEWPHNWPTFINEIISSCHASLSICENNMTILRLLSEEVFDFSQ
FT                   DQMTSAKARNLKTSMTSEFASIFQLCSEVLNTANQPSLVKATLETLLRFLNWIPLGYIF
FT                   ETPIINTLLTRFLGEPEFRNVTLKCLTEIGGLQIGAPYNYDERLVHMFTETLTTVSNVI
FT                   PLSLDLKQTYAMSNGRDQEFVSNLALFLSSFFSAHLDLIEKLPNQDYLTHAHFYLIRVS
FT                   QIDDREVFKICLDYWTRLVQELYEEMQQLPITDINPLVSMSVSGLANGGAPNPTTLANY
FT                   PLRKHKYETVLTNLRTVMIEKMVRPEEVLVVENDEGEIVREFVKESDTIQLYKTIRECL
FT                   VYLTHLDVVDTETIMIDKLAKQVDGTEWSWVNCNTLCWAIGSISGAMNEETEKRFLVTV
FT                   IKDLLGLTEQKRGKDNKAVVASNIMYIVGQYPRFLKAHWKFLKTVVNKLFEFMHETHEG
FT                   VQDMACDTFIKIANKCRRHFVALQPGESEPFIEEIVRNMRKITMDLSPQQIHTFYEACG
FT                   YMISAQGQKGLQDRLTENLMALPNTAWDQIIAEANQNPAILQDANTIKIVGNIMKTNVA
FT                   ACSSIGTYFYSQIGRIYHDMLNMYRAASQLINDAVASDGAIAPKTPKVRGLRTIKKEIL
FT                   KLIDTYVDKSDDLEMVNASMVPPLMEAVLIDYARNVPDAREAEVLNAMTTIIHKLHNLM
FT                   EDKIPAIMDSVFNCTLEMINKDFHEYPEHRVEFFKLLQAVNLYCFQALLKLDAAQFKFV
FT                   IDSCMWASKHDNREVENTGLTMCLELMNNMAETDPQTSSIFFREFYIPILQDVFFVLTD
FT                   SDHKAGFKSQAMLLSRMFYFVESGKIQEPIYSPDQAPAGTSNKDFLQEHIANLLKNAFG
FT                   NLQEAQIKQFVLGLFAYTDDLNKFKTHLRDFLISLKEFSDDNAELYAEEREQAVRDAQV
FT                   AERDRAMKVGGLLKPSEMDHEDEL"
FT   CDS_pept        join(410824..411037,411113..411435)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076654" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946609"
FT                   /orf_name="Pc16g01730"
FT                   /product="Pc16g01730 protein"
FT                   /protein_id="CAP92843.1"
FT                   /db_xref="InterPro:IPR011107"
FT                   /db_xref="UniParc:UPI00018315DC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H730"
FT                   /transl_table=1
FT                   /translation="MSRTRQPMGSNLFQTTTESPQDSSTAHIPPTLRLRAEEAPTDASE
FT                   ATSSSRRIRWSEDVVDNEGMGKKSSKVCCIYHKARPVGESSSEESSSSSSESDSESEDD
FT                   RRTARVNRARHTHSHNGGREPHSEHASQPDEGCCPEDHGSKPKRNRRKPSPNAYEKMPK
FT                   PSKNPKQNQNHARGT"
FT   CDS_pept        join(complement(414054..414102),complement(413565..413976),
FT                   complement(412973..413511),complement(411987..412912))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217073" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946610"
FT                   /orf_name="Pc16g01740"
FT                   /product="Pc16g01740 protein"
FT                   /biological_process="meiotic chromosome segregation "
FT                   /cellular_component="chromosome, centromeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92844.1"
FT                   /db_xref="GO:0000775"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045132"
FT                   /db_xref="InterPro:IPR011515"
FT                   /db_xref="InterPro:IPR011516"
FT                   /db_xref="UniParc:UPI00018315DD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H752"
FT                   /transl_table=1
FT                   /translation="MARLNDYAAPAESIDALKRRFVRQNREIARVNSLQSLRIRSLESE
FT                   VSHLLSENVSLRKQVINLTQETERLEAGKMLHNGIYDIKSKLDAKLAELSNLAADLGSL
FT                   PRKVGKLCDDQLDRPKQAESRPRTEDIVGGEDGRLPAIVEDKYYPRRTLEPQELDSLVH
FT                   DDHSILDSPPQFSFMPEEGDAPIEHSSPSPPESKFRSQIENDTPEEPEPLLPPTLETRR
FT                   KKKKSGSIVAPEISPAQTDRPPSPPVDTTQHAKPVSTKRKYIPEDDDRFASNLIGDGDD
FT                   DEFQFTRPSHSPKKRTTPFEDTQRDQLLTESHVEVTRGSKTPVLSMRKVLEPKSANSNL
FT                   GSPKKARMSSYQDSKLLQMSTKGDENNNSPQKVKDVEKIGGKTVNQKPRVSRIAPSNKE
FT                   KRAIHPVPPQLEEPTPHQPAMPLHPNAMKTEEESAVRPSRRRGAVVSYAEPNLRDKMRR
FT                   PTKEMIDAVALGSRRSSSFQASQENVDGGGEGGHTQPHSSLPDDSTLAQSSDLFSADGS
FT                   SEQLAMVSRRKRKVSANPKDDNDAGNPSSALKNEIEDSLADISAQVSQKPLNSRRQTRR
FT                   HSSNPRSTTANIAQYGVDQVDLQSPTGDSPEDEDSFGPGPNSSTMDTNDVRRGQRAAAR
FT                   RKSMMV"
FT   CDS_pept        join(414451..414682,414740..414798,414908..414997)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208990" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824073"
FT                   /orf_name="Pc16g01750"
FT                   /product="Pc16g01750 protein"
FT                   /protein_id="CAP92845.1"
FT                   /db_xref="InterPro:IPR013963"
FT                   /db_xref="UniParc:UPI00018315DE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H753"
FT                   /transl_table=1
FT                   /translation="MAYSSRPTSMLPGAPGGSSMRQPSGSQSQQSSALSARIAAKKAEL
FT                   ENLRQLRDLSGTLAIQMQALDNKISTLKDGTEAVAYVLSNWDNVLRAITLASKNVEKPR
FT                   NDARLPSTLVRIPAEPRDKTGE"
FT   CDS_pept        416337..416711
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201309" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977310"
FT                   /orf_name="Pc16g01760"
FT                   /product="Putative uncharacterized protein Pc16g01760 "
FT                   /protein_id="CAP92846.1"
FT                   /db_xref="UniParc:UPI00018315DF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H754"
FT                   /transl_table=1
FT                   /translation="MSTEWSLDFCLVCDRQTLGAPYCSQTCRLAELDEVSDGMSRRSSA
FT                   ASTHWSEINQAQARAEALKADTHNPSRTLSVSSSQTSLSSLKSNTSTSSNVADRLQDEL
FT                   RDYASCFDQVRDLKRRMTTT"
FT   CDS_pept        join(complement(418815..419183),complement(417960..418717),
FT                   complement(417774..417892),complement(417399..417706))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161565" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671368"
FT                   /orf_name="Pc16g01770"
FT                   /product="Pc16g01770 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92847.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI00018316CB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H755"
FT                   /transl_table=1
FT                   /translation="MAIAAALASLQGSVIEYPYHSLAAAAVLAPILYVILNEFIRDAAR
FT                   VKGMKGPRGLPLIGNLAQIRKDAAEQYRLWSKKHGAVYQIQLGNIPVVVVNSAASAKVL
FT                   FGQNAQALSSRPETYTFHKIVSNTAGTTIGTSPYSDSLKRRRKGAASALNRPSVDTYVS
FT                   HLDVESKAFVEELYRYGNHGKTPVDPMAMIQRLSLSLALTLNWGVRIASQEEELFDEIT
FT                   EVEEEISRFRSTTGNLQDYIPLLRLNPFSSNSKKAAEMRRRRDKYLGALNSDLDDRMAK
FT                   GTHKPCIQANVIMDKEAKLNSEELTSISLTMLSGGLDTVTTLVAWSLGLLAQRPDIQDR
FT                   AAKAIQEMYGEDDPMCSPDDDQRCAYIAALVKECLRFFTVLRLALPRTSIKDITYKGIT
FT                   IPKGTVFFLNAWACNMDPDVWTDPDDFRPERWLEQPDAPLFTYGMGYRMCAGSLLANRE
FT                   LYLVFIRTLNSFRLEPHDKTDCHPLRGNSDPTSLVAIPQKYKVRFVPKNEKALSKVLAQ
FT                   "
FT   mat_peptide     join(complement(418815..419138),complement(417960..418717),
FT                   complement(417774..417892),complement(417402..417706))
FT                   /db_xref="UniProtKB/TrEMBL:B6H755 "
FT   sig_peptide     complement(419139..419183)
FT                   /db_xref="UniProtKB/TrEMBL:B6H755 "
FT   CDS_pept        join(419310..419405,419836..419928,420018..420149,
FT                   420333..420410)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946611"
FT                   /orf_name="Pc16g01780"
FT                   /product="Putative uncharacterized protein Pc16g01780 "
FT                   /protein_id="CAP92848.1"
FT                   /db_xref="UniParc:UPI00018316CC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H756"
FT                   /transl_table=1
FT                   /translation="MEHFRVVKVVQPAMASLGVLLPHTTPGLARSQGLVKIISTCARTQ
FT                   DLLERRASFGKRFPKSGKFEGTRKQVDPKLFINGSPWSPVGPGWGKIAVPDWSIGQMEL
FT                   DSQKVESWKGEVGSSGRDNEISSRHVSE"
FT   sig_peptide     419310..419402
FT                   /db_xref="UniProtKB/TrEMBL:B6H756 "
FT   mat_peptide     join(419403..419405,419836..419928,420018..420149,
FT                   420333..420407)
FT                   /db_xref="UniProtKB/TrEMBL:B6H756 "
FT   CDS_pept        join(420963..421393,421529..421788,421844..423172,
FT                   423235..423320)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000004813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946612"
FT                   /orf_name="Pc16g01790"
FT                   /product="Pc16g01790 protein"
FT                   /function="glycerol-3-phosphate dehydrogenase activity "
FT                   /biological_process="glycerol-3-phosphate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="glycerol-3-phosphate dehydrogenase
FT                   complex"
FT                   /protein_id="CAP92849.1"
FT                   /db_xref="GO:0004368"
FT                   /db_xref="GO:0006072"
FT                   /db_xref="GO:0009331"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI00018316CD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H757"
FT                   /transl_table=1
FT                   /translation="MAARHSRKLLRPLLYTSAAAAAGAGVLYISYRPRNIPGLEAPAVP
FT                   PPGYREGKLVPPSFPSIKSRLDQIQDLKRSNDEEEYDLLIIGAGATGAGIALDAATRGL
FT                   KVAVVERDDFSSGTSSKSTKLVHGGVRYLEKAVWELDYNQYALVKEALRERKYFLNTAP
FT                   HLSSWLPIMVPVQKWWQAPYFWAGTKAYDFLAGSEGIETSYFLTKSKAIDAFPMLKRDD
FT                   IIGAMVYYDGAHNDSRMNVSLAMTAALYGTTVVNHLEVTGLNKDASGKLCGARAKDLVT
FT                   EKNGEVAQEFNIRAKGVINATGPFSDSIRKMDEPDVKEIVAPSAGVHIILPGYFSPSNM
FT                   GLIDPSTSDGRVIFFLPWQGNTIAGTTDQPCEIEAQPQPTEKDINWILSEIRGYIAPDI
FT                   TVDRSDVLAAWSGIRPLVRDPKVKNSEALVRNHLVTVSQSGLLTCAGGKWTTYRQMAEE
FT                   AVDEAINVFKLKPRQLSTLPDISGVGGSGLVADGAVLDGSCQTHQVRLIGAHGFSKTLF
FT                   INLIQHFGLETDVAKHLTESYGDRSWQVAALSSPTSERFPVRGCRISPMYPFIDGEVRY
FT                   AVRHEYAQTAVDVIARRTRLAFLNAEAALESLPTVIDLMGEELEWSTARKDLEWKDSLT
FT                   FLSSMGLPKSFMGLSRRDVQNGRVKQVDDAERATFSRNEPPADMIESDKRATTAAPAAP
FT                   AATPSLN"
FT   sig_peptide     420963..421034
FT                   /db_xref="UniProtKB/TrEMBL:B6H757 "
FT   mat_peptide     join(421035..421393,421529..421788,421844..423172,
FT                   423235..423317)
FT                   /db_xref="UniProtKB/TrEMBL:B6H757 "
FT   CDS_pept        join(423636..423799,423850..423863,423915..423987,
FT                   424041..424734,424791..424988,425052..425216)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946613"
FT                   /orf_name="Pc16g01800"
FT                   /product="Pc16g01800 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92850.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI00018316CE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H758"
FT                   /transl_table=1
FT                   /translation="MNPNQCEIDSQPLSFVKQKLDPDKESVLPKPELEEQDPFGDESQA
FT                   GVKYKTMAWWQAGMIMIAETISLGILALPKALAVLGLIPGILTILGVGTISTYTAYTIG
FT                   QFKCRHVRVHSMADAGDILMGKIGRSTLDVAQLVFFVLVMGSHVLTFSIMMNVLTEHSS
FT                   CTIIFSVVGLLASFMLTLPRRLERLSHISSVSFVSIVGAVLTGMIGVTLVKEGPVHVSA
FT                   FSPSPKVHDACLAIANIIFAYAGHVAFFTLFSELRELRDFPKALALLQMSEMVLYTVAA
FT                   IVIYAYIGPTVNSPALNSAGQLFRKISYAIAIPTIVIGGVVNAHVAVKFIYVRVFRGTN
FT                   SMHSRSFLARLLWAAICAALWILSWIIAEGIPVFNDVLGLASSLFASWFSFGLPGLFWL
FT                   YLNRSCWFLTWRQRVLFGFNIFLVFLGFVIVSCVPL"
FT   CDS_pept        complement(426741..427043)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208979" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671369"
FT                   /orf_name="Pc16g01810"
FT                   /product="Pc16g01810 protein"
FT                   /protein_id="CAP92851.1"
FT                   /db_xref="UniParc:UPI00018316CF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H759"
FT                   /transl_table=1
FT                   /translation="MPNLPLSRSWPEIRQALEHARECEDGPVNAQSAAVLEAAITELWN
FT                   RIQAQPESYVLTPDEFALFNYFLATRYRGSTVAQRAVARFWNSYQKTTNCDGVSN"
FT   CDS_pept        join(429792..429864,429920..429963,430082..430208,
FT                   430270..430670)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000041378" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128406"
FT                   /orf_name="Pc16g01820"
FT                   /product="Pc16g01820 protein"
FT                   /protein_id="CAP92852.1"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniParc:UPI00018316D0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H760"
FT                   /transl_table=1
FT                   /translation="MVFYFTSTVVEPSAFIYVGKDKFENEDLIKYGLDNDVWYFHVDNL
FT                   SSAHVYVRLREGETWDNIAQPLLEDCAQLTKANSIEGNKKDNITIIYTPWSNLKKDGSM
FT                   AAGQVTFHNHKLVRKIYVKQRENPIVNRLNKTRVEKFPDLRAEKEEDMKKKQRSDRKAR
FT                   DEQRAKEKKKQQEYEQLKWQKNHAYDDMFTEENMEASNNQDRDEDFLDDFM"
FT   CDS_pept        join(431282..431315,431363..431466,431522..431941,
FT                   431995..432710,432770..432876,432940..433181)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946614"
FT                   /orf_name="Pc16g01830"
FT                   /product="Pc16g01830 protein"
FT                   /protein_id="CAP92853.1"
FT                   /db_xref="InterPro:IPR000237"
FT                   /db_xref="InterPro:IPR019459"
FT                   /db_xref="UniParc:UPI00018316D1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H761"
FT                   /transl_table=1
FT                   /translation="MSEGNPPSATPSAKSKKNKKKAAKAKADSKADEHAEDAPGDHDDT
FT                   DNEPHDANEDPIQVPESNGAKLNTIDGSLPDRSVNNQGPVATSDVPSGTDIHSDPASDG
FT                   TEPKDRFDALVRDRDSLRAEVADMRKSLEEIQSKHTADMEALQQKLDDAENKKEQAETQ
FT                   FQMLLERVNTIKSQLGERLKEDAEELALARSQIEDLEDENNNLKDELNSKSTQLIELSE
FT                   DSAEKEKELSTLRDRTNLSQQNWLKEKEELLEQESYLQSEFEQAKEAMHNWEILAMEER
FT                   SIRENLNEKVADLEEQLSSLRDGYERATHERDTQQSTVDGLQRALQEIQLARKQELREL
FT                   VESSDSQLENLRRSLREAQKQATDADKALQNAKEEIERVRPFEKEVKEKNLLIGKLRHE
FT                   AVTLNDHLTKALRFLKKGKPEDNVDRHIVTNHFLHFLALDRSDPKKFQILQLIAALLGW
FT                   NDEQREQAGLARPGTSSMPGKLRVPGTPLRTPSTPNLATEFMDNGASSKETLAELWSNF
FT                   LEQEAEVGNMSSSRRGSQQGPPK"
FT   CDS_pept        join(433511..433520,433602..433706,433782..433889,
FT                   433944..434074,434131..434367)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000037640" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946615"
FT                   /orf_name="Pc16g01840"
FT                   /product="Pc16g01840 protein"
FT                   /function="guanylate kinase activity"
FT                   /biological_process="purine nucleotide metabolic process "
FT                   /protein_id="CAP92854.1"
FT                   /db_xref="GO:0004385"
FT                   /db_xref="GO:0006163"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="UniParc:UPI00018316D2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H762"
FT                   /transl_table=1
FT                   /translation="MASAYRPIVISGPSGTGKSTLLKRLFAEYPDTFGFSISETTRSPR
FT                   PGEQDGREYNFVTKDAFLDLVAKNGFIEHAQFGGNFYGTSVQAVKNIAEKKRICILDIE
FT                   MEGVKQVKRTDLNARFLFLAPPSLEVLEQRLRGRGTETEESLQRRLTQARNELEYANQP
FT                   AAHDKIVVNDDLEKAYAELRDWVVDGGKFGAAQ"
FT   CDS_pept        join(complement(435949..436087),complement(435759..435887),
FT                   complement(435622..435703),complement(435430..435567),
FT                   complement(435145..435358),complement(434752..435096))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946616"
FT                   /orf_name="Pc16g01850"
FT                   /product="Pc16g01850 protein"
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="septin complex"
FT                   /protein_id="CAP92855.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0031105"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="UniParc:UPI00018316D3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H763"
FT                   /transl_table=1
FT                   /translation="MAAATTAAQAQQPTVFPHSHVGFDSITSQIERKLLKRGFQFNVMC
FT                   VGQTGLGKSTLINTIFASHLIDSKGRLTPSEPVRSTTEIKTESHIIEENGVRLRLNIVD
FT                   TPGYGDQVNNDRCWDPIVKYIKDQHSAYLRKELTAQRERYIQDTRVHCCLFFIQPSGHA
FT                   LKPIDIVVLKKLSDVVNVVPVIAKSDSLTLEERQAFQERIKEEFSFHNLKMYPYDNDEL
FT                   DDEERAINAQIKLQDIIPFSVVGSEKTIVVNGKQVRGRQNRWGVINVEDENHCEFVYLR
FT                   NFLTRTHLQDLVETTSQIHYETFRAKQLLALKESSAAGGHTGGSRPISPSADRELSRNS
FT                   QRAAMNGY"
FT   CDS_pept        join(436375..436711,436780..436817)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217072" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946617"
FT                   /orf_name="Pc16g01860"
FT                   /product="Pc16g01860 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAP92856.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI00018316D4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H764"
FT                   /transl_table=1
FT                   /translation="MALRLLPFAPATMSRSLLSESLQFPRLARFPPITPIATRFLQPVS
FT                   ISLNIPSLLSDLWDSVLRAVPKKKTSHMKKRHRQMAGKALKDVKSLNKCPGCGQIKRAH
FT                   LLCPNCVKDIKESWRTLDMA"
FT   sig_peptide     436375..436431
FT                   /db_xref="UniProtKB/TrEMBL:B6H764 "
FT   mat_peptide     join(436432..436711,436780..436814)
FT                   /db_xref="UniProtKB/TrEMBL:B6H764 "
FT   CDS_pept        join(437409..437525,437587..437623,437683..437943,
FT                   438014..438168,438224..438317,438370..438556,4
FT                   38608..438788)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208957" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946618"
FT                   /orf_name="Pc16g01870"
FT                   /product="Pc16g01870 protein"
FT                   /protein_id="CAP92857.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00018316D5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H765"
FT                   /transl_table=1
FT                   /translation="MNKKKSGDKGGTGLRAPTSLFLRKQSLDTALRELGIIRMSKQYLS
FT                   RGSADNAHIFDIFSLAITDKQILSVSGASSIKVHSTTDADFPLVQSIDGAHTIGCHHIA
FT                   INGNGSRAITAGFDGEIKAWSCEDGHWTADRKLTGADAWAIAISEDGQYLAGVTQEGRI
FT                   NVWDLSADGTRIRDHETRGNFGTCIDLSPDGRLIASGHEDGAVYIFSTETGRMPISLLG
FT                   LVNPVRAVAFSPRSKILAAAGDSKVIVLYDTSSGEQIANLSGHSAWILSLSWSDTGEYL
FT                   LSSSFDGKVKVWSMETKACVATHSETDKAVWSAKWLPKVGRTEGFATAGANRSIAFYRE
FT                   ATG"
FT   CDS_pept        join(complement(439554..439785),complement(438937..439481))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208946" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824074"
FT                   /orf_name="Pc16g01880"
FT                   /product="Pc16g01880 protein"
FT                   /protein_id="CAP92858.1"
FT                   /db_xref="InterPro:IPR013255"
FT                   /db_xref="UniParc:UPI00018316D6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H766"
FT                   /transl_table=1
FT                   /translation="MTSSFEPSLSTSGMRPPLASADAPSMADSLPSINFGFEDLRNSMA
FT                   QFTVKFDAFIERGRKRLLEERNQFHINLAEYEEDERMRQRDIEILNLKSQTHEQTLQKE
FT                   AAEAAEMHAAISSITLERDARLAKRDRLKQQIAETQKAISQKVEAQKSHAQHLDAQSRL
FT                   NFPELEFWQDYLCLRIEGAGREDRLKFVYSHLLEKDWEAEAWFELGTASRDYEVFHTRP
FT                   KVDRDALEHVVDLVNDDRDFGAFLKRMRKLFVETMN"
FT   CDS_pept        join(440051..441399,441454..443093)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(443412..443499,443556..443707)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000038877" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824075"
FT                   /orf_name="Pc16g01900"
FT                   /product="Pc16g01900 protein"
FT                   /function="metal ion binding"
FT                   /biological_process="metal ion transport"
FT                   /protein_id="CAP92860.1"
FT                   /db_xref="GO:0030001"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="UniParc:UPI00018316D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H796"
FT                   /transl_table=1
FT                   /translation="MSDHQYKFNVTMTCGGCSGAVERVLKKLEGVKTFDVSLETQTVNV
FT                   TTEPTLSYDDVLEKIKKTGKAVNSGEADGESKEV"
FT   CDS_pept        join(complement(447050..447184),complement(446878..446997),
FT                   complement(446525..446818),complement(445938..446460),
FT                   complement(444307..445772))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208924" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946619"
FT                   /orf_name="Pc16g01910"
FT                   /product="Pc16g01910 protein"
FT                   /protein_id="CAP92861.1"
FT                   /db_xref="InterPro:IPR018744"
FT                   /db_xref="UniParc:UPI00018316D8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H797"
FT                   /transl_table=1
FT                   /translation="MARVTRRAASASARHGAGRAVQRRARRHKVIMESVTQEKKKLRSV
FT                   ICFEAQAPSGYTFIPAGNPQLTTTCKERCRAEGLQIHAVSTTPHHRHHNLSQHVHRIGY
FT                   HFPSTVVAAVCSELGFYLTSTGKTVPSTFPTDRIENSKRADSEVSQITLNTEARDALKD
FT                   LFPNIPDKDLNQIIKTAFQKGQNKVGTATELPLARRVQLAVVAHVRHVYTDYDRLLKTT
FT                   SFHEARGVVEHTTLAKVIEWRGDDENGQTVLEDVFREVIVISDDDDSESEEETADLAGH
FT                   QNTSVEILPSDTRAHEIRSQPINNTNPLGRDLARELSEEAPPGFRFVTRAPATDTINRR
FT                   GFNRYKAWTRAVKEYREASNDSQAHRVPAIPLMDRQVAKRHVGVQENYLHSDVQQKYSA
FT                   HELNARPTGLTNQESPELQILEELSGPRNVNMSHSQDVPPPRMEPRFRQRLPPQSDRTN
FT                   APVFVSGPKDNRQKLTPVGRRPDAGNSPLLRLGSNTQDSILPSIENPRPPENRRTDGAN
FT                   PLVHMANKMSLRSVTPGHPQGEMMPQPDVIEKEGDSGQASKRRRLACREGSRTESRPDP
FT                   WSARPMGLPVSDGFGPPSYRPVELVPDYRAQDQPHFRRDYLPVEPPPVVGYQRESNPNA
FT                   FSYSSAQHGPETRSVLGRQPISGPHEPQSKVGLSGTSIIVSEGDRNFRAAPAVSDSGPW
FT                   HLYHGDRSFRSDCVPKEPRAIRRTRIDGGRPLSENVHSDRNLYAEDFVRHVDHREPPPF
FT                   EYVSRRAGPAAKPIGESSQTARTRDLDYLGTKNLSQTQVSSDQHRPLPIGRVAPSHDHL
FT                   RTFSDPVGKIQPHVSLPQVPRERPASGGFNSSR"
FT   CDS_pept        447782..448090
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234764" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671370"
FT                   /orf_name="Pc16g01920"
FT                   /product="Pc16g01920 protein"
FT                   /protein_id="CAP92862.1"
FT                   /db_xref="InterPro:IPR013884"
FT                   /db_xref="UniParc:UPI00018316D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H798"
FT                   /transl_table=1
FT                   /translation="MNASIQAMKVDQRAMIHAYRHLYRQGLKAIQYSTPGRHILLKSLR
FT                   NSYRSSPSEQFDPAKITNTLRFLERATEVAGMEHKILKNLLLARYWEQGHLARESRV"
FT   CDS_pept        join(448941..450173,450224..450588,450640..451228)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208913" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946620"
FT                   /orf_name="Pc16g01930"
FT                   /product="Pc16g01930 protein"
FT                   /function="electron carrier activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP92863.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017921"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00018316DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H799"
FT                   /transl_table=1
FT                   /translation="MSGFISSLLIQIGIRSPLPPQPSKQPNDDQAKFHLNEPTNPSCNS
FT                   EDHKFGPQLDQDHGQKSNCGDAGAGSLHSPPFFTTLPKEMDGRNLQAEGTRSVTDNTPG
FT                   SRNIAATTVGSLDPTYEIDVTAQPDGSGNPQGSHPSEVSNSPSEPQYAASGIAIGEPRR
FT                   SLDNALDPEGLTQSSLPADDGMGVLRSKIIAIRELGLTNVEKARMVHGLMTEGYNSSRE
FT                   LPNTSSPPSLELPTSPRTPRASEINTSRPGSPYTESVPLYESTFNLTTEDLQPTFVPKA
FT                   ETEPPELETGDEDCDTEEQEETILGCVHYQRNVKLECYTCKKWYTCRFCHDEVEDHTLV
FT                   RRDTEHMLCMLCGHAQPAAQNCRQCSEQTAQYYCEICKLWDNDSKKSIYHCSDCGICRI
FT                   GQGLGKDFFHCQTCSVCLPMCIENTHRCIERSTQCDCPICGDYMFTSPETVVVMRCGHS
FT                   IHHKCLSEYSKSSFRCPLCSKTITNMESTFRNLDRTIESQPMPEEFKDTKGLIYCNDCG
FT                   SKSVVKYHWLGLRCDLCESYNTAQLRILHGDMSAQPDEDSGEDLLPRPRSSSVIENDDS
FT                   MSSSLAALNVNNTSVPRSRLSVPMSPEPVRRFSSYNITRGRAVSPVVSNYFGLPTERES
FT                   EKPSSMPFFGGPSRGENEDYGALNFLSKKLTYRYGLFGGETKSVEKVLETGDEEEDDDD
FT                   GESSDSAESDGSHGTEDDEEEEEDQDHIQIFGHQ"
FT   CDS_pept        join(451260..451519,451567..451702)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946621"
FT                   /orf_name="Pc16g01940"
FT                   /product="Putative uncharacterized protein Pc16g01940 "
FT                   /protein_id="CAP92864.1"
FT                   /db_xref="UniParc:UPI00018316DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A0"
FT                   /transl_table=1
FT                   /translation="MADGLVYRPGECDPAALFLPSSIIPSQAVHRAMNTVQLERSPTPL
FT                   VGFDFRSISDPVPHRVDKNPSRPIPFCTKAISLSLCVPLHMGQPSEGQLNALRGCWSYI
FT                   HQAAGFAAALRSLLFWLSKHTGVMTQR"
FT   CDS_pept        453082..453459
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946622"
FT                   /orf_name="Pc16g01950"
FT                   /product="Pc16g01950 protein"
FT                   /protein_id="CAP92865.1"
FT                   /db_xref="UniParc:UPI00018316DC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A1"
FT                   /transl_table=1
FT                   /translation="MQIIHGKGEERHFKVTHELSQPYRLYNIVHDPSHLTQITIFDPKV
FT                   PLREETRSQPDQFVAIISENGAKGELDTSHTSPWNRQVASEGNNENVGERKDLCFVPYY
FT                   LRADRGGRGRGQMRVSVLSTE"
FT   CDS_pept        454035..456974
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208902" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824076"
FT                   /orf_name="Pc16g01960"
FT                   /product="Pc16g01960 protein"
FT                   /protein_id="CAP92866.1"
FT                   /db_xref="InterPro:IPR008862"
FT                   /db_xref="UniParc:UPI00018317AA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A2"
FT                   /transl_table=1
FT                   /translation="MIRRNSDIEIQLPDAGPTPLSPESVSDLDVEMLSEESALPLSLPP
FT                   HIAARFYRKSSKARRSSAVSSRRSSVSSLHSHHSNTSSNGSPGADHIAQHLRRTSILES
FT                   RKARLADRALHAEKVRLRAALAKAATRNLQFEERALAAQQARERLLADITAKCEDQVKR
FT                   AKKKAEDQREKKAAEQARLRLEMAEKLAEAEKRRTLYQQTHRRQRTSSLPATEEKKMSR
FT                   EVTKSLTQDAAARKIQRVWRTHNAKMTMQRFQSLNLSVARVRDMTFEEVGALLSNRKLL
FT                   DTMTNVLRLCGLQDMEGGAMGERGAVRTFLSSYLIVTHPKEVLSSDGDQEQDLIAKARE
FT                   LLVAFDQVTALLSSGCCSPSVITADLQTLCESHNVFFSAFHAWKSHDSSVLIEIMVAQF
FT                   VELELIWQTVKNDKAGGAAEDYRLGIRQNQVLLLARLKRLAGPDRHMEMIRDSLKKAKR
FT                   EKKRAAPKQAIPRSAETAPPTTEATQSVTSPLSESFNNIDAAVFQELDKQRTSPHERFT
FT                   KILTPLPENRELVHELLINKEFKIEEAPYTEPRRQIMKQMCDTMRRGVEAGHGTNWTVA
FT                   MATVIQDRLLRSLQRGNSLYVIISEVLDPKLVQGQCEAGTFSYDNFFEFMNNILPRLCA
FT                   PYRDPVVKAYIEDTSGDAIDRLARLMSIIDLLSLDQTNFMIQLAAPQLIEEAPGYEKRA
FT                   FDRDVTDGTISLGKTRRFWRIHRKIIVDEMKKRDPEGVQGEPRPSSARVYAQGLADTVL
FT                   SNAVVSEDLVPETLSLDRQRLERLHAKAFQIVATASILLTAKNLLKRDARSQWKPEADR
FT                   ILSLDFNEISAERVQSILEATHPMPPAASAQLKATIKRVLGPVATACLAAAPQLAVVTS
FT                   ETSASDASVSSTDSPGTTTSAPSFSDPVTKLILSRLRGHVLSRLSASSASERVRATTTA
FT                   SQNLAGAGMPEFVNEVGKLVEELEKVREVDWLCHGAIYEGLYEEGVPAQ"
FT   CDS_pept        457355..458722
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208901" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824077"
FT                   /gene_name="cia1"
FT                   /orf_name="Pc16g01970"
FT                   /product="Probable cytosolic iron-sulfur protein assembly
FT                   protein 1"
FT                   /protein_id="CAP92867.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00018317AB"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6H7A3"
FT                   /transl_table=1
FT                   /translation="MSPKVTITHLSDLTPPSQERTWLTAPHPTLPLVATCSSDKTIRVY
FT                   SLTNFTLLSTITGGHKRSVRTAAWKPHMTGESVLATGSFDATVGIWRRWDSYGQEGDAG
FT                   MGMSSGDKQIPTDISTAASNGTGTDTADREEDEEEWRFAVLLDGHDSEVKSVSWSASGM
FT                   LLATCSRDKSIWIWEDLDDGDNNFETVAVMQEHGGDVKCVSWHPSEECLASGSYDDTIR
FT                   LWREDLDDWGQVACIKGHGGTVWFLDWEGEETEGNWSGPVADSVSESALSALQAQWRSQ
FT                   RALSGPRLLSCSDDRTVRVWRRQPKESQQTGPLSSATTGIPSIIRPTGTDEVWEEDAVL
FT                   PRAHELPVYAVAWSKRTGLVASTGADGRIALYEERFVTREQEQEQQADSDAMDTTSGDV
FT                   LRTEWVLVGVQDGAHGIYEINHVAWAKRADRRPGGEEEVLVSTADDGSVKVWTLTR"
FT   CDS_pept        join(complement(460951..461072),complement(460524..460884),
FT                   complement(459130..460470))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208879" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946623"
FT                   /orf_name="Pc16g01980"
FT                   /product="Pc16g01980 protein"
FT                   /function="serine-type carboxypeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP92868.1"
FT                   /db_xref="GO:0004185"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="UniParc:UPI00018317AC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A4"
FT                   /transl_table=1
FT                   /translation="MLLSALSLLLSPLVSASSAADYYVRSLPGAPEGPFLKMHAGHIEV
FT                   DPDTNGNLFFWHFQNRHIANRQRTVIWLNGGPGCSSMDGAFMEVGPYRLQDDHTLKYNE
FT                   GRWDEFANLLFVDNPVGTGFSYANTNSYLHELDEMAAHFVIFLEKFFELFPEYANDDLY
FT                   IAGESYAGQHIPYIAKAIQDRNKGITENGGTKWPLKGLLIGNGWISPADQYPSYFKFIE
FT                   REGLAKPGTSLHHNINALNEVCLSKLETPGAKNKLDVGACELVLQQFLDLTTEDHQCYN
FT                   MYDVRLKDEAKSCGMNWPPDLKNIEPYLQRPDVVKALNINPAKKSGWTECAGMVHMAFT
FT                   AKNSIPSVHLLPGLIESGINVLLFSGDKDLICNHIGTETLIHNMDWKGGTGFETSPGVW
FT                   APRHDWSFEGEPAGIYQSARNLTYVLFYNSSHMVPFDNPRQSRDMLDRFMKVDIASIGG
FT                   QPSDSRIDGEKLPQTAVGGQANSTAAEQNEKERLKQTEMHAYTKSGEAVLIIVIIGVIA
FT                   WGFFIWRSRRTRRGYKGVSNNDMSDSTSVLSRFQNKHSGRDVEAGDFDEAELDQLHSPS
FT                   IEREDYAVGEASDDDDHIISHPETGGNRQSS"
FT   mat_peptide     join(complement(460951..461015),complement(460524..460884),
FT                   complement(459133..460470))
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A4 "
FT   sig_peptide     complement(461016..461072)
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A4 "
FT   CDS_pept        join(complement(462344..462656),complement(462227..462244),
FT                   complement(462064..462174),complement(461892..462010),
FT                   complement(461791..461844))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208878" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671371"
FT                   /orf_name="Pc16g01990"
FT                   /product="Pc16g01990 protein"
FT                   /function="serine-type carboxypeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP92869.1"
FT                   /db_xref="GO:0004185"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR007364"
FT                   /db_xref="UniParc:UPI00018317AD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A5"
FT                   /transl_table=1
FT                   /translation="MTRPTFVVEHLDPELGPWSTLEYACIARESHDRGARFLLSSVPAE
FT                   LQMPADLAATKGLEVEQRSVEEIFADRKDKVCLLDPSAQTELSPEDGDNFEVFLFGGIL
FT                   GDDPPRDRTSELRKKGYVGRRLGPKQMTTDTAVRVTRLVVHEKTPLEDIQYVDYPELLI
FT                   NEHERTEMPFRYVKGANEQPIMPDGMVDLIKKDADKSIDFF"
FT   CDS_pept        join(463363..463398,463446..463529,463596..463988)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208857" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946624"
FT                   /orf_name="Pc16g02000"
FT                   /product="Pc16g02000 protein"
FT                   /protein_id="CAP92870.1"
FT                   /db_xref="InterPro:IPR006760"
FT                   /db_xref="UniParc:UPI00018317AE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A6"
FT                   /transl_table=1
FT                   /translation="MNPHQQNKVDINSLSPEEQRLLRLYGKMPTKKDVLQNKLKERKYF
FT                   DSGDYALSKAGKASDVGVTNIGSRHPVPENIPHLTSTSPGANNSANNGSVSSQGGQQVP
FT                   GSISGHPGSVGFQSRSPIKEGGSYLHHGTSISEGEPGSGPASESVRGEQEFSVSPPPAR
FT                   EGVPIRR"
FT   CDS_pept        join(465399..465923,465979..466782)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208846" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128407"
FT                   /orf_name="Pc16g02010"
FT                   /product="Pc16g02010 protein"
FT                   /protein_id="CAP92871.1"
FT                   /db_xref="InterPro:IPR013635"
FT                   /db_xref="UniParc:UPI00018317AF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A7"
FT                   /transl_table=1
FT                   /translation="MWLFRVFSSALFLAITVSSIPLAFDVGGKTCGLAFSLSLAAFYFL
FT                   VSLLKVTTPERSWFRSSIIAVLRFIQWAVILVLLIWSLNRFSVDLDSTGPGWVERTFSG
FT                   KRAEDSSIQEWLFGREGLVETVALGNWDRLLRWSTPVFQLAEGFCSLLVIQAAGQITRW
FT                   LVNRGGRSDSWMIGLLVLSATIISSSVYFLWRVLQFPEISNVDAALIGVSVTCAVILCA
FT                   WGIGSGRGNPVESSLLFAYIVLCIYQIFTDYQPSHPVEQIPSPSQVGDFPPLPPIIMAS
FT                   YTTLMHALSLLPSIIHAAFNVITAVFSAVTPSVLISLAYRLLVLYASTRIIPAVRESGA
FT                   RALSQEASIDDTDAAGQVLGFLSYFAPSILIAVYTSLLMQHFASTSQAMGGSGEWWSTQ
FT                   GNGGGNPWRWINLACTISLYAVELWLGETNDLDNGVAGHWKTD"
FT   sig_peptide     465399..465467
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A7 "
FT   mat_peptide     join(465468..465923,465979..466779)
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A7 "
FT   CDS_pept        join(468079..468137,468204..469236)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208845" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946625"
FT                   /orf_name="Pc16g02020"
FT                   /product="Pc16g02020 protein"
FT                   /protein_id="CAP92872.1"
FT                   /db_xref="InterPro:IPR003226"
FT                   /db_xref="UniParc:UPI00018317B0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H774"
FT                   /transl_table=1
FT                   /translation="MAENVAKKLKTSSPSIGTHNGHFHADEALAVYLLRLLPTYASSPL
FT                   IRTRDPAELEKCHTVVDVGGVYDPAIHRYDHHQRTFSTTFPQRATKLSSAGLVYMHFGK
FT                   AIIAQKLSLPVEHADVDLLYEKLYTDFIEAIDANDNGISAYDQAALTAAGIEKRFKNGG
FT                   ITLASMVGDMNNPDPTSPPGEPQDEDSLFGRASTLIGNAFARKMHHACTSWLPARTTVG
FT                   SAYASRKDVHPSGRIIVLPQGGVPWKEHLYNFEAEASGTKEIDPTVQAYYVLYPENATE
FT                   GAKWRVQCVSVSESSFESRKPLPEAWRGVRDQDLDGVMAAEAEKNGQSKIPEGAVFVHA
FT                   SGFIGGHKTREGAMAMAERSLEL"
FT   CDS_pept        complement(469824..470393)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208824" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671372"
FT                   /orf_name="Pc16g02030"
FT                   /product="Pc16g02030 protein"
FT                   /protein_id="CAP92873.1"
FT                   /db_xref="UniParc:UPI00018317B1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H775"
FT                   /transl_table=1
FT                   /translation="MEHNLLDSLLDVEEQFYNEGYELGTADGAATGYTEGSVFAVEKGF
FT                   EKFVEMGRLYGKALVWAQRLDMKSSEGAAAQADSTTGSTTDTLSLDPSICEDMPSLPPH
FT                   SSRLARNLQTLLELVDPATLDMSNTEEAVNDVDERLKGAATKAKLIQRAMGEREDPAAQ
FT                   VEPKDMSTSGDGSGSIEDISALSIRH"
FT   CDS_pept        join(470561..470691,470753..472571)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200402" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946626"
FT                   /orf_name="Pc16g02040"
FT                   /product="Pc16g02040 protein"
FT                   /function="ATP binding"
FT                   /function="methionine-tRNA ligase activity"
FT                   /biological_process="methionyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP92874.1"
FT                   /db_xref="GO:0004825"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006431"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="UniParc:UPI00018317B2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H776"
FT                   /transl_table=1
FT                   /translation="MTDPILPKAGERNILVTSALPYVNNVPHLGNVVGSVLSADVFARY
FT                   HKACGRRTLYICGTDEYGTATETKALEEKMSPEDLCAKYNKIHQDVYEWFNIGFDHFGR
FT                   TPTQKHTDISQSIFKRLHENGYLGERTAEQPFCEQHGSFLADRFVEGECPRCHYDDARG
FT                   DQCDKCGHLLDPFDLINPRCKIDGAAPVRRETKHIHILLDKLQPEIEKWAHPAIEKGNW
FT                   PRNSRIITESWLKEGLKGRGITRDLKWGVPVPLEGYENKVLYVWFEACIGYPSITANYT
FT                   DDWEKWWRNPEDVQLWQFLGKDNVPFHSVIFPGTQIGTKDKWTMLHHLSTTEYLNYEGG
FT                   KFSKSRGVGVFGTNARETGVPADVWRYFLLKNRPETGDTQFEWAPFVDSNNGELLAKLG
FT                   NLVNRIIKLVTASYGSVIPEFTVPETFNPFLEEVTEHLRQYHEDLEGAHLRAGVQTAMR
FT                   IAEAGNGLIQANRLDNALIANEPERAAAVVGTVLNLIHLLSSVFSPYMPATSKSILEQL
FT                   NAPFLYLPSVEELQSGWKPTSLKAGHKIGKAAYLFSRIDPKKADEWREMFGGSQADRKK
FT                   KEEEAAKLAAKKAAAKAKKKEKKEKGRAGAPEGGVEGSAKGGAEKVSVTTEGKNDEAVE
FT                   KVADGVAQVTLPTS"
FT   CDS_pept        join(complement(474002..474262),complement(473078..473902))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208823" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946627"
FT                   /orf_name="Pc16g02050"
FT                   /product="Pc16g02050 protein"
FT                   /protein_id="CAP92875.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00018317B3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H777"
FT                   /transl_table=1
FT                   /translation="MSLFGGGASSASAGQTNTTGDISKDVALNAPPEDGISDLRFSPTS
FT                   EHLAVASWDKKVRIYEINDQGQSEGKALFEHEAPVLNCCWSPDGTKVVGAGADKAARML
FT                   DLSSGTTTQVAAHDAPIRSCHMIPNPSVGGTPLLITGSWDKTVKYWDLRQSTAIASVEC
FT                   QERVYTMDVKNKLLVIGTADRYINIINLDQPTKFYKTMQSPLKWQTRVVSCFSDASGFA
FT                   VGSVEGRCAIQYVEEKDSASNFSFKCHRETPPANRDVCNIYSVNAISFHPIHGTFSTAG
FT                   ADGTFHFWDKDAKHRLKGYPAVGGPITTTAFNRNGNIFAYSVSYDWSKGYSANTQQTVN
FT                   KVMLHPIGPDETKPRPNTRKR"
FT   CDS_pept        complement(475566..476246)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128408"
FT                   /orf_name="Pc16g02060"
FT                   /product="Pc16g02060 protein"
FT                   /protein_id="CAP92876.1"
FT                   /db_xref="UniParc:UPI00018317B4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H778"
FT                   /transl_table=1
FT                   /translation="MASIGWFPRAKFGPGTTVLFEKPTISAWSIREKQSQHNYQREDWD
FT                   LDPGPSTAEATFHVQQDYGPLAYMRVYMQVPDPSTEFEPREVRRRQAALCPHREVDALK
FT                   CFHQKHFTMTPALLGIKEELQGDDDVVPGGFIVYMVFQHVPGIRLADDQGAPVRGCSIH
FT                   TFFREFDREERDKVRDEFDKNYPRLAELDLTLYSIWADHLVWDPVSSKLYVPSMLIQSC
FT                   SLTT"
FT   CDS_pept        join(477336..477486,477537..477588,477642..477825,
FT                   477895..478053)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208801" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946628"
FT                   /orf_name="Pc16g02070"
FT                   /product="Pc16g02070 protein"
FT                   /protein_id="CAP92877.1"
FT                   /db_xref="UniParc:UPI00018317B5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H779"
FT                   /transl_table=1
FT                   /translation="MSVPLTKIDSAIAGLSISDEKPETTEKEVKAKSHRRTSSTAEGVW
FT                   NIKDLEEQKMDITLPIETQKTGWKLNTSPSTIEDKDILKMFLVNPPVKKIDLHFPLGLE
FT                   VTARNLKGVTVKDALDAIYKQFKKKADDELDKPYLAGFEWDKEDCWTRLIVHQKKEGAP
FT                   QPSKKSKKKSKKKSKDEA"
FT   CDS_pept        complement(479140..479646)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946629"
FT                   /orf_name="Pc16g02080"
FT                   /product="Pc16g02080 protein"
FT                   /protein_id="CAP92878.1"
FT                   /db_xref="UniParc:UPI00018317B6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H780"
FT                   /transl_table=1
FT                   /translation="MAPTPTPAQSHALSIPEIFELILLNLDIRTLLTKASRICHSWSHF
FT                   INSSPRIQWALFFRPLDHALDKPKTQNPLLAETFPSIFDQFECTSKKNDLDTDTTNEKP
FT                   TSNVTLTTFDMIKNPHKWDAYIRPEASWRRMLVQQPPVYTLSLLRSNVGHGGQHLYIYE
FT                   AMVSV"
FT   CDS_pept        join(complement(481734..483583),complement(480937..481445),
FT                   complement(479870..480885))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128409"
FT                   /orf_name="Pc16g02090"
FT                   /product="Pc16g02090 protein"
FT                   /function="phosphatidylinositol binding"
FT                   /function="signal transducer activity"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAP92879.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR003114"
FT                   /db_xref="InterPro:IPR013937"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniParc:UPI00018317B7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H781"
FT                   /transl_table=1
FT                   /translation="MALSRRDLVLAGVGVFIAWGLVVRWLPILRYLGYAVTLGAILSSV
FT                   GLLGLITLTIRHQNDKANTKNVSVAFIKPNQWRKEVLNVRRSTRYRPRPLYPQSFVVSE
FT                   RIDELLSLITRDFISSWYRSISPNPIFANEVDRTIRVALENLRDRLVAEDMVSLIVSRI
FT                   FPIVTSHLKEFDIAERSVRGRNLNRNVTESGELDLAIANKYRDGRLHPAVATSASDQKA
FT                   VQQDYLRKLAVGLLPQLFPESVLNSRIVSVLIREIISCAVLIPIVTALSDPDTWNQLME
FT                   AYGRTALHDRKTVRKLRAALDQHASPTPKSKRGQPFPRLSATDSERAFERFVRAIRKCN
FT                   NLSDARRFRALVSSQLKQESVVEGQDQVYLKRLETGKRVLDQKVAKLAKPGEDSHVPPA
FT                   LDPRPEIPSKTHESSLVDVMHSASGLSYFMEFMDRQKLMSLVQFWVVVDGFRNPLEDDF
FT                   GDEAAPTSLAWKPADRNDLALISETYLSKPELKVSEESRRAVKTFLSAGKRATPEQYRK
FT                   ARMVVLTTQSAILEHLQDTYYPKFKESDLYWKYLASDEASAAQAPVRQPSPIAVTFEAP
FT                   ERRPLPPLLSRTSSQPGLRPSKDLRRAAVSSGDVRGMGKLFSSEIPQVDNRNERTKKSI
FT                   ASLGLVDHASRLGVFDDDLFPDQQKFIEDEYEEPDGVDEKDSADEVHEAAPGDLGLTEA
FT                   IEALSVDIDKLAAQDAVVQALTRKAELTNNTAELRILRKSKASIQREMHRKEMQRQQYI
FT                   LQESDNSLFGRSTVSIKSIVVGKEEDDGREFAMYVVEVQRNAGEQMPAASWVVARRYSE
FT                   FHDLHQKLRQRYPSVRHLEFPRRRVVMKLQKEFLHKRRLALEAYLQKLLLLPEVCRSRD
FT                   LRAFLSQRAILPRMEIARDNEGETKDLVTRIYNSVADGMDDFLGNFGVLDQLSTAGQNL
FT                   ISAATQQASSAIPESSLATEDAVTAAEAEAELNAFEDRELEPFIKPICDLFLEAFELNR
FT                   GNNWLRGRAVVVVLHQLLGGTIERKVRDGARGLVQDDSLLKYISLARDTLWPGGILRKA
FT                   PPRSAAERLNSRAEATVVLATLIPDLAGNVVGRANAQAAARRIFATLNNQHLNTHLVFT
FT                   ILDEIVLVLFGSAGRPR"
FT   CDS_pept        join(484008..484056,484113..484152,484237..484253,
FT                   484310..484736,484787..484844)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208789" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946630"
FT                   /orf_name="Pc16g02100"
FT                   /product="Pc16g02100 protein"
FT                   /function="N-methyltransferase activity"
FT                   /biological_process="phospholipid metabolic process "
FT                   /protein_id="CAP92880.1"
FT                   /db_xref="GO:0006644"
FT                   /db_xref="GO:0008170"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniParc:UPI00018317B8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H782"
FT                   /transl_table=1
FT                   /translation="MASLTDFVDFSSKPLLWSAATIAFNPIFWNIVARAEYRNHFLTRL
FT                   FGGAYNGCYFLAFTIFSLGILRDHLYQLALADQPFYAPVHQPIVGGVLFAIGSVLVLSS
FT                   MWALGVTGTYLGDYFGILMDAPVTGFPFNVTGSPMYWGSTLNFLGVALYQGKVAGILLT
FT                   AQVFVLYWFALGWEDPFTAEIYAKRERERAKKQ"
FT   CDS_pept        join(487422..487544,487585..487851)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671373"
FT                   /orf_name="Pc16g02110"
FT                   /product="Putative uncharacterized protein Pc16g02110 "
FT                   /protein_id="CAP92881.1"
FT                   /db_xref="UniParc:UPI00018317B9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H783"
FT                   /transl_table=1
FT                   /translation="MEILKDENLTVNVTSTETPAHRTHFSAMPGEEIQIPAGIVALQRR
FT                   GGYDLKAVIGTQDEAQTKEQTYDADSKIEGEDEDNTNDKGEERQNQDSGTWTISPCTHC
FT                   LLPKWTCVPYWDGPWTFQLSFYYVD"
FT   CDS_pept        join(complement(489579..489839),complement(489334..489487),
FT                   complement(488080..489263))
FT                   /pseudo
FT                   /gene_family="HOG000208764" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(493946..494239),complement(492259..493870),
FT                   complement(492085..492198),complement(491752..492032),
FT                   complement(490267..491715))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208753" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671374"
FT                   /orf_name="Pc16g02130"
FT                   /product="Pc16g02130 protein"
FT                   /protein_id="CAP92883.1"
FT                   /db_xref="InterPro:IPR012880"
FT                   /db_xref="InterPro:IPR021773"
FT                   /db_xref="UniParc:UPI0001831889"
FT                   /db_xref="UniProtKB/TrEMBL:B6H784"
FT                   /transl_table=1
FT                   /translation="MDAYPEDYVNHNLPLVLLSGLEADTENEPGTPSDYPLLSEKGTHI
FT                   FSDFPPLSGAVAEELRSLLLEEDSSQSPWKSRVTVSGNTTIANIGYRIKSSGRSCRLPP
FT                   QKADPPIPSPPTTPSDDHDNEHSEPSAHYVLHSPISPLSPGSPTFPDGLLTPLWVTKHQ
FT                   DLVPAAVINFFPFSLDPNMNSLRDNQLKIEINSLKKEWQSSGYKTRFVVVLLSEDGEEG
FT                   GYEGEIDDRIAGIRRATNLDPRSIFVIPPDATSSELQDFVKSLFSLLQPSVVEYYRDLS
FT                   KHARRKRNRGNIPPPTAPPTTGTSQTLSSQGWNVRYEFKLGIFAEFRQEMDAACRNYES
FT                   AYETLFGHEVFENIAGWNPRFNDARLLADALAIRIIRCLLWTGQTTTAARLWVDHRVRV
FT                   KDIVDRRGKGSKHYGWEAWEARWSMVMAQLIRRAEIPPISSEISSEQPRKLYALPEKSI
FT                   PTGERVRPWEHLHHEGYWLHRSAKHTMLRRALAQEIPLEDRKPPGQSPASQLANKSYLY
FT                   DTYLVPDAHAEAPQEGRTGFDHSGLILSTLKAAIEEFAKRDQTRKVESLSLEAAEEYMR
FT                   IGSWSEAHGLLRPLWSTLSWRRSGWWHLMANFGRALRECALRMQDSETILRVDWELLNK
FT                   NLKPRSAWHYDIHKSLESLPSEKPKPSLILRAEDVITSLTASLVFEKSDGNVGEPLHAQ
FT                   LAITSCAHKFSAPIRLSEVKLVFEGCLRPVKVQSDQNQDADTTTSCCIATLPLREPSNA
FT                   DTAVQSPAGGLTALTKVFDLTCVPREAGEARVASITMLIEEEQFDLGYAVTEPEQRESF
FT                   WWEQTQKGVTRRRVGKDRDTGRCKVMPKPPKIRLTTPNLKRTYYTNERVMLQIGIHNEE
FT                   DEAADISAEIRLFGTESAAQIQWLDGDSNPELLESGASTPIEGPSHYLKRSVGVLERSS
FT                   QKTLTIVLVDTQEATDFTLEVSTVYHLVSDTQTPIMKNTTVDLSFIRPFEANYEFLPAI
FT                   HPQPWPNFFAVSDNLLEDGSAPSPGGLFQKWYLNSKVVSFALEPLVIDKMSLVLLEANG
FT                   GVVCDVHSEELVTPGTPHLAPEELRESNFCLDVQKLLLGDRRPTALTCTLEINWRRQSS
FT                   ESVASSDAENSVTTTVLDIPRFVVPMGEPRVLASATPSSSMAGLIHMGYVLENPSTHFL
FT                   TFNLVMEASEHFAFSGPKTTVVQLVPLSRHTVNFNLFAAKRGLWIQPQLVVIDTYFNKT
FT                   LRVLPTGDMRSDKKGVLVWVDADD"
FT   CDS_pept        join(495350..497147,497196..498124)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208742" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824078"
FT                   /orf_name="Pc16g02140"
FT                   /product="Pc16g02140 protein"
FT                   /protein_id="CAP92884.1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI000183188A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H785"
FT                   /transl_table=1
FT                   /translation="MSNENPVQAESALLSRRRRRKSLPSRNGTDPTSPEVISSLISSLS
FT                   TISVPLNSHFDTIPKIDNESDPGLPEVPHTAPVYSIPPSEQHGFGMSYGAYKPTVEPPA
FT                   LPENPFLHPDDAASSPVIRMARAPPSPKSPRSPRFKPFRTADSSSTRPASRESYTSVIA
FT                   APEPSSFGTISTEPGPRLSTPSIASNSSAGRTKSLKGQLSLLKRSSREFVGEKDPQIER
FT                   LRKTTSYNDSLRHNVPRSRASLRSLHSMAEVTEEARPADVKEEPYEEKVASTPTKDYQS
FT                   FHGTPDASNPGGIGSGRIIPTRDSSLRHRHSQSSSSKKHRSARHSRYSSTASKEFNTDN
FT                   GLPGTSNDAEQVTRRIQEVKDQQQKIKTELEVGNSPEHSTKASPAKQAKPSKVSRVLGY
FT                   DVNQAMQNGPRRDRPSFNESAPSPNVMTGKSRTGSRPGAPLAPKSTHLPSQLPKSSVER
FT                   PDSERARYRQSLEPITPITHRRTPSGHLSHLSNGRPSYSTERPSSADSIDLAVDDYIFS
FT                   PKLTQRVIHPTTGRSIAFSEVGNPKGHVVLCCVGMGLTRYLMAFYDELARTLNLRLVTL
FT                   DRPGVGESGPHQGDEPSTPLSWPDDVAIVCNHLRVTKFSILAHSAGAIYALATALRIPQ
FT                   HIRGRIHLLAPWIPPSQLSNIGSKKEPAPTNAVPYSQKILRALPTSLLKVANSSFMSAT
FT                   SASITTSLPKSPRRAKRKAATKEASNATAIPPVPPIPSVDPNPQTPRVDIVPNIKPSAS
FT                   NTASYRKSDATLGSRAKSPEDEVERQRDYDTRLTYKIWELATTNANPAVDLLTCLERRQ
FT                   TIGFRYVDITRSVVIHHGSKDPRVPAENVQWLGKTMRRCEVRILEGEGHGLMASAGVMG
FT                   NVLTEIAKEWEDWTILVQGKRRATVSHAARPGLSIQT"
FT   CDS_pept        join(498906..498983,499054..499477,499545..499861)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208731" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946631"
FT                   /orf_name="Pc16g02150"
FT                   /product="Pc16g02150 protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAP92885.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniParc:UPI000183188B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H786"
FT                   /transl_table=1
FT                   /translation="MPSSQRRLRLVVIAVIALLFMVFYYTGDATKIQNQKFYRSTIDAM
FT                   KAKEQAKQAKAQEKIQHPVHAPGQNVAAGAGAGEKVPVAEVEKAAVPPATDNEDTEEVS
FT                   IAGRTKMTVPKKANQDTPSEVQSELKSEEEKEREEKAKREREEKERKEAEATTELNAIL
FT                   KRAPVIVFSKSYCPYSKKAKLILLEHYSIEPKPLVVELDQHPLGPYLQALLAQSTGRRT
FT                   VPNVLVSGKSIGGGDDIAALDQRDELASTLRQMGGKWIVDVSHHEVEKSL"
FT   CDS_pept        join(500252..500297,500563..500866,500965..501142,
FT                   501214..501264)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000039905" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128410"
FT                   /orf_name="Pc16g02160"
FT                   /product="Pc16g02160 protein"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP92886.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002359"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniParc:UPI000183188C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H787"
FT                   /transl_table=1
FT                   /translation="MRYIHSEERLPILDNVKVHIKSRIVTVEGPRGKLVKDLSHIAVTF
FT                   GRPEQNVISIELHHGARKGVATLRTVRTIINNLMIGVTRGFKYKMRYVYAHFPINVNIE
FT                   PNPETGRAVVEIRNFLGEKYVRRITAQPDVDIAPSANVKDELVLTGNSLEGVSQSAADI
FT                   QQVCRVRNKDIRKFLDGLYVSEKGNIIEE"
FT   CDS_pept        join(501844..501927,502053..502183,502260..503058,
FT                   503116..503850)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208720" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946632"
FT                   /orf_name="Pc16g02170"
FT                   /product="Pc16g02170 protein"
FT                   /function="hydrolase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP92887.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniParc:UPI000183188D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H788"
FT                   /transl_table=1
FT                   /translation="MGSWWLGLWNIVGAVWNMVLDVAQFWRDKLLSWWHSKSPRDRLFH
FT                   TLANAQSYEEWEEAAFELDELQSKDIWRQNPVSRHYDYRLILGRLEALMGARESEDILT
FT                   LVNLLRSGLVRNLGNITSTKLFTHAYAGTKLLIDDYITQVALSIQYVTSVPGAPMHPSG
FT                   FSSQAKLELLHDTRQAFGRTTLLLQGGSAFGLCHLGVVKALHLQGLLPRIITGTATGAM
FT                   IAALVGIHSEDELLPLLDGEGLDLSAFERRKMVSGGGEGNSDYSWVGTFYRRMKRLLRK
FT                   GYLFDVGVLEECVRANVGDLTFEEAYARSKRILNITVATTEKNGTPNLLNYLTAPNVLI
FT                   WSAAVASNASSSGLYSPVTIYCKDETGTIIPWPHTQDTVFRPWRHVQYNEGESPLSRIS
FT                   ELFNVNHFIVSQARPYLVPFLRSELNLLDRRQTGWNNLSRSAMRLMIVELRHRLRQLDY
FT                   LGVLPAPLSRLLIDETIPGPNLTLVPDLCFWDLRKLFQSPTKERVSEWTLKGERGVWPA
FT                   ISALKVREAVEIELDRGYQLVRRRRPSDASLSVSVPKQVNAMNEGVPRRRRGESENEEG
FT                   ILADRE"
FT   sig_peptide     501844..501894
FT                   /db_xref="UniProtKB/TrEMBL:B6H788 "
FT   mat_peptide     join(501895..501927,502053..502183,502260..503058,
FT                   503116..503847)
FT                   /db_xref="UniProtKB/TrEMBL:B6H788 "
FT   CDS_pept        join(complement(504639..504812),complement(504304..504405),
FT                   complement(504114..504200))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128411"
FT                   /orf_name="Pc16g02180"
FT                   /product="Putative uncharacterized protein Pc16g02180 "
FT                   /protein_id="CAP92888.1"
FT                   /db_xref="UniParc:UPI000183188E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H789"
FT                   /transl_table=1
FT                   /translation="MSLLDDGWTVVERHKNARVRNKIAAENVKFIGHSIKELEGCWVVA
FT                   VNTFFARGGGAEQDERLVLTFIVTAVTGEQRKCHVFETGKGTRCVGDEVLDIKLKSMRV
FT                   ILKPNPNLQDIGIIPR"
FT   CDS_pept        join(505768..506060,506122..506456,506513..506817,
FT                   506875..507046,507101..507306)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128412"
FT                   /orf_name="Pc16g02190"
FT                   /product="Pc16g02190 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP92889.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000183188F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H790"
FT                   /transl_table=1
FT                   /translation="MTSILEWLKRLFGKRLFNLEWLRSLFRRSLKFPVSFPKAGWAVIP
FT                   ADEKVEEEQMPGFYEQNYFLPVTMGEILLSRYQAVGKLGWGTTSTVWLVRDLEMNDYKA
FT                   LKLFALDVFAAEESAFYDQTKQGNQQHPGANRVRAKIGNVMIPRKDWMYYDDHLALVQT
FT                   PLGESLQDLQIRSAGERLDKLSIQSTIYQMLLALDYLHTECHLIHGDIKGDNIFQEIGD
FT                   KTRLDRYVQAEMENPSPRKFADDYPIYRSRPLEPASELGILQLGDFGASAQGDQPRNGK
FT                   ILQPGLYRSPEVVLKKEWNYPVDVWNLAVWAWCAFEGSPLFQCTDTSENKRSYSVSLHL
FT                   AQFTGLLGPPPPDLIEPDTISAEYFDKDGNLVAKDREVKMTSFEELEKHLEGEDKEMFL
FT                   DLMRGMITWRPEDRKTPKELIKHPWLQAMDTCFSQAN"
FT   CDS_pept        join(508621..508784,508841..509259,509310..509450,
FT                   509514..509728,509781..509978,510040..510183,5
FT                   10239..510322)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946633"
FT                   /orf_name="Pc16g02200"
FT                   /product="Pc16g02200 protein"
FT                   /protein_id="CAP92890.1"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="InterPro:IPR021711"
FT                   /db_xref="UniParc:UPI0001831890"
FT                   /db_xref="UniProtKB/TrEMBL:B6H791"
FT                   /transl_table=1
FT                   /translation="MPLTTPVLTVDADNIHKVDTANAQSLHGMWMVFSKCADYMDQGRR
FT                   LENLSWRLWTRETFCVEPEKSNSTSALPLLRSEAGDLPELSASVESAASDQAERIEAHI
FT                   KRPKFSDYRPAVVREDSLASLGRGKEKHITSLDLERMVLNIKEKKQLEPMPTVEPAAPV
FT                   VDITPRPSTPTPTPPSVSTARQVPNFSVRPTPYPHESTESCSTTAPEGNESDTAQVNAS
FT                   DTSVSSSGILPSRPQLVKSTSIVRGFSPSHISSSFRSQPRLSIEPSPSRSATQLKPSPL
FT                   KKKGGMFTLGGSGDDDESSFEERMVPQAGQENATGALKPKNNTDPTKKTASFSNQVSSH
FT                   IIPNSKDISRSDEDAIETDDEVSESAIEDDEDSDWEDSITEGGESSVDEQGGMFQRVDS
FT                   RPNLVSRRSMLTMMMHQPARMQGNAFRSSPALQRSRLTSPSGPSIPQSPPSNEEESLVM
FT                   RGPDVPRSKPIVMNTNASQSMAHSPRTTRRNMLATELTESLRRHLLWERQQKSATANAF
FT                   LKRRHTAHDMKNLQEYPGPKGPHKGVGPNQASAEADPNAADLGKNGSWTNYTTDYGPWE
FT                   YHVKGW"
FT   CDS_pept        join(complement(511271..512759),complement(511175..511212))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946634"
FT                   /orf_name="Pc16g02210"
FT                   /product="Pc16g02210 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP92891.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001831891"
FT                   /db_xref="UniProtKB/TrEMBL:B6H792"
FT                   /transl_table=1
FT                   /translation="MALEKEISPSPSPQDHEKGTIENLQLDRLGYKQELRRNRSVLTLL
FT                   FQTLAMAAIPYGEGSPLLSAIYGGGPLSIFIGWIVVCLLDQCIALSLAELSSRYPTSAG
FT                   PYYWTFQISRKKTTLSFINAWIWLIGNWTITLSVNFGFASMLSATISIYHPTWSASSWQ
FT                   LLLIFYAVCLTSLAICIFANNHLPLVDTLCATWTLLTIIIILVALSIKADTGRHSVSYT
FT                   LSHYDKSFAGWGDFTFFIGLLPAAYTFSAIGMISSMAEECANPAIKVPRAIALSIPVGG
FT                   TAGLFFIIPICATLPPLQDIIDAPAGQALPYILARVMGSPAGGLGLVSLVLVITVFCSI
FT                   SITVAASRATWAVARDDAVPLARLWARVDQRWGVPVWALVLLTGIQMLLGLINLGSSSA
FT                   FTAFVSVGVIALATAYAIPIFLSLWYGRREVAKAPWNCGGVGWFVNVVALAWIAFELVL
FT                   FSMPMALPVTAVSMNYASVVFVGFMAISAVWYGVYARKYYKGPPESDALD"
FT   CDS_pept        complement(513516..515699)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208709" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946635"
FT                   /orf_name="Pc16g02220"
FT                   /product="Pc16g02220 protein"
FT                   /protein_id="CAP92892.1"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="UniParc:UPI0001831892"
FT                   /db_xref="UniProtKB/TrEMBL:B6H793"
FT                   /transl_table=1
FT                   /translation="MGNPALDLKVAQTNQSMVAIAGIPQNGETGQYIARGSNDRFELIS
FT                   GPLLNLKNMHYEATTTWHGSVLIVTKPTQDNPQLRLRQVGAVDSGAQNGEGRAPTSQTI
FT                   EGLKLYEDPQKAFWRFSLTVPVAAFEARWAYDIPGLYESGAQVQTSWEFVVPAEEQSMR
FT                   IMFHSCNGFSVGTDMDAWVGPNLWNDVMRVHGEKPFHVMVGGGDQIYNDGIRVDGPLKP
FT                   WTMISNPHKRRHHDFNNQMRAESDDYYYANYVRWYNTEPFRAANGRIPQVNIWDDHDII
FT                   DGFGSYTDHFMKCAVFRGIGGVAFKYYCLFQHHIAPPKSTFTTDSPQTMHAVNGTSGVD
FT                   PRQVENTYVLENQVEDDSWIIGKRPGPYVEERSRNLYMRFGKRIAFMGLDARTERTRHQ
FT                   VNYEDTYDLIFDRLQREIVDSNGDIKHLVVLLGVPIAYPRLAWLENILTSPLIAPVRLL
FT                   NKRFGVAGGLFNEFDGQVDLLDDLDDHYTARQHKRERKMLVHRLQEFARSHSVRVTILS
FT                   GDVHLAAIGRFYSNPKLNLSGENDHRFIVNVVSSAITNKPPPQAVANLLARRNKIHHLD
FT                   RECDETLMPIFDKQPGGREKGADWNKVTMPSRNFAILTEVVAPGAGNTGILDANSVKLD
FT                   RLPKDGHAPLHKGEVDAGTTHGAADGFTCATGMYGGLDVSVRVEIDPHDRSATTEGYGF
FT                   SIPPLLATEGPPSTGHRLSLHSRRSQGRPSTAM"
FT   CDS_pept        join(complement(516550..517542),complement(516401..516419),
FT                   complement(516291..516316),complement(515918..516247))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824079"
FT                   /orf_name="Pc16g02230"
FT                   /product="Pc16g02230 protein"
FT                   /protein_id="CAP92893.1"
FT                   /db_xref="UniParc:UPI0001831893"
FT                   /db_xref="UniProtKB/TrEMBL:B6H794"
FT                   /transl_table=1
FT                   /translation="MQSPRLSPSADDMIPVNPLKRVKPTKSTNPNPPKDPQPVTKELSF
FT                   ASYLNRYMRHPWGVIDYHIYLTHIESGRDKLRREKECHLLETTGFAQVTLHDEPVLNNI
FT                   PAYTNPTVFFVSLPVPDIQNESSNALLVLGFDLQSDRLQGYFFEPESPVENYDDLWEVW
FT                   SQGEGHLVIDVPVDRFLAIIRHTMQHRIEILEIGVLHHYGLTTREFQAGLDMVVTVQFL
FT                   QFVDDFAELLSEEPDELRETYTPFQDELRELLASGSRDAWFAVRDGLNIEQYRQKQLKK
FT                   VVSSGLFQGQDVLVLRDGSEEITEKDKSRPVKIVPGHRRWSWSKLRVRVLLFRSIEIKS
FT                   PGVHDSGLYMYKCPKQDNSSIQIAIKICEIHENPRKSDRQKKKCTASLAQSGIARNHSC
FT                   GVTWLNWGVAGITFSPIGQTINGMSWQRQSCSSSFLGPRPQGPKGTDPQPPISLRV"
FT   CDS_pept        518856..519248
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946636"
FT                   /orf_name="Pc16g02240"
FT                   /product="Putative uncharacterized protein Pc16g02240 "
FT                   /protein_id="CAP92894.1"
FT                   /db_xref="UniParc:UPI0001831894"
FT                   /db_xref="UniProtKB/TrEMBL:B6H795"
FT                   /transl_table=1
FT                   /translation="MGQDSVFIVQAEYFQDFDGDAWVSVDSHDFDDPDNEEADWVTVVL
FT                   PEEMAHTHDDEDIMMYVLHNIQTRRAVVREVALHNMGTVCISIPIPVGTADTTSILVQA
FT                   ETDVKKWLEHIRDGMVTLDREVIFGR"
FT   CDS_pept        join(complement(519962..520459),complement(519567..519621),
FT                   complement(519452..519530),complement(519294..519384))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946637"
FT                   /orf_name="Pc16g02250"
FT                   /product="Putative uncharacterized protein Pc16g02250 "
FT                   /protein_id="CAP92895.1"
FT                   /db_xref="UniParc:UPI0001831895"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A8"
FT                   /transl_table=1
FT                   /translation="MNKGKMPIYQGHSSSLSSEPPQLCSNPLTNLPSQFQPSVYKFTSG
FT                   QYFAEPAGHRSDYYWVTVYFPKDIDHRDIQDSEVMLYVKDMIVKGRFTIDDQSMHGLGG
FT                   KCLSIPIKRDPDTPLPKSYTPDPTHPDLLLAENLAAYWKDQIAFKKVTLDRRMIFVETR
FT                   RKTRVPAILGGIVTVFLSIFFDTWMDIWPYTYMNIYVHVLDTRELAMRFDIPTLTQFSD
FT                   STRQPIAQSLDNPFVLEI"
FT   CDS_pept        join(521064..521205,521248..521552)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977311"
FT                   /orf_name="Pc16g02260"
FT                   /product="Putative uncharacterized protein Pc16g02260 "
FT                   /protein_id="CAP92896.1"
FT                   /db_xref="UniParc:UPI0001831896"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A9"
FT                   /transl_table=1
FT                   /translation="MPFFQASVFQSTQPDHDRRFHFKDPHNSQPGWVWGTVALPDTIGV
FT                   ATAGLVSWGDRATHGLGNYCISFPIKVETPEQNLERLTDQVQDAAMWWLRLVRDKSVSI
FT                   DKHMLFQARQPPPDRDDQLLDAPLHWERPKYTVPNPWSAVTVLQ"
FT   CDS_pept        join(complement(522919..523762),complement(522760..522863),
FT                   complement(522369..522702),complement(522128..522302),
FT                   complement(521795..522065))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208687" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946638"
FT                   /orf_name="Pc16g02270"
FT                   /product="Pc16g02270 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92897.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniParc:UPI000183195D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B0"
FT                   /transl_table=1
FT                   /translation="MSNVVWAVWRAPCPGLRTSVLPVPFRAASRDLRITPWRMYSTSRQ
FT                   SMLPIPNLLSQLLARPSRPTPTPISPQRFNPVSTPRRFKRTSAASQKPKPKSDPSEVHP
FT                   RQKPFSDAEIKAIFGPAKFNAKLGNRILAVLHGHRLSGTLDADLPVDIARAVTKQQVDA
FT                   ALEWLRDEYPLDEDAAIFARIEREDRAAEEKLVRRAEKLGLYKPQSGSYDAELGEEGSP
FT                   YGKSVLKEARERNEKRLLAEQERKRQEWLDGEKEEQERLKREFGKNTSLQEYQEAALTE
FT                   ARPRADPIERPYLAWVQKHHIAATNDSPESMNITNSQRLLAPLLFSIVVLALCYTFAQK
FT                   YEFPARKDRIMPDVPPAVATVGAIVAANVAVTLLWKYIPPAWKLLNRYFVIVPFYPSSL
FT                   GMIGSTFSHQTWRHLGTNMMVLGLMGTRVHDEIGRGNFLAIYFASGVMGSVFSLTRSVI
FT                   LGRLGMTSLGASAATSGIVAAWCMSHFNDKLTMWILPQGLQDQIWTYGWVFLTCLVGTE
FT                   VFSLIAPAFLFRAWPLSRLTKMDHAAHLGGYATGAGCGYTLMQKRKERERKARQSRWF"
FT   CDS_pept        524168..524629
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208676" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946639"
FT                   /orf_name="Pc16g02280"
FT                   /product="Pc16g02280 protein"
FT                   /protein_id="CAP92898.1"
FT                   /db_xref="UniParc:UPI000183195E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B1"
FT                   /transl_table=1
FT                   /translation="MSTESLPITPGAFAEAIKELPIAVLYSKVSELTNSIAHLHRSNAE
FT                   LRAFLAESNDSEEDKKELEGYITENEGVAVSMNERILLLKTEVENRGQPWIELDELKIN
FT                   NDQEASPVTNGNETETETETETGVRPGSGAEAGAGQESHDREDGDGVYL"
FT   CDS_pept        join(complement(526548..526570),complement(526018..526286),
FT                   complement(525846..525960),complement(525278..525794))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208665" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128413"
FT                   /orf_name="Pc16g02290"
FT                   /product="Pc16g02290 protein"
FT                   /protein_id="CAP92899.1"
FT                   /db_xref="InterPro:IPR005301"
FT                   /db_xref="UniParc:UPI000183195F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B2"
FT                   /transl_table=1
FT                   /translation="MATFFQSVRQGFGRGGNNKSNNPPKSPAQTSAPQHQATMSNSPSI
FT                   SSSLSVENQANDPEGPKYFFQEKYAPLNVRGNFLTLCACPKNVELGEWLAHQIVEQYRL
FT                   LHGMLQVIQEVNTVTGLPICNENTCPTMSAGRLTYTWLVDGRAAKISAPKFINRVEKWI
FT                   VSKIHDPVMFPTEKVNGTPETSAIKEANGASATPSDPANPDEWIGKSSGFPPTFYKDCQ
FT                   GIMKQMFRCYAHLYHAHWLNPFWHINKHDVLNMCFVHFVTVSKYYGLVSDKEMEPMQPL
FT                   IELFIKQQRVPPEALNGGHWAQQATT"
FT   CDS_pept        join(526920..527068,527120..527285,527339..528331)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208654" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128414"
FT                   /orf_name="Pc16g02300"
FT                   /product="Pc16g02300 protein"
FT                   /protein_id="CAP92900.1"
FT                   /db_xref="InterPro:IPR007149"
FT                   /db_xref="UniParc:UPI0001831960"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B3"
FT                   /transl_table=1
FT                   /translation="MSSDEEGVRRPSNGNESPAHSNAHDSGADQMDEGDDLFGSDGEGG
FT                   LDDIEPHRTLDDEQLDSGDDENRYDRREDRMEDVAEEQQEVNVADQDLARAPVPLTNDG
FT                   EVYTMRVPDFLSIEGEEFNPETYVPPPYQTAATSLCWRKDPADESLLQSNARIIKWEDG
FT                   SITLQLASAPLEQYRIASKPLAPLTKSGDYDHKLDSHVYLAAGLETAQVFRLTSHITQG
FT                   LTVLPTTLETDDAVQRLQEQLAAAARGSKQTAAGTAPRYELTEDPELAGKRAEMMEKEA
FT                   IKAERRRQQLADREADRGRRHGATRPGPSGLSVGGLEDAGLLTTRPRAKPRRQNRRGEI
FT                   YTDDEEEDYSRGARNREDEYDEDDGFLVGSDEEVEEEAEDEEEELEDEDMDAEGEDDVE
FT                   AAPAKAGRSKPEPQVRDGTPPARKKNRYVVDDEDDE"
FT   CDS_pept        join(complement(529941..530034),complement(528653..529884))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128415"
FT                   /orf_name="Pc16g02310"
FT                   /product="Pc16g02310 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92901.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831961"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B4"
FT                   /transl_table=1
FT                   /translation="MSLLHEYEGGLPLPITNSLSEPKRHAACDECRKRKLKCSGELTGC
FT                   SRCTKQSLSCNYSIQKQMGRPPKKRARTDNEGVDFPALSEAEIWPSPEDSQQSSLGMDT
FT                   VTLTDADHLCPQIFWRPGTNMNLPQSQPSDLSQPADLLSGYEDHNHAWRPDRLKQPNLP
FT                   VPASSSPWPDFSAISEATAMPMPFPNSPPFPSMHSLPLSPATSISSDSTTSGCPCLSYL
FT                   YLSLSHMTSISSFPVNSHTLCSLYIAARTARDVIRCQVCPKVFSTGLQNIMFIGTLLTV
FT                   TADAWLRVLRADAVELGTQSALPQYVSEALQSPDPAQYWKSWLHQVVRRAVIGGAVEPS
FT                   AMIACSEQPDLLSMIIEIENRQRRFHEPGKHPLGECNPIFMPDSAQSQDEDDHGEKKFL
FT                   CLRVVGSARDVIARFNFDPSEYPEGVEPVTATNKAHAGAYHA"
FT   CDS_pept        530250..532556
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000029368" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128416"
FT                   /orf_name="Pc16g02320"
FT                   /product="Pc16g02320 protein"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92902.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR012953"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001831962"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B5"
FT                   /transl_table=1
FT                   /translation="MNPKAASKKRKAVTRDVEEEAGVFSGDELSKGNLDGALSDNSKDL
FT                   SDSEDDESDSEVELVDDFSDSEDGEEELDSDEIPSDTEEVKPTAGDPNFRIVKDANGND
FT                   RYLWDEIHPDDNSELSEVDENANTIGDIPLKFYDEYPHIGYDINGKKIMRPAKGEALDA
FT                   LLDSIEIPKGWTGLTDPKTGKPLNLSQEELELLRKVQMNEVPSEGYDPYEPLVEWFSSE
FT                   KEIMPLSAAPEPKRRFVPSKHEQKRVMKLVKAIREGRILPYKAPEEREDKEEELINYDL
FT                   WADEAERPDHVMHIPAPKLPPPGYEESYHPPPEYLPDSKERKAWEQTDPEDREKDFLPN
FT                   DFGSLRKVPGYDNFVQEKFERCLDLYLAPRVRRSKLNIDPESLLPKLPSPEELKPFPTA
FT                   CATVFRGHKGRVRSVNVDPTGIWLATGGDDGTVRVWELLTGRQLWSAKLSDDEAVNTVR
FT                   WRPGKDAVVLAATAGDDIFLAVPPIVDPEIEKASLDLLDAGWGFAASRPAPSASEDGKK
FT                   NAPPTWIRPEAALVDAGVCVVIPLRYVPKTISWHRRGDYFVTVCSGASTPASVAISIHT
FT                   VSKHLTQFPFRRRLKGGGPPQTAHFHPSKPILFVANQRSIRAYDLSRQLLVKILQPGAR
FT                   WISSFDIHPTSSSASGGDNIIVGSYDRRLLWHDLDLSQRPYKTLRYHRKAIRAVKFHPS
FT                   GRYPLFADASDDGSLQIFHGSVTGDMLSNATIVPLKVLKGHKITGELGVLDIDWHPREA
FT                   WAVSAGADGTCRLWM"
FT   CDS_pept        join(complement(535142..535195),complement(534853..535092),
FT                   complement(532896..534785))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000223225" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946640"
FT                   /orf_name="Pc16g02330"
FT                   /product="Pc16g02330 protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAP92903.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI0001831963"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B6"
FT                   /transl_table=1
FT                   /translation="MPARKGGRPTLSQGLDREVYQIVRKIIDDQPENGRIRLSVPAIYD
FT                   TIKKSNSSLNRKPKRLIEDSLERVLEVVKADMGEEDEDSMEGDFEGLEEPAATEPNGMN
FT                   QSVVGSWATTKAKKTESTASTPAPTSSKRRTHGGESASKRRKAEPADRSPPTHVSLADL
FT                   GGLDDVVQELGDLVILPMTRPQVYLSSNVQPPRGVLLHGPPGCGKTLIANAFAAELGVP
FT                   FISISAPSVVSGMSGESEKALREYFEEAKRLAPCLIFIDEIDAITPKRESAQREMEKRI
FT                   VAQLLTCMDEIALEKTDGKPVIVLAATNRPDSLDAALRRGGRFDKEINMTVPSEPVREQ
FT                   ILRALTRKMRLADDIDLKTLAKRTPGFVGADLNDLVSTAGSAAIKRYLAILKSNSGEEM
FT                   EMEIEGEDDISPRVRELRRLINHAKETPIGDEAEVVLVSNADFFTALPKIQPSSKREGF
FT                   ATIPDTTWADIGALGGIRDELVTAIVEPIKNPDIYANVGITAPTGVLLWGPPGCGKTLL
FT                   AKAVANESRANFISVKGPELLNKFVGESERAVRQVFVRARSSVPCVIFFDELDALVPRR
FT                   DDTLSEASARVVNTLLTELDGLGSSRQGIYVIAATNRPDIIDPAMLRPGRLETLLFVNL
FT                   PTPLERVEILQTLVRKLSIEFNEDLRKLAEECEGFSGADLGSLLRRAGYSAIKRRDSIK
FT                   LVDFVAAKSFIRPSVTDLRKYEKLRRDWSGGVV"
FT   CDS_pept        join(535359..535402,535580..535943,536034..536261)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208642" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946641"
FT                   /orf_name="Pc16g02340"
FT                   /product="Pc16g02340 protein"
FT                   /biological_process="protein transport"
FT                   /protein_id="CAP92904.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI0001831964"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B7"
FT                   /transl_table=1
FT                   /translation="MGNSSSSQKISAQDRAILDLKNQRDKLHQYQRRITVLTDRETEIA
FT                   KECLARDDRRRALLALRRKKYQESLLAKTDGQLAQLEQLTGQVEFALVQKDVLFGLQQG
FT                   TKVLQTINKEMGGIEGVERLMGETEDARAYQEEVSQMLAGHLTNQDEDEVEDELEALQR
FT                   ELAGPEILPDDVVLPSPPTADLPVEEPVLESSKRTKAKAETRTALPAT"
FT   CDS_pept        join(complement(537370..537499),complement(537202..537313),
FT                   complement(536626..537046))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208631" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128417"
FT                   /orf_name="Pc16g02350"
FT                   /product="Pc16g02350 protein"
FT                   /protein_id="CAP92905.1"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="UniParc:UPI0001831965"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B8"
FT                   /transl_table=1
FT                   /translation="MSGHHHDHGHCHGEDHDHTNDITPAIQSLLYSQINFDLITTLNET
FT                   TPNSGASIVQKTWAERLNDKPELESDADEQLLMTIPFNGQVNVHSLLLYTAPTNSAPRT
FT                   VKLFKNRDDLDFSTASELHPAQTIEVPRPVPGADVFELPLNRAHWNATTSVTLFFEDNW
FT                   SDGEEDVTKVGYVGFKGQFMKLTREPVNFLYEAAANPQDHVSIPGVSGIGGRIMPGQ"
FT   CDS_pept        join(complement(539808..540032),complement(538084..539742),
FT                   complement(537892..538026))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671375"
FT                   /orf_name="Pc16g02360"
FT                   /product="Pc16g02360 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP92906.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001831966"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B9"
FT                   /transl_table=1
FT                   /translation="MASEQELSTSFIPALYKPAALLPIARHKKNLLYLVEKYPVTIVVG
FT                   QTGSGKTTQLPQYLDQAGWCEDGKIIAVTQPRRVAATTVATRVAEEMRCKVGEEVGYSI
FT                   RFEDLTSPATRIKFLTDGMLLREALVDPLLSRYSVIMVDEAHERSLGTDVLLGTLKKIR
FT                   KKRPELRIIVSSATLQAEDFLRFFAGEEYQPEAEPEDLGGSVGRIISLEGRMYPVDILF
FT                   LDSPAEDYIERAVKTVFDIHTQEPEGDVLLFLTGREEIDTAIQLISERAATLHPKAPSL
FT                   LPLPLYAGLTTEQQMYVFEPTPENTRKVIVSTNIAEASVTIDGIVYVIDSGFAKLRAYN
FT                   PNTGIDTLTAVPISKASATQRAGRAGRTKPGKCFRLYTQQAFEQMPEARVPEIQRSNLA
FT                   PVIMQLKALGIDNIVRFDFLTPPPAELIIRALELLSSLGAVDDYAKLTKPLGMRMAEIA
FT                   LDPMMAKVLLVAPSFNCLSEILTIAAMVNLQGTVWVQHAGDKRSAESHRRKFAVEEGDH
FT                   LTYLNVYQAFVTKGKKDSKWCRDNLLNYRALLRAVSIRGQLKRYLERFGIQVDETLSSR
FT                   HGAADLSKQPEQIRRCLTTGYFAHAAKMQPDGTFKTVSGGLTLHAHPTSLMFNRKADWV
FT                   IFHEIMQTGEKTYIRDVTKIEKSYLLEYAPDYYRVRQ"
FT   CDS_pept        join(540337..540357,540417..540726,540790..541032,
FT                   541087..541353,541406..541800)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208610" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671376"
FT                   /orf_name="Pc16g02370"
FT                   /product="Pc16g02370 protein"
FT                   /protein_id="CAP92907.1"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniParc:UPI0001831967"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7C0"
FT                   /transl_table=1
FT                   /translation="MSEEDKMNTPGRPLGALNSPNSPRAESPTTARPMDFDDEPQETGV
FT                   ITSSPVAPQPAAAEPAPPKPPRPLSPREQSENTLREAFPSIEPGVVKAVLTASNWHVER
FT                   AFNALLGMTDPKAQEEMTPPPKPPRPTQQSTAAQRQLEADEMYARQLSEHYNATGRRAP
FT                   PPGWESDPRYQRPRGSEDSEEREYSFFDDDLPVIRENLRKGFLETQNKVNSWVTNLKKR
FT                   IDGDDLDEEPSQNQRETTHARPRRSGDMGRRSGDRERYDADPQVLSDDFSALELRDGEA
FT                   PPPRPPRPGNSSLKPSVSPSPDRRRVSFQEGPPTEIDNSYDASTPSKRLSSTGSKSSKW
FT                   QPLSTVEPSPVAENDPFSLGDSDDEKEIKTKEQTTSSEGDQLKHATVESVSDEVGSSKG
FT                   PDTKGASKPESK"
FT   CDS_pept        join(complement(542570..542656),complement(542371..542448),
FT                   complement(542192..542260))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217071" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671377"
FT                   /orf_name="Pc16g02380"
FT                   /product="Pc16g02380 protein"
FT                   /protein_id="CAP92908.1"
FT                   /db_xref="InterPro:IPR022214"
FT                   /db_xref="UniParc:UPI0001831968"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7C1"
FT                   /transl_table=1
FT                   /translation="MPPKSQEADDKRQAAREVIDILQEISDLLNTNLDRTELSLCVSLI
FT                   ENGVNPDALATVIKDLRKETGSKRVGNAHAVE"
FT   CDS_pept        543254..544171
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977312"
FT                   /orf_name="Pc16g02390"
FT                   /product="Pc16g02390 protein"
FT                   /protein_id="CAP92909.1"
FT                   /db_xref="UniParc:UPI0001831969"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7C2"
FT                   /transl_table=1
FT                   /translation="MSYEITTHSGGARCFLIPPKKPSAWQQFRDEPCLFLARKLSAWRP
FT                   TNLPKLPENPVTVVCISNTYHERPEIPPGDILIHAGDLTSDGSLAELQITLNWLQAQPH
FT                   PIKIAVAGRADRYLDKMKKGGRRWRHGHRERAYWGDIIYLEHQHLTVTAPNGRQLRIYG
FT                   SPYSPMTVPSLAFQYSDSDNIWDRVPDNMDILITHTPPYTHRDSLRGCLHLLNHIWMDP
FT                   PRLHVFGCAREHHGCEFLYYDALQAAVERIEDVGGGFSNLLMVVKGLVQSFFRPDIKAK
FT                   SVLVNACTNGGLWDPERQPISVVI"
FT   gap             544373..544472
FT                   /estimated_length="unknown"
FT   CDS_pept        544665..545183
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217070" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671378"
FT                   /orf_name="Pc16g02400"
FT                   /product="Pc16g02400 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP92910.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000183196A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H733"
FT                   /transl_table=1
FT                   /translation="MAPQYETGGMGGMPGLTISDIHALKRNEALEILARISRVEKKTFP
FT                   TNEAFPFGEDLWRKKPNTRVLYAIRAKGSQSDLIAYAVYVRQKGIALLHKVCVTEPNRR
FT                   RGVGQEVLSYIQQRLRKEGCQYIQLWVDQAREPARALYLRIGFEEREVIPDYYAPGRTG
FT                   IKMVLDLQA"
FT   CDS_pept        545709..548537
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208599" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977313"
FT                   /orf_name="Pc16g02410"
FT                   /product="Pc16g02410 protein"
FT                   /function="calcium ion binding"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP92911.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniParc:UPI000183196B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H734"
FT                   /transl_table=1
FT                   /translation="MAFFLTIVLVFLSVASAASLSANYPINAQLPPVARVSQPFRFEFA
FT                   QSTFANTDADTKYSLLNAPSWLEVDSSSLALYGTPDSSDSGANEFKLVASNGSEKDSMD
FT                   VTLIVTADQGPTVNKPLVPQLQKSGPVSYPATLFIHPGRQFSIEFDQDTFDNTHPSTIY
FT                   YGTSPNNAPLPPWITFDPAALKFAGNSPAFPGAGPQTFTFQLVASDVAGYSAANVTFEL
FT                   SIGPHILTFNETVQNFNLTRGEEFNSPKFTSLLSMDGSPVSIKELEKVDAELPNWLNLD
FT                   KENISLSGTPPKDAVNQNITISVTDTFHDQAHLMVRLEFLKLFLDTVNGCEAAIGQDFK
FT                   FVFNQSILTDDSVQLEVDLDNDLAWLTYFSDNKTLYGHVPDDMDPKKFTIPLTAYQGST
FT                   EDTMDFVLDVLKASDTHSNPTDPFTDTGSPDHKKAGIIAISVVVPLVVILSLLILFCCW
FT                   RSRKNSPTIEEGTSDRKAPPRPVRPDVPNCQPSMTERPSRDDNSDDWMSPISPSSIPKL
FT                   ELGPAWNVASFDKRENPVNFVIPEPIIPPRSPARNSPTRGGFVPRRDTITQEDKPVEAV
FT                   SPSKKQNNRLSYTNSPVRRRTTNRSRREPLKPIQPRAMKRESLQSSKSKRYSKRSSGIS
FT                   SIASGLPVRFSGAGHGAGGFGPPGHGVVHTSWQNARASMINDESSLTNMAPMFSRPPAA
FT                   GRMRHSMASSIPENYRRMTLRTVEPDDSIISESDSLEAFVHSRAKHRNSSNPLFSAQIS
FT                   RRTSSGMRALDRNRSMRSRADTVSVSTFSDEYRQSMQDRPLSTAISASEYGDDNTTNNN
FT                   SRFSQYQSQTGLFPLAEGSAYGQSQLSIAQDYRGAISPLPQCWSENSMGSARQLEGQGN
FT                   SQPQKVNDENAMPPSSSMISDLDEHLSRKVNPNKGANHEWWLSSPVEPPRPLKNSDNRS
FT                   LPVASSGELAFV"
FT   sig_peptide     545709..545759
FT                   /db_xref="UniProtKB/TrEMBL:B6H734 "
FT   mat_peptide     545760..548534
FT                   /db_xref="UniProtKB/TrEMBL:B6H734 "
FT   CDS_pept        join(550223..550258,550608..550926,550983..551056,
FT                   551123..551207,551276..551482,551538..551824,5
FT                   51894..552205)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233896" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946642"
FT                   /orf_name="Pc16g02420"
FT                   /product="Pc16g02420 protein"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="CAP92912.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI0001831A3D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H735"
FT                   /transl_table=1
FT                   /translation="MGQTLSEPVVEKTSSEGGDDCCVYGVSAMQGWRISMEDAHATVLD
FT                   LQAKYTGTDDKPTDPEHRLAFFGVYDGHGGDKVALFTGENLHKIVSRQDAFAKGDIEQA
FT                   LKDGFLATDRAILEDPRYEEEVSGCTASTAIISQKKIWVANAGDSRSVLGVKGRAKPLS
FT                   FDHKPQNEGEKARITAAGGFVDFGRVNGNLALSRAIGDFEFKKSPELSPEQQIVTAYPD
FT                   VTVHELTNDDEFLVIACDGIWDCQSSQAVVEFVRRGIAAKQPLAQICENMMDNCLASNS
FT                   ETGGVGCDNMTMSVIGLLQGKTKEEWYNQIAERVANGDGPCAPPEYGKSPEEPESFEDT
FT                   PDEYDLEMERSRGFSVRSGRIILLGDGTEVITDQNDEELFDQTEEDQDLTNQVQHESGT
FT                   RNDRQATPGPQGKQENGSGTSAQISESPASTDAEKEKPAS"
FT   CDS_pept        join(553385..553893,553997..554347,554400..554808,
FT                   554887..555024)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208588" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128418"
FT                   /orf_name="Pc16g02430"
FT                   /product="Pc16g02430 protein"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAP92913.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0001831A3E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H736"
FT                   /transl_table=1
FT                   /translation="MSPSTSPAGKRKRSASHLPAPVPKNVTADLQPSSRDASGEEGGED
FT                   STGPANANSNSSNGTRHPSKRARKAAAADAASHTEVNGVEPVNKEDPGEPSETTVASSD
FT                   IEGGPRSRPGLHIDLPEDDEPVTEEQMAPPVFGRLQDPVGYHTNPPPTGRPVRVYADGV
FT                   FDLFHLGHMRQLEQAKKAFPDTYLIVGVTGDEETHLRKGLTVLSGAERAETIRHCKWVD
FT                   EVIPCCPWIVTPEFLSEHKIDYVAHDDLPYGAAEGDDIYAPIKEQGKFLVTQRTEGVST
FT                   TGIITRVVRDYDQYISRQFKRGASRQELNVSWLKKNELEIKRHVAELRDNIRNNWTMTG
FT                   QELGRELRQIWQNSRPNSPAPSARNSMDWGMRGPLTSPTGGSKSHLSRVGAEHNRADSP
FT                   MGSRRNEDFATGYSLGLIGGVRAWMARSRQSLQEPPSGMHSPTDEELEPEHNNGYEEEV
FT                   RGRTGHVSAK"
FT   CDS_pept        complement(555744..556523)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000179081" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946643"
FT                   /orf_name="Pc16g02440"
FT                   /product="Putative uncharacterized protein Pc16g02440 "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92914.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniParc:UPI0001831A3F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H737"
FT                   /transl_table=1
FT                   /translation="MDIPISPSACLLLGSLPLLALSEWNSTSHTGTAVFKMLSSLAFLS
FT                   SPLLLSTEWTDYRRLITIGLGFSLLGDFFLIPSHSEFHDLNTTPSATSEAKSEGNVSIS
FT                   FQLGIVAFAAAHIAYTIAFLQDSSDTSWMTFAVTFVGTLGAARWLGVIYPPPSFSLRNN
FT                   VLGLAIAPDMKPLVSVYAVIIGTMFAAATSTSPLTVPTEWWHSRALGAAMFVVSDLFVA
FT                   KNAFGKSSAKGRGWLRIFVGYALYFWAQMVIAGTVRA"
FT   mat_peptide     complement(555747..556457)
FT                   /db_xref="UniProtKB/TrEMBL:B6H737 "
FT   sig_peptide     complement(556458..556523)
FT                   /db_xref="UniProtKB/TrEMBL:B6H737 "
FT   CDS_pept        complement(556738..557913)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217069" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128419"
FT                   /orf_name="Pc16g02450"
FT                   /product="Pc16g02450 protein"
FT                   /protein_id="CAP92915.1"
FT                   /db_xref="UniParc:UPI0001831A40"
FT                   /db_xref="UniProtKB/TrEMBL:B6H738"
FT                   /transl_table=1
FT                   /translation="MRHFDTWVLRDPYSIWHYYPTGHRWRDTVRDLIQSRAICSPNHID
FT                   WNASSPSSSSSSSSTSNQFQFQFQPQQSPLLRLPPELRQIIWSYVLTNSSTPNTQTPQT
FT                   IHLVQLKGKIRHVRCPEPHPNPNDSQSTQPSQTHPNPSLTQNRHCCPTTPARWRIYDGR
FT                   VPGHSDRLLYPHTHSHLPSTLSNSNSALLRVCRSIYYEAETILYKASHFDVDDLYTFIA
FT                   FATSLSPAARNAIARLTVQWMPIWVPMAGLDHKGSIYAHTHSDELWVRFWDIVASLEGL
FT                   RDLGLSLDLGRFTSVVGNTGEAVVSGQRIPFGIMEEWVKPILRVRGLEGFDLAVTARCD
FT                   LLAKGVVEGELVRDVGLLREALRGILCGPRERKKKMEEREGRKGMRLAITA"
FT   CDS_pept        join(complement(559360..559761),complement(558277..559272))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208577" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946644"
FT                   /orf_name="Pc16g02460"
FT                   /product="Pc16g02460 protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP92916.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniParc:UPI0001831A41"
FT                   /db_xref="UniProtKB/TrEMBL:B6H767"
FT                   /transl_table=1
FT                   /translation="MVSPNLDSASGTGQYQDHPDAPLPIRVEQSESNSRSEQRSSSTQT
FT                   QTYRDDERGYCESDEAESQPALTQSDPIPIEDDDEAIAIAAASRPRHAWQVWWLRNKGM
FT                   GLVLLAQAFAASMNVMTQVLEIHSSMHPFQILFARMSITAVASYLYMYIASTPSPLGTR
FT                   PVRGLLLLRALFGFTGVYGLYYSVQYLPLSEATVITFLSPIMSCYACSLLIPGETFSRK
FT                   QLLAGLISLGGVVLIARPFSKRDPSMTIATPTATTAWVLGLSTSTVDKPPSETDSYHHV
FT                   MATIVAFLGVLGASGAYTSIRMIGRRAHPLVSVTYFSSVTTVISFVAMLTVPSVPFRVP
FT                   NTVVEWMLLTGLGVCGFLLQFLLTAGLSYVPPASVSDGKPTAQGARATSMVYMQMFFAV
FT                   FYDKVVWGSTLSPISWVGSGIILACAVYVAFAQESPVQQGSGSAEYRDVAGYKDATDEE
FT                   RAEERGN"
FT   ncRNA           complement(561068..561168)
FT                   /ncRNA_class="snRNA"
FT                   /gene_name="U6"
FT                   /db_xref="Rfam:RF00026"
FT   ncRNA           complement(561395..561495)
FT                   /ncRNA_class="snRNA"
FT                   /gene_name="U6"
FT                   /db_xref="Rfam:RF00026"
FT   CDS_pept        join(complement(564322..564452),complement(563753..564275),
FT                   complement(562201..563694))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208576" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946645"
FT                   /orf_name="Pc16g02470"
FT                   /product="Pc16g02470 protein"
FT                   /protein_id="CAP92917.1"
FT                   /db_xref="InterPro:IPR010678"
FT                   /db_xref="UniParc:UPI0001831A42"
FT                   /db_xref="UniProtKB/TrEMBL:B6H768"
FT                   /transl_table=1
FT                   /translation="MPAPRGSGSFRGARGRGGRGRGRGRGRGGQGRNSFATSRLNESDT
FT                   RSDDSSGGEDDASEQSQEELDDDTLMDEGSSSDEEDENTERPYNELLQLLQPNESSGPA
FT                   RKKRKIATDPNAEVQIAQPAEEPEQGDDDLEAQAPSDDEEEEADEDEDPTAPFEKHFDL
FT                   RDSADLTKQIEPIQSNKWASVKKEVDGLRLVHTVPDTGANSAPILPPLKSTTNIKLKQK
FT                   LKSRAAEILPKITGQAQIIAPYVFNYQDVLYGARTTSNANEIRDIMALHSVNHLLKTRD
FT                   QVLKNNARLAKDPDTDIECRDQGFTRPKVLYILPTRQACVKVLDAITRIYQPEQQENKK
FT                   RFTDSFSAPNDDSWEHKTEDFRELFGGNDDDMFRLGLKFTRKTVKYFAQFYSSDIILAS
FT                   PLGLRTIMDQSDAKKRDHDFLSSIELVVVDHADALLMQNWDHVDYIFQHLNLQPKQAHG
FT                   CDFGRVRNWYLDNQARHVRQTVVVSSYITPEINALFSSQMQNASGRLKATPTYAGAITE
FT                   LPLAVPVKQTFTRIDSTSPIKDPDARFKHFTTTILSTLVKNITHGRGKGGAGTLIFIPS
FT                   YLDFVRVRNHFATSTQTTNVSFGAISEYTESKEANRARSHFMSGRHSVLLYTERAHHFR
FT                   RYQVRGVKRVVMYGLPDNAMFYGEIVGFLGLDPAALIEAAEGGVRALFSKWDALKLERV
FT                   VGTSRTGNMLREKGGDTFTFV"
FT   CDS_pept        join(564676..564777,564828..565540,565596..565800)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000241154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977314"
FT                   /orf_name="Pc16g02480"
FT                   /product="Pc16g02480 protein"
FT                   /protein_id="CAP92918.1"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI0001831A43"
FT                   /db_xref="UniProtKB/TrEMBL:B6H769"
FT                   /transl_table=1
FT                   /translation="MAEDSFLHLARPLGPVSVGTAPTTAPLNVVIQPQAIFSVLDHSLR
FT                   RNADQERVIGTLLGTRSEDGSEVEVRSAFAVGHSEAEDQVEVDMEYHKQMLALHLKANP
FT                   REVLVGWYATASELNTFSALIQNFYSGQGDGTWPHPAVHLTVSTEAGKDLETRAYISAP
FT                   VGVTAERAADSAAFIPVPYELRYGEADKSGLESIANAKDAEDRSTSVTSDIESLERAIE
FT                   EVLSMVDRVSRYVESVIDEETPASTAMGQFLLNALALAPKVEPADIERDFNNHIQDVLV
FT                   VSYLANTVRTQMELSTRLATAQLTLGGGGEGPATEGQRNQRGKGQGRPRQDRAEEARA"
FT   CDS_pept        join(complement(568120..568144),complement(566955..567817))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234765" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128420"
FT                   /orf_name="Pc16g02490"
FT                   /product="Pc16g02490 protein"
FT                   /protein_id="CAP92919.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001831A44"
FT                   /db_xref="UniProtKB/TrEMBL:B6H770"
FT                   /transl_table=1
FT                   /translation="MVDLLGDKACSWSPARQHACRYQSHVNLFYGVSNRGVWSLGSNLI
FT                   LKERSTEPPNFEVPNIRFLASKTSIPIPRIVEEWQEDDGACFLLTRRIRGQPLSELWPT
FT                   MTSADKERVAKQTAEYLMIQLHELRSNRMESIGGQPIYSAFLFPHTYGIGHGPFSSDDE
FT                   LWAEMSLTLNDQVPEQVRSKLRQRMPTAAPYTFTHGDLTNVNIMVENGNLAGILDWESS
FT                   AFFPVWWEFTCAGIGLGQDDKEWKDLLRSHLPDHTEARNFWLDFFAIHNYPNLNERGLA
FT                   LLKECDLDLPEKET"
FT   CDS_pept        join(568592..568672,568821..569007,569100..569218)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671379"
FT                   /orf_name="Pc16g02500"
FT                   /product="Putative uncharacterized protein Pc16g02500 "
FT                   /protein_id="CAP92920.1"
FT                   /db_xref="UniParc:UPI0001831A45"
FT                   /db_xref="UniProtKB/TrEMBL:B6H771"
FT                   /transl_table=1
FT                   /translation="MPRLWLLYATHDLLRDRALRYVDYLVSVVPTNSGTTSCDVLLPVV
FT                   DHGTIFVEIRDETTSGYTRQLAVQHRTSGTASNLQVVVLLLVFKDYVNQKKPLKRHKKI
FT                   IREDYLRPPDYDRISGRLFLSIVK"
FT   CDS_pept        join(complement(569965..570025),complement(569394..569890))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208555" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946646"
FT                   /orf_name="Pc16g02510"
FT                   /product="Pc16g02510 protein"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription from RNA polymerase II
FT                   promoter"
FT                   /protein_id="CAP92921.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0006366"
FT                   /db_xref="InterPro:IPR003195"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0001831A46"
FT                   /db_xref="UniProtKB/TrEMBL:B6H772"
FT                   /transl_table=1
FT                   /translation="MAEPRARMARHKGQMNFQNELRLLLLAYGDPSPHPSFPNEPLPET
FT                   VRVLDEIVTDFVLELSHGAAQVAHHARRQKIKVEDFRFALRRDPNKLGRVQELLRMERE
FT                   LKEARKAFDQNDDQVAKEAGKKGAAAAAAAAAAGEDPVAAEAAATATVTKKSKGKGKRG
FT                   AAIRRGSDATEESVSKKRKTIG"
FT   CDS_pept        join(570692..570733,570822..570931,571004..571178)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946647"
FT                   /orf_name="Pc16g02520"
FT                   /product="Pc16g02520 protein"
FT                   /protein_id="CAP92922.1"
FT                   /db_xref="InterPro:IPR009653"
FT                   /db_xref="UniParc:UPI0001831A47"
FT                   /db_xref="UniProtKB/TrEMBL:B6H773"
FT                   /transl_table=1
FT                   /translation="MVSSCTCQDLWHCCSALFNFQSLLLVILLIICTSSYAHSIMPGIM
FT                   DRNQNGIFGIFWKCARVGERLSPYVSICCVVMAVSSLFHKPRYMKKDTDIACRSQSSSV
FT                   VNLA"
FT   sig_peptide     join(570692..570733,570822..570890)
FT                   /db_xref="UniProtKB/TrEMBL:B6H773 "
FT   mat_peptide     join(570891..570931,571004..571175)
FT                   /db_xref="UniProtKB/TrEMBL:B6H773 "
FT   CDS_pept        complement(571478..573880)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208543" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946648"
FT                   /orf_name="Pc16g02530"
FT                   /product="Pc16g02530 protein"
FT                   /protein_id="CAP92923.1"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI0001831A48"
FT                   /db_xref="UniProtKB/TrEMBL:B6H739"
FT                   /transl_table=1
FT                   /translation="MSSCPHQLVRSRLNGLLSPQCRSAGRWYRESGTANVGHRVRLSTY
FT                   NAPAILEPGVTHDTPDPVSYQHNRGSTSSSHPPTSEQSDQVANDRYGMGHGQTKPPTQS
FT                   RKSSQTPIITNDKMKKVAYVRQADPKLVAMAAERVNREILNKGRHLTDRGLYLSLAMRM
FT                   NSLYTRDLGLRQWKEAYGAIHKAKTYGREVLHKAALPKLREDGEQLLALLLNDCQGKFR
FT                   EAWLAMNRATRAWAWQRLAGWLLQNNPAMALEFLLVTTEPRDKPDFTMVVDCLAYLEKF
FT                   HYEELRDWTKGVHTFESVVATCLDPKDWPIISPPQKGIRFYIRRAGFLGVYESFRLMNE
FT                   RGITMEAQTALCYMYRFTQLNDVEYALRALEFIPKINDPGFSMDSEGVLRHCCKLLTLD
FT                   TVEDKAGGRNFRILPRLLKMGVQPDRDMMNIVLANAYKTGDPQLGADMLQFMKNHHHDF
FT                   DSYTYLTLLTDAVSRGDRGRVDELVREVEMQEDIRNNPYIFSKIFHAHFTFTAKHIDPE
FT                   SDPAGVFYSMLDMYNKIHDITPLKELLLLPPHYTAPPTQGLEVKTPPSPVSLFLMIATF
FT                   FRCRNRISQVHHMYDRFRELVQQGHPSIAPLVETDHVYNEFLIAFRKSSRGLRSSIRLV
FT                   EDMLDASALPKETTAGKPLKHVSPTPRTWTILLSAFNYSRQPDAAEKVKEMMAKHDVEY
FT                   NQVTWNTIINGYANAQDIPETANAIKKMEKDGFAIDHYTMKSLRYLRDPERLWVAIEEM
FT                   DEGLDLDGTHKLLTLEPASDVHTDQKEQDELIDNGLEKLESKLKPKM"
FT   CDS_pept        574183..574785
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208532" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977315"
FT                   /orf_name="Pc16g02540"
FT                   /product="Pc16g02540 protein"
FT                   /protein_id="CAP92924.1"
FT                   /db_xref="InterPro:IPR013169"
FT                   /db_xref="UniParc:UPI0001831A49"
FT                   /db_xref="UniProtKB/TrEMBL:B6H740"
FT                   /transl_table=1
FT                   /translation="MSSSHANLDAASTDRKARLAKLAALKRKQPEQDTNEAGAVDRELP
FT                   DADTTPDVTAKYLSGRNYDPETRGPKLGFEQGPQEGQVTLEAQAAEIARATAEQSKEDT
FT                   GADEPLDLFKLQPKKPNWDLKRDLDEKLKILNVRTENAIARIVRQRVEDAKRAAKARGP
FT                   KSNGDEEGEEVGMEGETLVEGIHMREREEEKSDEETI"
FT   CDS_pept        join(complement(576095..576189),complement(575911..576069),
FT                   complement(575191..575839))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208521" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977316"
FT                   /orf_name="Pc16g02550"
FT                   /product="Pc16g02550 protein"
FT                   /protein_id="CAP92925.1"
FT                   /db_xref="UniParc:UPI0001831A4A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H741"
FT                   /transl_table=1
FT                   /translation="MNRYRNAPRLGGSNSNKATATTLCQKCLGRDILLTNSDPRHYSFD
FT                   CKASAQERPYIPRPSRTQQLLNPELMPKLSSENPNELLRKEGVADELLATREEERGRKR
FT                   DLDDMTDRNAQSPGRARSLSVETISTNRSYSSSPRRNKRGAADRGRRDDSSAPPAKSRK
FT                   RRYSDSTEGSSGSVHSGPKDRSPSRERTRTDDRNTRRRRRESSPEERGRHRRAGRHSER
FT                   RDRRSKSLDKDRVEESRATAQDVPKDRSYRDRASPPRQSQHERSRPDPIMQKNQPPRER
FT                   SLSPFSKRLALTQAMNNGR"
FT   CDS_pept        join(576968..577018,577074..579485)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208510" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671380"
FT                   /orf_name="Pc16g02560"
FT                   /product="Pc16g02560 protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP92926.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="UniParc:UPI0001831A4B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H742"
FT                   /transl_table=1
FT                   /translation="MASKSPPGGDSPLSFAKIAAMPAPLKPHSSSVSDENEICQPTEQP
FT                   PFSEANGSGAALPSQHNLDKTPEASSVDLAVDDLGRGVQDIGLTLKKHSDDPSSLAGGQ
FT                   DNGLLKRENSFEDDRTHLSTSSTKMTNFDSKSLASVTTFAMDEKDSVRPDDSASVQAID
FT                   EEESLSGLASGAPNSVAGSEAGSRAFRDHYRDGIPTRPRGILPVPRLFDGTQPANGTIP
FT                   PDSVANNFVIPANPNGIEDGQILHGFPLEPDEKLLEAMKSPKDRLLILQLEEKIRYFIK
FT                   DCNEQSLELPPSNAFGRLLAHKLGDYYHLTHFVDNNVTSVRLHRTPFCRLPTPLSDVHA
FT                   ACNSTPPPVVPAMKIMRRNDGGQFEGSIGGSSNPSKANSEDGDSGPDGERHGSSSGATP
FT                   AKDRMALTREEREAKYHEVRERIFRDFPDSAKSDPASGDSNPNMSRSSSASGRKKNPRQ
FT                   RTPHDDSFEVRSQFNAYYPGMQYGNGTAQYNAPVNDGSYPNQVPYLVGPGVPPPSGGYM
FT                   PSGQNGAIYPGQLNMNMNGVSQYPTMSPQVASNGSWQGGNMPQQSPYSGYASMSQQGMM
FT                   NQPSSNASSPAMNNYAVPNVAPYQQTPNWSSPPFPTNFQQSPHQRNGPVHWPNYPQQPM
FT                   TSSMPPNMGPNMPSNMGAYPYAQYPGQHMNPGLQHSAGSHAAMQAGYARSHFNPQTRSF
FT                   IPGGAPLGRHPNKSQHTMQPYGNMQSGAQPQWNGYPEPIPNRTMDSTPAMNSNRVPTGP
FT                   RDSIAKWGTPAHLPPKPPPSEVPSDFDLKNRPVPASVPAPTYSSNGIPAVSNGPLVVSG
FT                   GTTVSKPN"
FT   ncRNA           580122..580276
FT                   /ncRNA_class="snRNA"
FT                   /gene_name="U4"
FT                   /db_xref="Rfam:RF00015"
FT   CDS_pept        join(complement(582242..582310),complement(582063..582148),
FT                   complement(581956..581969),complement(581572..581756),
FT                   complement(581412..581482),complement(581210..581338),
FT                   complement(581045..581105))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946649"
FT                   /orf_name="Pc16g02570"
FT                   /product="Putative uncharacterized protein Pc16g02570 "
FT                   /protein_id="CAP92927.1"
FT                   /db_xref="UniParc:UPI0001831A4C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H743"
FT                   /transl_table=1
FT                   /translation="METFMSMVCHVIVNLVDTHRLMRGVQQYDRENETYKVHAKDAGRR
FT                   TECAWHWALFQGAGSQTRSTMVYWAMNDGNCDLSEDRRVDGYDTDPETTPFAIEDENLL
FT                   PMLSIHSQPTFQLSNMFEHAAFDLARTFAGETPLGRGREQVSNSPGELRVDETIRPGRD
FT                   DTKREPCAAYTMGRNRLSQTSRCNVGGHDLNICGRKLVAKP"
FT   CDS_pept        complement(583235..583750)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671381"
FT                   /orf_name="Pc16g02580"
FT                   /product="Putative uncharacterized protein Pc16g02580 "
FT                   /protein_id="CAP92928.1"
FT                   /db_xref="UniParc:UPI0001831A4D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H744"
FT                   /transl_table=1
FT                   /translation="MSLETHNPLRQNAPSPPYPDTYKEVAASYPPRQTIEHSVSGESTL
FT                   QVSDRDCTLEFSDRDCNMEVNQYPDHKYTDKQAEAGAGLGAGAADRNQADASGPQSAAA
FT                   TEGKQDLESQSVTGTVMRHKSRRREWIIFGSAMVAVVLLVVIIVPSVIFGIRQSRPQYS
FT                   PPKNPYIS"
FT   CDS_pept        join(complement(585602..585817),complement(584998..585423))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000019780" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946650"
FT                   /orf_name="Pc16g02590"
FT                   /product="Pc16g02590 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP92929.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="UniParc:UPI0001831B0E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H745"
FT                   /transl_table=1
FT                   /translation="MAGGGSRYRHLSRDSAHRQAMLRNLVTSLFKHETITTTWPKAKEA
FT                   QRLAEKLITLGKKNTEASRRRALEIFYTPHEMLPKLFGPLRERYADRPGGYTRVLRVEP
FT                   REKNEYFSAKKGDKNAIREPKPQVKAPTAILELVDGPKDMRFAMTARTVAREREQGRDL
FT                   VHSLTRLNVKKVTQFRKDGVEVLERAISKLSLAKKQNDKLAKEGEVESKE"
FT   CDS_pept        complement(586960..587748)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208488" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128421"
FT                   /orf_name="Pc16g02600"
FT                   /product="Pc16g02600 protein"
FT                   /protein_id="CAP92930.1"
FT                   /db_xref="UniParc:UPI0001831B0F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H746"
FT                   /transl_table=1
FT                   /translation="MDLSRKPTNPQRLPPPALFQGPPSHNASNISLPVPPAASTLATAS
FT                   GSQPPPLHRNRSPRGAEGETPEKSSLLSPFVSRRPSKNDVDGADAIWQEMQSALSEVEL
FT                   SAVTSENVFGAKHSEALEDLRMKQLKLAQAWARSEADDEVVDPGHSGADEASGKPSSAR
FT                   RGTEESKAQYDTATEISAGRGSVSHRTLDGETENDIHLARKRREANDRYFDRVNQGVLD
FT                   VVAKLEEVAQAMRAVERESKDIWSDSESVTTTAPSSTQTS"
FT   CDS_pept        join(588253..588511,588642..588820)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000040064" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946651"
FT                   /orf_name="Pc16g02610"
FT                   /product="Pc16g02610 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAP92931.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI0001831B10"
FT                   /db_xref="UniProtKB/TrEMBL:B6H747"
FT                   /transl_table=1
FT                   /translation="MGKGQPRGLNAARKLQSHRKDQRWADDHFKKRLLGTAYKSSPFGG
FT                   ASHAKGIVLEKVGVEAKQPNSAIRKCVKVQLIKNGKKVAAFVPNDGCLNFIDENDEVLL
FT                   AGFGRKGKAKGDIPGVRFKVVKVSGVGLAALWKEKKEKPRS"
FT   CDS_pept        join(complement(591374..591471),complement(590999..591294),
FT                   complement(590108..590945),complement(589966..590038))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208487" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946652"
FT                   /orf_name="Pc16g02620"
FT                   /product="Pc16g02620 protein"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAP92932.1"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="UniParc:UPI0001831B11"
FT                   /db_xref="UniProtKB/TrEMBL:B6H748"
FT                   /transl_table=1
FT                   /translation="MPSSSLALTPGLGSFLKCLKTNPIDTSIETLISLLKRRQIRHSRS
FT                   CATATAYLLRSVISACRTTDSAKLIERVQSVGRRLMAAQPREMVVGNIVRRVLGLIRDE
FT                   AEDDRDAEFALSDIGSESQPQTPRAYDDASLPLDRDSPSFRAEDRSSRPPLTSMFSLLS
FT                   HPEPEISLPSTPGSSSPSGRFTGHGPSKDVRAEVLEGIGEIIDELGQVDDQIAAYALDH
FT                   IHSNEIILTHTSSTTVQKFLLKAAAKRKFTVIHAESYPNNHEATHATVSGSAVSDDDNL
FT                   GLEAFQKPLIEHGITVILIPDSAVFALMSRVNKVILGTHSVLANGGLVAAAGTRVIARA
FT                   AKVHQTPVVVVSGVYKLSPVYPFDFDSLIEYGDPSKVLPYEEGDLVDLVDVQNPIYDYV
FT                   PAELVDLYITNLGGHAPSYLYRIVSDHYRKEDISF"
FT   mat_peptide     join(complement(591374..591408),complement(590999..591294),
FT                   complement(590108..590945),complement(589969..590038))
FT                   /db_xref="UniProtKB/TrEMBL:B6H748 "
FT   sig_peptide     complement(591409..591471)
FT                   /db_xref="UniProtKB/TrEMBL:B6H748 "
FT   CDS_pept        join(592049..593453,593506..593648)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208466" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824080"
FT                   /orf_name="Pc16g02630"
FT                   /product="Pc16g02630 protein"
FT                   /function="phosphatase activity"
FT                   /protein_id="CAP92933.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001831B12"
FT                   /db_xref="UniProtKB/TrEMBL:B6H749"
FT                   /transl_table=1
FT                   /translation="MNSLNILSSRVIGQSSSSSRHRSQSQGDGKRAPLPSDFSKLRSYS
FT                   EDNFRSLDPTEKSYNDGLPVGEDREEDAPYDLDEKTPLLHEAHKNGTLTARSTWRLITQ
FT                   RFFDAITETIKFILSTIAAPGVYLAQCFQADDGHYSLLAPVRKLRRSSADPTIRSAKGA
FT                   TRVEGRRRSGSTRKLRPQGSHESIVSTTSESDTDRRHVKNLSSGRNRPIKTKGHDPDPI
FT                   PEGEEHEHTPRRSIRIKLHNEESLKRQRQRRSQSADLGHPMPEGVSRVQGAVHLDSLKS
FT                   PTSPNIHRITKYPHSPTPPRPLLPPRVPSYTAPPRNARAPQKTLVLDLDETLIHSLAKG
FT                   GRMSSGHMVEVKLSIPTTTSLSPGGPQTTLGPQHPILYYVHKRPHCDEFLRKVSKWYKL
FT                   VIFTASVQEYADPVIDWLEQERKYFQGRLYRQHCTFRNGAYIKDLSSVEPDLSKVMILD
FT                   NSPMSYIFHEDNAIPIEGWINDPTDNGLLHLVPMLEALQYVTDVRALLALRRGELES"
FT   CDS_pept        join(complement(594838..594873),complement(594767..594792),
FT                   complement(594661..594681),complement(594106..594334),
FT                   complement(593945..594013))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946653"
FT                   /orf_name="Pc16g02640"
FT                   /product="Putative uncharacterized protein Pc16g02640 "
FT                   /protein_id="CAP92934.1"
FT                   /db_xref="UniParc:UPI0001831B13"
FT                   /db_xref="UniProtKB/TrEMBL:B6H750"
FT                   /transl_table=1
FT                   /translation="MAKRLLSPLECQAGSANQITTGGNQQGGVRSAGGKTGLCLASAAV
FT                   PPRQHYEAHCAGMTTSRAGHNAAKIVLPIIHHFLEGWFPRKPLNLLRSAANAAKEKAQR
FT                   LIFSRDNGRKSWHGFVAWDQRG"
FT   CDS_pept        join(595358..595978,596057..596340,596431..596788)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235074" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977317"
FT                   /orf_name="Pc16g02650"
FT                   /product="Pc16g02650 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP92935.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI0001831B14"
FT                   /db_xref="UniProtKB/TrEMBL:B6H751"
FT                   /transl_table=1
FT                   /translation="MSIRRRTAHRRRAGDQRLRFDENGTFQISVFSDLHFAEGTITDLN
FT                   HCLGILTIFKDDEEDHKTTGVMRSVLSSEEAQLVVLNGDLISGEATQSSNSTLYVDRVV
FT                   APLVDLDLPWASTYGNHDSEINLDPEELFRRETEYRNSLTQRDILDPAAGITNYYLPIF
FT                   PHGASNDSIPVFILWFFDSQGGHYPLTENDDGKATKRQNWVDDTVIEWFVKANANLTST
FT                   YGQTIPSLAFVHIPVYAMRAFQETGVSPTTEPGINGERVQQQGYEPDSGYHYQDFPFIN
FT                   ALLNTTGLAATFSGHDHDNDWCFRWDSKLPNLNVTGNGMSMCYGRHTGYGGYGDRARGG
FT                   RQILLDERLLGDDIRTWIRMEDGSISGDVHLNATYGHDHYGLVERSIVNGQNGGLSPPC
FT                   LGVICLWICVFSGLISGFHLW"
FT   CDS_pept        join(598244..598343,598418..598665,598729..599178,
FT                   599249..599818)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977562"
FT                   /orf_name="Pc16g02660"
FT                   /product="Pc16g02660 protein"
FT                   /function="mannan endo-1,6-alpha-mannosidase activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="CAP92936.1"
FT                   /db_xref="GO:0008496"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniParc:UPI0001831B15"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I2"
FT                   /transl_table=1
FT                   /translation="MRLSGTWSISNGLIATLLFSTLTPAIELDLNDEQSIKDAASTSTY
FT                   SMMGWYYGNETGQIPGSFPEKWWEGSALFLALLQYWHFTGDTTYNSLMSEGMQWQSGEE
FT                   GDYMPSNYSSYLGNDDQMFWGLAAMMAAELKFPDVEDGFSWLSLAQGVFNTQTARWDTT
FT                   TCGGGLRWQLFPYQSGYTMKNSVSNGGLFQLAARLARYTDDDKYSKWAEKIWDWSTSSP
FT                   LVNNKTWNVADSTQMANDCADSGNYQWTYNYGAYLMGAVYMYNYTNGDEKWKKPVDGLL
FT                   GKTLKTFFPNGDVIEDVTCEPIKMCNFNEILFKGLTSSWLAFTTLLAPDTAAQIKPKLA
FT                   SSAEAAAKSCTGNNNNTCGITWYQNKWDGTTGMEQEISATNVFLANLINYNTGSFGPVT
FT                   SKTGGNSASDPNAGSENDDEKKMKPITTGDKAGASILTLIFVFGWAGAVAFMMLGG"
FT   sig_peptide     598244..598318
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I2 "
FT   mat_peptide     join(598319..598343,598418..598665,598729..599178,
FT                   599249..599815)
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I2 "
FT   CDS_pept        600584..602140
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234808" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824330"
FT                   /orf_name="Pc16g02670"
FT                   /product="Pc16g02670 protein"
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92937.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831B16"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I3"
FT                   /transl_table=1
FT                   /translation="MVAITWTDRQPDAVHEESYHVDETTALLASGKTKHGGAPTSDTLD
FT                   SSSGPDGDNDGNNDNDDEKKPLPIAQILLLCYARAVEPLAFFSIFPYVSQMVQDNGGLA
FT                   DADVGFYSGLIESMFSLTQAIVMIFWGQAADRFGRKPVLVSSLFGVTVATSLFGLAKTI
FT                   PQMIMFRCLAGVFAGTIVTIRTMVAEHSTPNTQARAFSWFAFSGNLGIFLGPLLGGALA
FT                   DPVRQYPGVFGAVHFFEKYPYALSSLVVASVGATAAVSSACFVEETLKKEPVTVGHDGE
FT                   EAASDVPTQSSDLSTWELLKSPGVGMVLYAYGHIMVLAFAFTAIIPVFWFTPVHLGGYG
FT                   FTPLQISLMMGLNGAAQATWLLLVFPPLQKKIGSNGVIRLCATGYPLFFLCCPLGNVLL
FT                   RIGTDGSVKAFWIILPITLAIGCGVSMSFTAIQLALNDVAPSPKVLGTLNALALTGVSA
FT                   LRAFCPALFTTLFALGARTQLAGGYAIWVLMLIIASGLSVTAKYLPEPEAARKRRSSQP
FT                   R"
FT   CDS_pept        join(603728..603893,603945..604256,604306..604720,
FT                   604792..605259,605316..605475)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947668"
FT                   /orf_name="Pc16g02680"
FT                   /product="Pc16g02680 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP92938.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831B17"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I4"
FT                   /transl_table=1
FT                   /translation="MIQIHGVTSATETPHVSEKDAALAVVSDVAQEIDPVVEKRVLRKI
FT                   DWYLMPAMLIGYGMVYYDKAILGSAALFGMTTDLELSVKDYSTSPPTVDTSRLGWATSI
FT                   FYFGMLAGLYPMTFILQRFNIRTVLGPVVLVWAVICAATAGVSTWQGLYVQRFFLGFIE
FT                   SVIPTGFMTIVSGYYTQEEQALRQAWWFSGTGWFTIIGSALNYGFGQITSGSLKRWQYI
FT                   YILAGALTFLFGLWCCTMPNSPVSAWFLTPEERMVAVERLRKGQTGVRCQKIKLDQIKE
FT                   CLTDVKIYLVAIMMAAAYTINGAISGFGPLIVSTFGYDTLDSILFQFPVGGVCVIFIPL
FT                   CGYISTIVPNVRIPMLIACCLPVIAGCVMIWKSEWGYRPVTPVVGYALTGFFGPVVSLI
FT                   ITTGACNVAGATKKTVMAATVFVAYTVGNIIGPQLVKSDTKAQHYPELWTGMIICYCIT
FT                   IAAAVVLYLVLRRENRIRGQLDLDEVQRDKIAFDDLTDKQNPFFRYAL"
FT   CDS_pept        join(605707..605879,605954..606339,606404..606674,
FT                   606738..607380)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947669"
FT                   /orf_name="Pc16g02690"
FT                   /product="Pc16g02690 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP92939.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831B18"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I5"
FT                   /transl_table=1
FT                   /translation="MEDPKQSPAVALCGDDTIFRDPRYEVTWESGDSENPRTWSVWYRG
FT                   FIVASMSFSTTIVVIYTTMYTSGVEGIQKEFNISSKLVVLLGLTTNLFGLALGSVILSS
FT                   LSEIYGRRPVYLVSVLLFGLLTLPVALANNIEAILISRFFGGFFGGTMIASAPGSVTDV
FT                   TDDQYRALALSCWSLGTMNGPVLGPIIGGFVYQYLGWRWLNWLVLICSGISLCLMFLVK
FT                   ETYSPALLRQKTIKRQKMTGDRRWWCRFDHEETGLQVLKTNLIRPLRMAVLEPICIFWN
FT                   LYVGVVYSVLFLCFVAYPIVFEGARGWTPGLAGLSYCGIGTGTAIAVGLEPLIRKIIAL
FT                   HPHDPSTSRPAPEAAVIAVCIGSVLIPIGEFWFSWTAQPSVHWILPILAGIPFGLGNGL
FT                   VFIYATNYMAGSYTVYAASALAGNSIVRYGLAGVLPLAGEKMYSTLGANWAGTMLALIE
FT                   VILIPIPFIFYKYGHHIRLRSPMIVKRDMDSS"
FT   CDS_pept        join(complement(610206..610312),complement(609238..609955),
FT                   complement(608593..609171),complement(607565..608527))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947670"
FT                   /orf_name="Pc16g02700"
FT                   /product="Pc16g02700 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92940.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831B19"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I6"
FT                   /transl_table=1
FT                   /translation="MRRKHGGHSRIAIETSSNTKEPISNVVVSVSAGKLKQGKSRFIEP
FT                   QDKSDQNTSRSPKLYTRSHQEDVPEDQNGHKGLPDESITPFSGETSLAHNMTVVEDRLE
FT                   QMGVRYARLRSESPNHSFSSQLTPSPQASPKGNRPQQTKSYVYQALDSHKIVPDRVQWD
FT                   RAMKTFCDEVHILVPFLHLPSVWEAYERLWESFLVPSANHYSRGEWRFTFACVLLCLAN
FT                   GTCVESSRVDGQQGQYSAGWSLYRAARDVIGDLLDVFGECTDQILLLQNILLMVIYLFR
FT                   LDSHGPAEKLLALSISHSHHIGLQRRQVVEAMNPFESEMARRLWWCIYLMDRRLAIETG
FT                   RPFLIQDLNVDIGLPRSMSDEWLSKHRGTSHPLQPEDTATGNSPTTVPYLIAMASYSKV
FT                   IGKVWEALYGASTSDSTPSPFLKEYLELLITQSQSDLQPEFSYDPQRPGSYRARGLAWW
FT                   QIKQQLMMRIRWSSLYLLIRKPMLQRKGASSLPVPEAIENEVICMRLAQSIIEDFSNVA
FT                   EDHPKYTFPFLHYLTSATIIALGLIIKQSSFKHTYGELTLEAARSLKKHCRKTWVSGRM
FT                   ARAVWKLNQMAEAIMNPGPRLTENLGSNDQQSSSSRPMSSSNHLSHESPKTCDNALQER
FT                   VQFNLSSSDCLADSTLSASCRRTQIRQAIDRDPPVAGHMDLDESPFMPNDFPFEERHTP
FT                   AHTSGHRPPRHHPHELHSGGVQTAGMEPGLPGDTNDTDPNTGVLSTSLPISGMDMIGSD
FT                   QNAWLPGEMIDGGIEWLQELFVSDLDSHVPSAWNW"
FT   CDS_pept        complement(610770..611799)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(612455..612572,612637..613116)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(613927..614004,614056..614307,614380..614752,
FT                   614802..615376)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076656" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977563"
FT                   /orf_name="Pc16g02730"
FT                   /product="Pc16g02730 protein"
FT                   /protein_id="CAP92943.1"
FT                   /db_xref="InterPro:IPR012901"
FT                   /db_xref="UniParc:UPI0001831B1A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I7"
FT                   /transl_table=1
FT                   /translation="MLREVFSIFTCVAWVGFAIYLSPWMKDISNEVEAYNATTFQYPVP
FT                   LSTHNEEHTRLMQNLQRSNGKWDSNHPRHRLLTALYGYTSYKDKNLAEVNRWRNLYKNV
FT                   SKQQRTLLESTVHYTRKLNTIEHLLDTNNELAKSIVDHGLWFYNISQSELDEFIKESES
FT                   QKRSADKTSVSQGMKHFVRDWADEGHEEREQSFGCILKSLAQTPRTTDRPLRVLLPGAG
FT                   LGRLAHEVDNLGGFDVTMNEWSTYMNLAYRYVSSRSVPNSVPFHPYIDWWSHHATTEDL
FT                   QRSITFPDQVIRPSSVLLIEGDFTTVFAEHTGQYDILVTLFFIDTARNLVTYLETIHRL
FT                   LRPGGRWVNLGPLLYGTAPFVQLSLDEIVALSESIGFEFQETDPSVGDITVPGLQVRGL
FT                   DVAYGRNARGLNKNAYQAQYWEAVKR"
FT   CDS_pept        join(complement(615978..616128),complement(615614..615736),
FT                   complement(615472..615527))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671651"
FT                   /orf_name="Pc16g02740"
FT                   /product="Putative uncharacterized protein Pc16g02740 "
FT                   /protein_id="CAP92944.1"
FT                   /db_xref="UniParc:UPI0001831B1B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I8"
FT                   /transl_table=1
FT                   /translation="MNVPKSRNLFPRVQAGLYTYCSAGIVGFARPRKEKVLVPQRFSNG
FT                   LGAGGGILYYQSMLLGYGPGIGNVQGPTVAPETLTALASQWGLGAKGKTQVDSLLPYPA
FT                   SSLPV"
FT   CDS_pept        join(616170..616279,616344..616773)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169475" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128679"
FT                   /orf_name="Pc16g02750"
FT                   /product="Pc16g02750 protein"
FT                   /protein_id="CAP92945.1"
FT                   /db_xref="UniParc:UPI0001831B1C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I9"
FT                   /transl_table=1
FT                   /translation="MKLSIFLIALMTSVSSAQDPGPSPTASVGCEPHGDHWHCDGPAST
FT                   DVSSVTSTSAAEVSTTASPTMPSPTESVGCEPHGDHWHCDGPAETGTEAEASTTSATAS
FT                   PTMPSPTESVGCEPHGDHWHCDGPAETGSASASASASASASASTSAGDEEGAAGSIGVQ
FT                   VSLLAGLSLVAAGLNL"
FT   sig_peptide     616170..616220
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I9 "
FT   mat_peptide     join(616221..616279,616344..616770)
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I9 "
FT   CDS_pept        join(complement(621464..621483),complement(621373..621395),
FT                   complement(621252..621290),complement(621081..621186),
FT                   complement(620882..621015),complement(619558..620809),
FT                   complement(619208..619501),complement(619018..619155),
FT                   complement(618568..618963),complement(618406..618505))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208451" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947671"
FT                   /orf_name="Pc16g02760"
FT                   /product="Pc16g02760 protein"
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP92946.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI0001831B1D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J0"
FT                   /transl_table=1
FT                   /translation="MASNLPAQPNLRVTIIAADGLYKRDVFRFPDPFAVATVGGEQTHT
FT                   TSVIKKTLNPYWNEPFDLRVNEDSILAIQIFDQKKFKKKDQGFLGVINVRIGDVIDLSM
FT                   GGDEMLTRDLKKSNDNLVVHGKLIINLSSNLTTPHPNQNGLQRQQAQTSTSSGLVPQVA
FT                   APTSQSQAGPSNIDTSPAAASSSSLTQRTSATAPPAGAPPSLNGAPTNPPGPGVPSRTN
FT                   LSSFEDSQGRLPAGYERREDNLGRTYYVDHNTRTTTWSRPSANYNEHAQRSQREANMQL
FT                   ERRAHQSRMLPEDRTGANSPNLPDAQQIPTPPPGPNAGTSLASGAPAGSNAAAISMMAT
FT                   GATTAGTGELPPGWERRVTPEGRPYFVDHNTRTTTWVDPRRQQYIRMYGQGQTTGGANN
FT                   TTIQQQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQGVPQYKRD
FT                   FRRKLIYFRSQPALRIMSGQCHVKVRRNNIFEDSYAEIMRQSASDLKKRLMIKFDGEDG
FT                   LDYGGLSREFFFLLSHEMFNPFYCLFEYSAHDNYTLQINPHSGVNPEHLNYFKFIGRVV
FT                   GLAIFHRRFLDSFFIGAFYKMMLRKKVSLQDMEGVDEDLHRNLAWTLDNDIDGIVELTF
FT                   SVDDEKFGERRTIDLIPGGRDIPVTNENKPQYIELVTEWKIMKRVEEQFDAFMSGFNEL
FT                   IPPDLVNVFDERELELLIGGIADIDVEDWKKHTDYRGYQEQDEVIQNFWKIVRTWDAEQ
FT                   KSRLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKSGDPAALPKSHTCFNRLDLPPYKT
FT                   HDALEHKMSIAVEETLGFGQE"
FT   CDS_pept        join(complement(623085..623165),complement(622685..622941),
FT                   complement(622532..622619),complement(622325..622474))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208465" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977564"
FT                   /orf_name="Pc16g02770"
FT                   /product="Pc16g02770 protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP92947.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001831BED"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J1"
FT                   /transl_table=1
FT                   /translation="MAAEGQEIPEEIKGEKVPAQEDGVDDEEEIEAMKRRVAEMESEAA
FT                   KLREMQADLDQQTESLQENKEDIDARSIFVGNVDYGASPEEIQAHFQSCGSINRVTILL
FT                   DKFSGQPKGYAYVEFAEPSLVAQALVLNESVFRGRNLKVVPKRTNLPGMHRGRGRGFGR
FT                   GRGRGFPRGGGYRGGAPYRGRGRGFSPY"
FT   CDS_pept        join(complement(625021..625077),complement(624481..624894),
FT                   complement(624312..624428))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000293431" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977565"
FT                   /orf_name="Pc16g02780"
FT                   /product="Pc16g02780 protein"
FT                   /protein_id="CAP92948.1"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="UniParc:UPI0001831BEE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J2"
FT                   /transl_table=1
FT                   /translation="MTARLVLVIGDLFIPDRAPFRKLLTPGKIGQTLCLGNLTDRETYD
FT                   FLREVAPDLQMVKGDYDVDSPNLPLSRIVNHGSLRIGFTHGHTIVPPADADALLIAARQ
FT                   MDVDVLLWGGTHRFEAFEMEGRFFINPGSATGAMSSGFWPDGEEPTPSFCLMDIQGDVL
FT                   VLYVYQLKTDANGVENVAVEKVSFRKNHPPAS"
FT   CDS_pept        join(626252..626340,626397..627465)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171814" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947672"
FT                   /orf_name="Pc16g02790"
FT                   /product="Pc16g02790 protein"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="CAP92949.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniParc:UPI0001831BEF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J3"
FT                   /transl_table=1
FT                   /translation="MSAQAPHNTLLIPGPIEFDDAVLQSMSHYAESHVAPGFVKVFGET
FT                   LTLVRKLFQSTNPTAQPFIIAGSGTLGWDLVSANLIERGENALVLNTGYFGDSFGQCLE
FT                   TYGANVTHLKAPIGDRTPLEQVEQALKEKPYKLITLTHVDTSTGVLGDVKGVAQLVRRV
FT                   SPNTLVVVDGVCSVGSEEIAFDEWDLDAVVTASQKAIGCPPGLSIVMTSGRAIQAAQSR
FT                   KTPPGAYYASIANWLPIMQNYENNKPSYFATPPTQLVHALHTTLTQITADVPGRFAIHT
FT                   EVSDKVKAAVAELGLKQVASYPECQAHGMTAMYLPEGLVPADVLPGLLKRGVIFAAGLH
FT                   KEIATKYIRFGHMGVTVTDPKRGDVDKALAALKEALAEAKQAKGL"
FT   CDS_pept        join(628343..628470,628565..628666,628728..629085)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824331"
FT                   /orf_name="Pc16g02800"
FT                   /product="Pc16g02800 protein"
FT                   /protein_id="CAP92950.1"
FT                   /db_xref="UniParc:UPI0001831BF0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J4"
FT                   /transl_table=1
FT                   /translation="MHYLNSTLPFLLAAATFTLADTAATTTTTSADNAVNTTSASENII
FT                   LQECIQSVRSNLGNCAPDDWDCRCTNSMDVVDCYTNCREDTSKKDAETTRQRDCANAKA
FT                   HASISVATSTVSSSRAAATGTDIDDGTDISDSEVETDSEGDSINSYSGLEANLFVRPEE
FT                   GAASGLRMRGWLRFLGHAPGVSLLVLGAGLRF"
FT   sig_peptide     628343..628414
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J4 "
FT   mat_peptide     join(628415..628470,628565..628666,628728..629082)
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J4 "
FT   CDS_pept        join(complement(629790..630202),complement(629279..629726))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128680"
FT                   /orf_name="Pc16g02810"
FT                   /product="Pc16g02810 protein"
FT                   /protein_id="CAP92951.1"
FT                   /db_xref="UniParc:UPI0001831BF1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J5"
FT                   /transl_table=1
FT                   /translation="MEPTTSEHEPKTTKWDEGQIYVKACHNATRKLLVCLLSRSNEKKL
FT                   NLTTAGLDLSSGDSPDYGPRFVKPFSHDKMREYVEREQPWDDRWDIHSLCIPDEPELYK
FT                   YRLWRNAHHVAGILHLTLENFWGYDWPHGLVDEDNELGSLYRNQSQWYLEGWTIAKDTS
FT                   QPHINAFVSDSQPHRVGRLNSGEVSLAYGLIAKRRLQEGYNDHRYIPITMFSMSNFTVR
FT                   ILQIWHDKQNPKALQVRSSRIMDFKGGIQNNLDDWITILCWMTGEPVGDTKNGTEVAKV
FT                   IEREE"
FT   CDS_pept        join(complement(632540..632932),complement(632248..632481),
FT                   complement(631752..632154),complement(631650..631691),
FT                   complement(631396..631591),complement(631071..631341),
FT                   complement(630977..631018))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671652"
FT                   /orf_name="Pc16g02820"
FT                   /product="Pc16g02820 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP92952.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831BF2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J6"
FT                   /transl_table=1
FT                   /translation="MDTLIRDSLFGRLSNSLISNKLWPYPNLEACKFETLSTSPTSTIS
FT                   VTPEPSQQFIVEFSGDDDPDMPRNWSLLSKTLVTLDIMLLNFSFYAASAIFTPSIPGIE
FT                   EQFGATTAEGTLGLSLFVIAYGIGPLFLSPLSNLPAIGRTPVYVLGSLIFCLLNIGAAL
FT                   GKNVETILILRFFGGFFGSAPISVGGATLMEVYGPGEAPYAIALYAIFGTLAMFVPSYI
FT                   YALVMVANSHSERWHTWTASLWLLSGITAFTTLFIFFLLPETLSSNILLRRAQRLREHT
FT                   GNPLYRSKSEMDTPTTSFGAMIFKQTVDDLKLSCMDPVIIFVNIHTMLIYGILYLWFEF
FT                   FPFVFDGIYHFTPIQQALAFFGILVGAAISVVSYMLWLRFSYQPRVSKVESSIEPEARL
FT                   VPGQIGAICIPICLFMFAWTSRPGVHWVVPIIGTAFFAPGFYLTFQSVLNYLGESYPRH
FT                   VASVFAGNTFFRSSFGGALPLAAPRMLQSLGIVWASSTLGFISIAMLPLPFILERYGKT
FT                   LRSWSKFAN"
FT   CDS_pept        join(633685..634368,634418..634969)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171392" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947673"
FT                   /orf_name="Pc16g02830"
FT                   /product="Pc16g02830 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92953.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="UniParc:UPI0001831BF3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J7"
FT                   /transl_table=1
FT                   /translation="MKVRKQVPPRKKACQSCTDSKVRCGLEKPTCSRCRARGKQCRYPA
FT                   GSGDVHQSSPMVSSEQISADESLTFGLSPANLSATSTVTAFSSPVSGHPSDIPRIYSQH
FT                   ESTQTVDTDLNFDHIDLVPMIDAEKIRDRWLQPYLLTATEQVPKLFNPFTVQFVTCVLR
FT                   SYPNHLLDEKSLPPFIHPLQLNSKAMPRTIANCFSLVRMWMNRVAGSEAIVLSTVRQEM
FT                   ERLSREDATSDFDTLCSFQVYLIYLLTAYFFPIENASLGDDMSMITIQDLAFRVAKAGF
FT                   TCKAELSQTRPTWESWIIASAKRRTLFTMYIFSNVYNSDKGLPNFLSDELGDILVPESK
FT                   ALWEASDRDSWTREYNRHLSKWEDGMLKISELWRSSETGSEARRKRIGRWVQSTDEFGM
FT                   MLFAVCAHIHGC"
FT   CDS_pept        635906..>636211
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947674"
FT                   /orf_name="Pc16g02840"
FT                   /product="Putative uncharacterized protein Pc16g02840 "
FT                   /protein_id="CAP92954.1"
FT                   /db_xref="UniParc:UPI0001831BF4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J8"
FT                   /transl_table=1
FT                   /translation="MLSLALLQSLQGDLNELTRGIQYLCLIRRIVTGEFRQLRDVPIAV
FT                   GRPFAGGVIKNGAVIVSNNLQIVQGSFARVVVHGLEGCGRGRKGFSEAEILARPPIR"
FT   gap             636254..636353
FT                   /estimated_length="unknown"
FT   CDS_pept        join(<636356..636616,636668..636886)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947675"
FT                   /orf_name="Pc16g02850"
FT                   /product="Pc16g02850 protein"
FT                   /protein_id="CAP92955.1"
FT                   /db_xref="UniParc:UPI0001831BF5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J9"
FT                   /transl_table=1
FT                   /translation="VLLQRQKQPRARDREKKLSTKHPSRARQVLTSGTRKHTTSFSRVT
FT                   AIDKMEGGFRKAFLMKRADGTDVIAKVPCHIASPPLLTTAGESGDTLPFLYLVFFLESS
FT                   DGSNAVPNSLSWRKLRISLCSTPMASEAEKHTVFQPPGPFDAALPSNYILQKGWL"
FT   CDS_pept        <637049..638086
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000089307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824332"
FT                   /orf_name="Pc16g02860"
FT                   /product="Pc16g02860 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP92956.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020659"
FT                   /db_xref="UniParc:UPI0001831BF6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7K0"
FT                   /transl_table=1
FT                   /translation="MTREQIIYDVGPFRSSTKNTDTQLNVYVSNKRFKIDLFTSSFSRS
FT                   PVLLAEYLRHVRRQEPEWIPDESEVDLDVEFEDPLDEMHDWVLQPFLPIFREIAPLDPS
FT                   QKYTLEDCLFAEELHYTVEVVGDNLVPVYLGNTKNMKHHLIGARLPSSVDYSAFSIYHP
FT                   REVQVPISAESAALPGIPRKVFIHGQPQPSFFKIVYGGDMGITTREILTYSKIRMAKFD
FT                   PPILTSQLEGLVQDDDGYVMGLLLSYINCDGVTLNCINGRDPKFSELRQKWVDQISHTI
FT                   EHMHSHNIIWGDAKAANVLIDANEDAYLIDFGGGYTKGWVEKEKSDSTEGDLQGLENIK
FT                   RFLFR"
FT   gap             638478..638577
FT                   /estimated_length="unknown"
FT   CDS_pept        641734..642885
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128681"
FT                   /orf_name="Pc16g02870"
FT                   /product="Pc16g02870 protein"
FT                   /protein_id="CAP92957.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001831BF7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7K1"
FT                   /transl_table=1
FT                   /translation="MAAEKRFLVPDEKILSDIFPGVVGLKPSSCNVISNTFDICTFSVQ
FT                   VEVIPLIVRLETEKSETSKSRLATVAALSRLGHLQLNDIVPSIQQIGTATTIDTKVNYL
FT                   VTEYLTGTVLLEDIWNTLDETNQLELVDSVVCAMDKLQKLGDIKNVYKYLTATPYISND
FT                   KTPVAIGGPGIGYFPDIKDFLEGILQKHKRPGCKLLGTDGGLSIQSEYDDIGQIDLSHS
FT                   DLDELQHCVVFCHNDLEPRNILVRKSSSGKYKLAGVIDWEMAGFFPFAYEYGVKDTYLG
FT                   RENLYFSWYTMFKGKASYLLPQMECHTKFIKAVRIIEKSKKKAMSRNVGVRVQEKWIQR
FT                   EKVEESSDIREGWIRKAGEKSQVFTKEDMKELENEVLKELGYI"
FT   CDS_pept        join(643493..643508,643567..643603,643700..645002)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217562" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977566"
FT                   /orf_name="Pc16g02880"
FT                   /product="Pc16g02880 protein"
FT                   /protein_id="CAP92958.1"
FT                   /db_xref="UniParc:UPI0001831BF8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7K2"
FT                   /transl_table=1
FT                   /translation="MAGTGARAVCSVANDASRYGVGCPGYKRPWQFKDEGPRLQKRYQK
FT                   KCSNARTHSEAINSNGIFTKFSIDERVHPALVHQSFISQQPQVFKEFICAAFPTMFFHN
FT                   EFRFGNGFNFADCVVKHFGSKQYHDASVSCLSAEYLGHLTGDPRLHQFGRQEYSKALGA
FT                   IRRALNSEEALSDSLLLAVILLSIYEMNTRTTRDAWVYHSRAVKQLLLRRRTTFCLSGV
FT                   GRVCHFAYRPFLIAAALYEGEPCFLADDNWQDLAAFLRMEDSQKQSEWAFYINVYETIF
FT                   MELVKCPGYIKEAREIVSVTSPKARLLAQRICIAGDRLRTLSDELRSLLASHNQRKEGI
FT                   IFRSFVGPQPNAFPETSPSLLLRAAVTATSILEELFIRLTTPAYAKGESPSSSRGTPQS
FT                   VGVSGAGGPLLDFRFTFELGGRTEKDNPCHFTWLDRVAGSMGLLGAEITYVE"
FT   CDS_pept        645422..646165
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076657" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824333"
FT                   /orf_name="Pc16g02890"
FT                   /product="Pc16g02890 protein"
FT                   /protein_id="CAP92959.1"
FT                   /db_xref="UniParc:UPI0001831BF9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7K3"
FT                   /transl_table=1
FT                   /translation="MPFSSRHERKPSRGRAHRKAGGSMTGDKDIWELDLERSGEINILQ
FT                   RYRLRQHLRRPSHDDSERPFISHRLYFIEEDLREVVQEEISIKEGLDVLEKCGKEKERL
FT                   DVLNTKYWLLERQWWHYHSCLEDGYELRGFELWRSHPKWYMHRDLIKDCASRQGCCARG
FT                   CGCCLRRKIDPTRAFGVGHCTFECGCCRRARGFEIPEGDKILLKEKCREEIGKLPTHRI
FT                   VRVAIWGLVGDSYDNPFDMIDAPPS"
FT   CDS_pept        join(646701..646875,646923..647145,647210..647441)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128682"
FT                   /orf_name="Pc16g02900"
FT                   /product="Putative uncharacterized protein Pc16g02900 "
FT                   /protein_id="CAP92960.1"
FT                   /db_xref="UniParc:UPI0001831BFA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7K4"
FT                   /transl_table=1
FT                   /translation="MEDAKEVVAKHRWNGYKRLKRAVRKFLGNNIDRRQLQEATDQIDA
FT                   SETKFPTVAITTLSVFADVFFGLFLTHPFSPSASPPHNEESMALEVLHLADKRGPILAL
FT                   EVGGVVFLVLVLMRTLSLVYWYIRLKILLKLDPDGRYDNDTRWTVIDTLTDMEASQDPM
FT                   KASLPYSLDDEGLYFHPSDAEPSLCLPKSMTKKVFALVHDDQGHCI"
FT   CDS_pept        join(648289..648719,648778..649444)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208429" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128683"
FT                   /orf_name="Pc16g02910"
FT                   /product="Pc16g02910 protein"
FT                   /protein_id="CAP92961.1"
FT                   /db_xref="UniParc:UPI0001831BFB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8P9"
FT                   /transl_table=1
FT                   /translation="MAKETKTRTLNVQPEKSQGEDDNKHVSFHPRQITLETFRNLLYQY
FT                   PSTVERVHRSKLMIKLQSKGKAKAPKRKAETKTSAAPATKADLDPSEEKHILEESDQFL
FT                   QLDRWRYEVLPKLIAERANGSAEGAHLVKEELIDIMEWKTKHGVSRPMLMGMVKSNPAT
FT                   TITKSTSTAFAALPDADPLVAPNDTFPKASLDALTAPIRGVGPATASLILSIATVFGDA
FT                   KKQVPFYSDDVYLWLCLMDFPEGPDVKEQKPSKHKKPNGELIVKYNMHEYRELWNASQA
FT                   LRARLNNAAGENSGDGPVSFIDIERAAYVLRNLAISDYFASQEAEDGSNVVKDVESPND
FT                   SLPKQPEKDSSELGTRRSKRTKKEA"
FT   CDS_pept        join(complement(650830..650845),complement(650708..650784),
FT                   complement(649670..650587))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947676"
FT                   /orf_name="Pc16g02920"
FT                   /product="Putative uncharacterized protein Pc16g02920 "
FT                   /protein_id="CAP92962.1"
FT                   /db_xref="UniParc:UPI0001831BFC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q0"
FT                   /transl_table=1
FT                   /translation="MSLNQAPISQSGRMLVPVEEKIKTSGDFWNWQRLRAAVFPFLPVN
FT                   IEDTLPLVDEHPTSMQTIESNMGEVIPHHKAVDIPIDSHGNLDEDCTENQDEVNEHELS
FT                   RQVRPAFDTALEENDTKVISNTCCTESPVVSSSESVEGATAKEDLPSPPTSPVPTTTNN
FT                   PTYPIYHNLIPPPPIPLDATTQSRIDKKFQSAIKETPTIRLIVDIPPHLVDWSNPITSI
FT                   TTTINPFLSHWETQNKVNLLAVEIRHGHAYAAIEVNNHNYDFKTAHKQTFVFPVYVLKV
FT                   GRGFRWRFYRAPAVDVSVMNEIKTVHYLHREEVGTPYLVFRVGGREPVSGESRED"
FT   CDS_pept        complement(651563..653518)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208418" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671653"
FT                   /orf_name="Pc16g02930"
FT                   /product="Pc16g02930 protein"
FT                   /protein_id="CAP92963.1"
FT                   /db_xref="UniParc:UPI0001831BFD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q1"
FT                   /transl_table=1
FT                   /translation="MLAPNCTGINTLSLPQLKRKRSDSDSDATDAPAPTKVCADSVSTR
FT                   PTPTLIADSVAPTPSTPTTSSNSPVASARPPAQDAVARPSVTRLRETITAQLSLEVLLK
FT                   HNELRLIDQEIAKCQVALEQLRRCGEIPYPGSRVTGVSPDVSLGTGASVLAPGNGPAPM
FT                   SPAPWGVTEGPYARHYARWLLPDPRFDGGEVDSGMPNSLVEGRSTRGNPGEMGMLAGKT
FT                   RPQRGSTATKHTALSSGYPVVKEKSGPMLIRRKSDGVLVKLVCLDCRRDNFSSTQGFIN
FT                   HCRIAHNRNFASHDAAAMACGQSVQVDDAGTVVGGSAEPTANPTTPGYVHPLIRSTHVA
FT                   TTPWKSLRTPAKDSVTPRTPAAATTSAVATPPSTAEPAYRRRSEPIRQPPNPQFLASPA
FT                   TPHLSALMKSRGAGLNMDKLVEESRTPVDLGALFDDDSETDDSRPSGASHTSLGARAGR
FT                   QPMRMPASQTAGESESRKALDRGHSPPTEHATPSRPQSFLDLSLAGQSQSRESNSLDHQ
FT                   ALSPHAIESNQAPSLVSDDEDDYEVASDSDSPASSEEDEQEQEFRHIHVEDDERAAAPS
FT                   ATAEAKPGPSLASPAPQSGPPLSQPLKRSRSKKISSIVPFGDNDDQHVGYIHSPSADNA
FT                   AKAKRAAERKPNQSKR"
FT   CDS_pept        join(complement(656704..656737),complement(656118..656464))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208407" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947677"
FT                   /orf_name="Pc16g02940"
FT                   /product="Pc16g02940 protein"
FT                   /protein_id="CAP92964.1"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniParc:UPI000004EC06"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q2"
FT                   /transl_table=1
FT                   /translation="MSSQPLLQTAPGKRIALPTRVEPKVFFANERTFLSWLNFTVILGG
FT                   LAVGLLNFGDRIGRISAALFTIIAMGAMIYALVTFHWRAQSIRRRGQSGIDDRFGPTIL
FT                   AIALLAAVVVNFILRIKDGQMN"
FT   CDS_pept        join(complement(659945..660190),complement(659704..659883),
FT                   complement(658631..659639),complement(658147..658571))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000139601" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947678"
FT                   /orf_name="Pc16g02950"
FT                   /product="Pc16g02950 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on CH-OH group
FT                   of donors"
FT                   /biological_process="alcohol metabolic process "
FT                   /protein_id="CAP92965.1"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="GO:0016614"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniParc:UPI0001831BFE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q3"
FT                   /transl_table=1
FT                   /translation="MAENPTCAIEEFTRTIFDYVICGGGTAGLTLAVRLSENPAVTVGV
FT                   IEAGKYRIGDPLVDTPAAFPQTFENPEYDWCVYSVPQEGNRGVAHHIPRGKLLGGSSGI
FT                   NYMMYVRGSTKDYDNWAELLEDDGWSGEHMQHYMRKHQTLEPIDPSITDRSTMPLVGEF
FT                   HGTSGPIRTGFNDSILPVENDIIKACEDVAGITNKPHDPWSGDHIGFYHTLGAVIRTGP
FT                   NKGKRSYAARGYYEENRATRPNLKVLCEALVNRVVLDGNKATGVSLTHEGVEYQVSARR
FT                   EVIVSGGTIQSPQILELSGIGDPEVLKAAGVECKVANSAVGGNVIDHALSFIVMEVQPG
FT                   IMTLDTLSQVPEAMAAARKQYAETGGGPLTAVSSMQGFFPAKSILSETELAEIIQSIRD
FT                   IKPNSAFHAKQLEQTIANLEDGHSANMQFVTVPGSMNPDAIGHQGNIILPRSADQPAGV
FT                   TLEACLQYPVSRGTIHIESADPTKHPIVNPNYGGHPADISLLAAFLRWCDKVTESEHVK
FT                   SSFLRRAFPDPKVNLQDMDAAREAVHDLVVGEYHISGSVAMGAALDSRLRVKGVEGLRV
FT                   VDASVLSNNVSGNIVSTVYAIAEKAADLIREDWDFSAAKETIA"
FT   CDS_pept        complement(661257..662447)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216713" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671654"
FT                   /orf_name="Pc16g02960"
FT                   /product="Pc16g02960 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92966.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831CD2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q4"
FT                   /transl_table=1
FT                   /translation="MPPLRAHTKSRNGCDQCRIRRVKCDEKGPPCSNCTTRELKCTYLK
FT                   VAARRAATHITPPSSTSDVLQSLDGHGSPVAAMPGPAVATIPVSAPTQTNSFGINNLEL
FT                   MHKFATETYKSLCISDSEMQIWKITVPTLALKHDYLMNGILALASLHIATTCGPSEVAL
FT                   MYYEAGLQYYNRSLTPFRNAIDSITPHNCDAVFAHSIVMIAIGIASPQLTGMKDECAST
FT                   TKNIVILFELLQGVKKILQVSKSWIKLELFSQGEFWKNTPAELDPDTEAALTHLSDLND
FT                   RVMVGVYSEQHRINKTVIAHLRHCYAKFAHSADPAPAFAWLAAVEKGFVDSLRCRQPFS
FT                   LLILMYWGVLLRELDGLRWWARDAGRVLVSELFDALRSGDPRWQSALGWVQRKMGL"
FT   CDS_pept        join(663003..663076,663139..666007)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(666767..667450)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076658" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947679"
FT                   /orf_name="Pc16g02980"
FT                   /product="Pc16g02980 protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAP92968.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI0001831CD3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L2"
FT                   /transl_table=1
FT                   /translation="MLAPAPIQAKASSSATELYLSQARASGSTEDCMALYEKWAASYDD
FT                   EVGDSAQEYVAPMLVAQAAIKYGLSNGATNSVILDAGCGTGLVGVALAMAQAKAIDGID
FT                   LSPAMLSIARKTGIYRDLTVADMNRPIDKTDGTYDLVSCVGTFTLGHVGPNPALRELVR
FT                   VAKHKGVVVSTILEQIWVPGGFKAEVEKLVAEGLVKVVTDELIDYVKGHGDKAVLLILE
FT                   KIDRD"
FT   CDS_pept        join(complement(671280..671576),complement(670983..671226),
FT                   complement(670809..670927),complement(669863..670756))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000158948" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128684"
FT                   /orf_name="Pc16g02990"
FT                   /product="Pc16g02990 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92969.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0001831CD4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L3"
FT                   /transl_table=1
FT                   /translation="MNTLLELTTKLALFVAILLTSRFLWNYLRSPLKSFPGPNLASFTN
FT                   IWRMQDVAKGRCDVTHNNLHRRYGSAVRMGPNVLSLSDPDLISVVYNTKNPWLKSDMYN
FT                   VNDVVVSGVRLKNLFSNQNESWHSTYIRPVKNLYSMSKVQDAESNIDITIKLLCEKLRA
FT                   RFVRPGKTCEMSDWISFFAWDTMSQVTFSKDLGILEAGSDYKGFLRRSNQTLDYFAAIC
FT                   QIPLLDYLFDKNPIMRIGPPTFLWANIFSLEQLHRRYQEGNHDGDFLSKFLELKQRNPE
FT                   LVNDNTVILWLLSNVLAGSDSTAGTMCATIYYVLRDPGVCQRLCDELRGANLSSPAQWK
FT                   EIKALKYLEAVMRESMRINPGVGLMLERIVPKGGLTLPDGRFVPEGTTVGMNPWVINRN
FT                   ETVFGAKTHEFIPERWLQNPGETEEAYQARFSKMKSTDFTFGAGSRACLGRYLSQLESF
FT                   KLIATLFNTFDVSLNCILRFRVNGILANWLHRWRSPVATMSGSSRIRGSLGRKAFLSTW
FT                   "
FT   mat_peptide     join(complement(671280..671510),complement(670983..671226),
FT                   complement(670809..670927),complement(669866..670756))
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L3 "
FT   sig_peptide     complement(671511..671576)
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L3 "
FT   CDS_pept        join(672254..672470,672527..672545,672615..673344)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947680"
FT                   /orf_name="Pc16g03000"
FT                   /product="Pc16g03000 protein"
FT                   /protein_id="CAP92970.1"
FT                   /db_xref="UniParc:UPI0001831CD5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L4"
FT                   /transl_table=1
FT                   /translation="MFLLLYDLVACLYNVVSTLKVPKACGCFGSLLSCLSTALLFHSHL
FT                   SEIPLPRLHYHIPTSPFFVHFLIHASHAASGTAPGYRSNQARDTHHTTRQNSQPPTIAF
FT                   VNSESRQVVLERGRILESVEGNDLKWLWVQPRRDTLHLIGRKCYTLFRGLMMTPRVQLS
FT                   NSYCMRCILGSATDAVVAYSMPVLQLAEAIDSMKRIKKIGQNAIDVHRKELITEILAIV
FT                   LMVIPFAGKALGPLICSATPMARIALLVGEMGNGGLVVAALSAILGLIAGIDSGTGKLS
FT                   KGEALVEASNARGLLKASDLAKSPEGFRNFDQPLGCSQIS"
FT   sig_peptide     672254..672307
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L4 "
FT   mat_peptide     join(672308..672470,672527..672545,672615..673341)
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L4 "
FT   CDS_pept        join(complement(675401..675610),complement(674845..675327),
FT                   complement(673857..674789))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161934" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947681"
FT                   /orf_name="Pc16g03010"
FT                   /product="Pc16g03010 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP92971.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI0001831CD6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L5"
FT                   /transl_table=1
FT                   /translation="MHISSLIGGLSAIGGLTLAQAAVDSPVIEADDFSITGALEDLGVD
FT                   VSQIPALKSFAAIETRSTDKACAVACASLSFLFGSKVSAQETTGYNNFTSSFWSVQQEE
FT                   VQPHCVFRPTKNTEVSTAVLLSRLTGCEFAARSGGHAAFTGASSAPGGISIWFKDMSAV
FT                   TLNADKTVASIEPGNNWLTTYAALEPYGLAVIGGRASSIGVGGFVLGGGISYHSNLYGW
FT                   SCDNVESFEVVTASGLIVTASATSYPDLYWALRGGGNNFGLVTKYNMFTIPSPEMYGGA
FT                   RTFLETEFPQVINAWINVINNATVDGNAQQYVAFLQTQGMNLASAELTYVKNDPNPEIF
FT                   KQYRNISAISDNSSAKSLVEYVKYLETENPYGLREVYWPISAALDEKFANWVVNLFYSM
FT                   IPEVGNVAGAQPVLIYQGITEPMLNNMKNHSGNPLGLAGSSGPVHLLHISCWWKNESDD
FT                   KTVYAFVNKFMEKVTTEAKNVGVFNEYVYMNYASMFQDAVAGYGAANKAQLKKIAKKYD
FT                   PREVYQNLQPGYFKLDGPPVTPSF"
FT   mat_peptide     join(complement(675401..675547),complement(674845..675327),
FT                   complement(673860..674789))
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L5 "
FT   sig_peptide     complement(675548..675610)
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L5 "
FT   CDS_pept        join(676784..677204,677336..677422,677476..677673,
FT                   677741..678090)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201315" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128685"
FT                   /orf_name="Pc16g03020"
FT                   /product="Pc16g03020 protein"
FT                   /protein_id="CAP92972.1"
FT                   /db_xref="UniParc:UPI0001831CD7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L6"
FT                   /transl_table=1
FT                   /translation="MGEAIAGTFGTGTIKGTGISLIVLTSLVVGTRFAGLIRSFKDLKA
FT                   EDYLLIVAYIFFLELSILYIYIAPAIFRIAAVSAGTIPPYATISEYGLRLQTVFFVTTS
FT                   SLWLCLWMVKFSLMAMYKRLLVGKKYIIAWWVIMGFCQCDTPRDHRAAVISLYYAYGVD
FT                   IATDLAIMILPIRLIWNLQMKTRQKLSIGGLFCFGWICIIVSTIRVVQLGETENGVPAP
FT                   SWLALWGTIEALIAVMIGCCPGLYRVLKNAISPSKTSYPYDSYNLRGRGGSGMPSNRSG
FT                   AFGRTDIPLNSFRGKEESYQSASAYRSTSPSSSQEKLADLDDRRNIMVNYGVAVTVENR
FT                   PRDYGQATRFV"
FT   CDS_pept        678871..680763
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216973" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947682"
FT                   /orf_name="Pc16g03030"
FT                   /product="Pc16g03030 protein"
FT                   /protein_id="CAP92973.1"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniParc:UPI0001831CD8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L7"
FT                   /transl_table=1
FT                   /translation="MRLSRNLFALVNILPPLTAHASPSIQETLIPPPSPEPIVVTELPL
FT                   PPVTPNSTEGSCTPELNPRRTGCLLRDSQIRSGDFLPDDNHVLVSLDFSGAPAAPDPAG
FT                   IYNGLQLIIVKADGETFPNGDPWKCITCGVPEGNKVGSTELAPYPQAFRDGSRVLVGSN
FT                   IVDCGDEQLASPGCTPDKVHIYPIRWNTKLDGSGPGGDIRELRLHPDNVHLGFNSFTFE
FT                   NGQLGQFAYFSRLQFNSDPSTGEPRTARYDLVNVTRLFSLQNPASISAHGNQLFINDSA
FT                   ISVGELRGFSGRGKEVTYVGSSVESCNIDVFAADLTTGRVRRLTSDPEYVDPVDISPDD
FT                   KWHVVLDTRGSGRQMFLAGMRGVPPIIDMAVITAVSSVRNNGARRFFQPWLLDHDGDRG
FT                   DYNGQQVNAAGDGSPGSVNDPNWNAGADPKWSRDGTRIAYYQKLVIPPACGGSNPLPCQ
FT                   NSTEPGGRIARLMLAHLTSREPLHLEPVAPVSDEVPWGTPYVPESPIPALSYPGIGNYT
FT                   LQGKVSGSARVTIADATGSTPTTIKVAYENYSDDGLHYIHGWEKVTSKMLSLTLNKVDW
FT                   YSNLTSTGQQHATKKTSPGGFHLEIDTMKNIFNSNGTLTTTIDGKSWRQPLNGA"
FT   sig_peptide     678871..678933
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L7 "
FT   mat_peptide     678934..680760
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L7 "
FT   CDS_pept        join(complement(682910..683213),complement(682631..682833))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947683"
FT                   /orf_name="Pc16g03040"
FT                   /product="Putative uncharacterized protein Pc16g03040 "
FT                   /protein_id="CAP92974.1"
FT                   /db_xref="UniParc:UPI0001831CD9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L8"
FT                   /transl_table=1
FT                   /translation="MQSWISFLPYLLFQFSTCISGVQAKRGGGGGDSDDSYSDDNSGGS
FT                   SSTDSCATSKHPTIWKWDLIPSNADNYTSGDISGEDTSYDGSFFKGEASLHYTITEDKY
FT                   CRCRSNLAADLNTSDLALECCVCWRLQVTTMANQASRENPHKIPVLDSVYSGLRQNSTF
FT                   ILPTV"
FT   mat_peptide     join(complement(682910..683141),complement(682634..682833))
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L8 "
FT   sig_peptide     complement(683142..683213)
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L8 "
FT   rRNA            complement(683506..683624)
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="Pc16e00070"
FT   rRNA            complement(683806..683924)
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="Pc16e00080"
FT   CDS_pept        complement(684107..684541)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(685322..685426,685481..686066,686122..686372)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671655"
FT                   /orf_name="Pc16g03060"
FT                   /product="Pc16g03060 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP92976.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831CDA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L9"
FT                   /transl_table=1
FT                   /translation="MVKVAVAGGTGGVGRTIVEELLRQDKHNVIILSRKSTPLPGLPSV
FT                   PVSAIDYDDIASVATFLREHSVDVVISTLSLFTEEVGKAQMNLIQAAIESSAVNRFIPS
FT                   EFAFNYSHPGLLDFHAAAQMRIDAADLLRSSHVDFTRFVFGWMLDTWNPVRAKSHMPPM
FT                   SWVLGFENRRARIPGDGKAPLTFLHSFDLAKFVAALLDEENRWPETSAFAGDRITFNEV
FT                   VELAESIMGQKWEVTYEPVSRLEKKDVVVFEQPEGSYDFGEGLRDVTAEFGLIVVKDMM
FT                   DASVDGLRNMDFPNVRPITVEAWMHQIWGKKA"
FT   CDS_pept        join(687451..687653,687717..687923,687994..688098,
FT                   688187..688275,688305..688341,688371..689454)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977567"
FT                   /orf_name="Pc16g03070"
FT                   /product="Pc16g03070 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP92977.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI0001831CDB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7M0"
FT                   /transl_table=1
FT                   /translation="MDDRELVSILHPGLGAVFKGVKTAEFLDQKSSSVAQFRGIKFARI
FT                   PTRFRRAILHENFPPIVDATNHGPICPQSIGQRKFEDLLNGASPESLAVAGQLESPVMD
FT                   EFECLNLVITAPVLKSTESVAEELFPVMIYIHGGGNFVGANSFWFNDGRHLVKKGMESN
FT                   LPTVIVALNYRLSALGWLSSQTLREYNAAFGDVGVGNYDDANKSTQAAMMFADKIHKHL
FT                   GIEWVYRNISGFGGDPNNITIFGESAGGFAVDNQIHSQLPCRFSQAILQSGVMSSHMSS
FT                   PLPLSDQDTLFDLVKARAHVNTVEELRDIPVDVLLQAFAKASSETGFSAVPTIDDEMFT
FT                   QSWAEHYSFANEDFRVIIGHTTYERSLFEILAHLHSEAKDNDQSFERICSSFLAHIEGM
FT                   EATELCEAYGYQDDIQPARLKQCLMKILEDIVFVTPINEATTRYIQKGLAVYRYIFDEP
FT                   NPFKGAFSGKSNHALDLPYLFGSASIFAGVENKDWEQDIQDSLQTKWLLFAHGIPPWPS
FT                   VSDGKFLVFGPHGTVNEHSSTELISKSLSISDDIFGSLELGYRAELSMLVWKHARLL"
FT   CDS_pept        join(complement(692440..692618),complement(691966..692300),
FT                   complement(691609..691910),complement(691391..691556),
FT                   complement(691141..691331))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128686"
FT                   /orf_name="Pc16g03080"
FT                   /product="Pc16g03080 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP92978.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831CDC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X0"
FT                   /transl_table=1
FT                   /translation="MLTSFLQSLPRLGRRWTPLNFTNPNFIQLSASQAIEEETIPGYIA
FT                   GRYYPTRIGEILKDRYRRYVTLKIFIKSTSMGQQLDDELKIYKRIEGAPQKHPGRKYVR
FT                   SLLDSFDISGPEDKHRCLVHPPLWESMLDFLFRNPVQRLPTPILAVTLHRLFLALDYLH
FT                   TECKIIHTDIKADNIMFGIADDSVLSDFENTELQHPCPRKELDGRTIYTSRELRMPKNL
FT                   GAPILCDFGSAVIGDKEHSEDIQPDIYRAPEVILQAPWSYSVDIWNVGCVIWNLFEGGS
FT                   LFSGQDPEFQTYRSRAHLAEMIRLLGPPSPSFLARGNLTQRFFSQEGDLYAGELVGEHI
FT                   PLEQRETSLEGEEKEMFLRLMRKMLQWEPEKRSSAMELEQDEWVQAELHK"
FT   CDS_pept        join(696176..696248,696299..698309,698371..698773)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000031215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128687"
FT                   /orf_name="Pc16g03090"
FT                   /product="Pc16g03090 protein"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP92979.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001831CDD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X1"
FT                   /transl_table=1
FT                   /translation="MPQTFDVEHVLANISEQDKIALLSGIDFWHTHPIPEFNVPSIRAT
FT                   DGPNGIRGTKFFAGIPAACLPCGTALGATWDRDLIYQAGELLGDECIAKGAHCWLGPTI
FT                   NMQRAPLGGRGFESFAEDPHLSGILAKSIILGCESKGVISTVKHFVGNDQEHERRAVDV
FT                   LVTQRALREIYLRPFQIVARDAKPGALMTSYNKINGKHVVEDERMLNLIREEWKWNPLV
FT                   MSDWYGTYTTIDSMNAGLDLEMPGVSRYRGKFIESAVQARLIKQSTVDARARKVLEFVK
FT                   QASQVQVSEVERGRDLPEDRALNRKLCANSIVLLKNEGILPLPREIKKIALIGSHMKCP
FT                   AISGGGSASLEPYYSVSLYDACREALPDAEVLYQVGAYAHKMLPVIDRLLSNAIIQFYN
FT                   EPMCKERHLISTEPVSTTAFQFMDYYAPGLNRALFWATLIGDFTPDTSGIWDFGLSVFG
FT                   TANLYIDDELVIDNTTSQTRGTAFFGKGTVEVLGSKELVAGTIYKVRIEFGSANTTTMK
FT                   TVGMVNFGGGAASLGACLRMNREEMIENAVEAATEADYTILCTGLNKDWESEGFDRMHM
FT                   DLPPGVDELISKVLKAAADKTVIVNQSGTPVTMPWADQARCIVQGWYGGNETGHGIADV
FT                   LFGEVNPCAKLPLSWPVDVKHNPAYLNYASVGGRVLYGEDIYGGYRFYEKTGREVLFPF
FT                   GHGLSYTTFNVSPNVTVAPEIFNMDVPTVATVQIKNTGKLAGAQILQLYISAPESSTPR
FT                   PSKELHGFEKVFVQPGEEKTVNIQLDRYATSFWDEIEDMWKSEQGTYEVLIGTSSQEVV
FT                   ARGKFQVDRTSYWRGL"
FT   CDS_pept        join(698972..699098,699391..699486,699543..699933,
FT                   699988..700115,700162..700258,700305..701064)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947684"
FT                   /orf_name="Pc16g03100"
FT                   /product="Pc16g03100 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92980.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831CDE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X2"
FT                   /transl_table=1
FT                   /translation="MDASSTARPRRNTRVLTACDACRLSKTRCDSARPVCAKCVQRDMI
FT                   LSWPIFPKEKSVSTFPMAAYSEKPDRFQTALHSLDPQRLLELREIFMTKIWTKNPIVDP
FT                   DQLDFYIARVLENGVDWSASSCLVLLIFALAAIWGNYPDDETREVSYNEPSFSPPVTYL
FT                   TISVPEHRMKESLTFLSMARKRISTAYLDDTLLGVQCLCLFGIWYQYNIEPIPGWKMFR
FT                   TASMLWQTYRLKHREGKTVRSAQEESLEQRLYWTCLKSEWYSIHHTPQILTQLADIQYL
FT                   SDFPYSLPSFPTRQPSNDSAGWVFSNPSSTDLEAASSYYYLAEIFLRRLLNRARNAVRV
FT                   LSPDIDPPTINTLAETLTQLEGQLQQWVDCLPHTLRFNMPLESAPGPKEGELMKLSRER
FT                   YVEVRELLCRAYLYLCIHVPLDAGMAALYGVKASEALLLAVYRIQTEVPFFRHPGSWGA
FT                   CRVRFNHALCLIAGFRAKLTQRPSAEYVTIPPDWADCVRVVIERLKIWGQEGGGIKELS
FT                   VLLEWLMHGNLELSN"
FT   CDS_pept        join(701821..702031,702164..702304,702354..702615,
FT                   702667..702936,703001..703308,703359..703589,7
FT                   03640..703764)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178887" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671656"
FT                   /orf_name="Pc16g03110"
FT                   /product="Pc16g03110 protein"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92981.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831CDF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X3"
FT                   /transl_table=1
FT                   /translation="MVIVGKQREENLAEPVLANLLADDRTPWYKKPNLRRLYFILFPAC
FT                   MGIEITSGFDSQIINTVQIVYTWNKCAAYSLGAILSLPFVPYVNQLVGRRWTIMFGSGV
FT                   SLVGALIQGFSNGVGMYIVARIILGFGIPFCIVAGSSLLGELGYPKERPILTSLFNSSY
FT                   FIGQIIAAAVGLGTVTIASDWAWRIPSLLQIAPAMVQIATVMFLPESPRYLVSKDRYDD
FT                   AFDILTKYHAEGDRSSTIVKAELAQIERTIKLELEESKQSWWDMFRTAGMRRRLFISAF
FT                   LGLFTQWSGNTLISYYLSDLLNMVGITDGVIKSKINIGIACWGLICGTALALTAPRFKR
FT                   RPMYLTCASALLCVYIAWTISMERFLATKAQSAAIATIFFIFAYSPAYNLGYNALTYTY
FT                   LVELFPYMGRSRGLSWFQFYGRGANFFATYVNPIGLARIAWKWLLVYCCWLLFELVFIY
FT                   FFFPETAGRTLEELSFLFEDKEKANEVAAAVHKQLDEDDEKKTVTAHVEVQDTKNAV"
FT   CDS_pept        complement(704441..705280)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947685"
FT                   /orf_name="Pc16g03120"
FT                   /product="Pc16g03120 protein"
FT                   /protein_id="CAP92982.1"
FT                   /db_xref="UniParc:UPI0001831DBA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X4"
FT                   /transl_table=1
FT                   /translation="MPVATLHLLTLAKSTDAQSFLQQLRQSPSTRVIVASRPRHVVIHP
FT                   NILDNDPLASNPWDLLVLLQITQPNAQDPIPSALRGLITNEYIITTGVPSKLLSDYQAR
FT                   DSRLKNDASSIPLTGSLDKVVRGGSKEASQNLEVSPQLLRFMDELWKTHKGPVTMLNLL
FT                   HFHHPDGKKNYYQYGQAFIPVAGKRGGSAKLVGNVVPPAPEKRDSRGSRNRSQQDWWNE
FT                   ISIVHYPSIRHFCDMLAGEDYQAINERYRLSVSALDALLPFISIEFVEWCNDYLGTS"
FT   mat_peptide     complement(704444..705229)
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X4 "
FT   sig_peptide     complement(705230..705280)
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X4 "
FT   CDS_pept        complement(705975..706925)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201258" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947686"
FT                   /orf_name="Pc16g03130"
FT                   /product="Pc16g03130 protein"
FT                   /protein_id="CAP92983.1"
FT                   /db_xref="UniParc:UPI0001831DBB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X5"
FT                   /transl_table=1
FT                   /translation="MAGESGPVEVSRPIAMVIAGLFALACWNVLQILVSIINTFKRRRG
FT                   LYFWSMVIATLGILVHALSTFLRYFALAPNFPMCVLICISWYSMVTGQSVVLYSRLHLV
FT                   TNYDSYSRWVLGMIIFNFCVLHVPTTILFLGINLDVKSFIRPFNIYERVQLAGFAAQET
FT                   IISGLYIWETMTSLRPVLAMKGRRGQKVVINLLVVNTLAVLLDAALLATEYTNHFDVQT
FT                   TLKPVVYSIKLMLEFTVLNSLLLVIRTNPSAIEEVEQLHDDLHIDTGCSGKHFNNTAVF
FT                   IGDPAKSDQGDQGVQISPVRSDPSWISFDHQVKPA"
FT   CDS_pept        join(complement(709150..709432),complement(708377..709089))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947687"
FT                   /orf_name="Pc16g03140"
FT                   /product="Pc16g03140 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92984.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831DBC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X6"
FT                   /transl_table=1
FT                   /translation="MSVTFEVFRGSKEGKIVADKTTRTLQPNEVYIETTHSGLCGTDEH
FT                   YLSSGMALGHEGVGIVRQVGRDVTNVKVGARVGYGYTHYVCGNCDKCLTGWDQYCENKK
FT                   EYGSHDHDLGSFSGGTVWDAGCVVPIPDGYDSADAAPLMCAGATVWTCLTEYGVKPTDR
FT                   VAIMGIGGLGHLAIKLASAMGCHVVVLSSSETKREEAFGFGASEYHVFRKGEEMKDFKP
FT                   VNHLLLCGSANVDYPSLIPLMDVHGSIYPLTVDFSHSPVPLLFMNLKGIRIQGSLVASR
FT                   NSLRTLVKFAADKKITPTTMTFPLTKDGVESAMQTLRDGKMRYRGVLVRE"
FT   gap             709534..709633
FT                   /estimated_length="unknown"
FT   CDS_pept        711675..713447
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000149415" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824334"
FT                   /orf_name="Pc16g03150"
FT                   /product="Pc16g03150 protein"
FT                   /function="transferase activity, transferring phosphorus-
FT                   containing groups"
FT                   /biological_process="phosphorylation"
FT                   /protein_id="CAP92985.1"
FT                   /db_xref="GO:0016310"
FT                   /db_xref="GO:0016772"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR012047"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="UniParc:UPI0001831DBD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X7"
FT                   /transl_table=1
FT                   /translation="MGPYVASVFEGTTHVRGKASGTLIASGLELSFWGGVNSQTGEVID
FT                   RHHDLSGHYLQDTVLAIPGGRGSCSGSGVMLELLLNNKGPKAILFERQDDILTLGVMVA
FT                   EEIFGKAIPVVTMKPNDFRAILGMRGKIIYIDSDRVSDAPFHDTHPDHTQEPTKNYFVD
FT                   GMQMSDFDKELLQGLHGEASCTAIRIILRMASLLGATELMNVTQVHVDCCLYTGPGSLL
FT                   FAEKLRDWGGKVRVPTTLNSISIDQNRWREQGVGNSFGEAATKLANAYTDMGATPTFTC
FT                   APYQLKTAPRQGEQVAWAESNAVVYANSVLGARTMKYPDFLDICIALTGRAPRGGAHLD
FT                   INRLASLILRVGLPDVDTIDDSFYPILGYKVGSLAANRIPVIVGLQTLAPSRDDLKAFG
FT                   AAFATVSSAPMFHMLGVTPEATSLSAVVDEARQIPSVDIKMEHLIDDWQRLNSASEQQA
FT                   IDLVSLGNPHFSFKEMKRLAHLCEGRTKAQEVSVIVTCGRSSYGLASQAGVVELLENFG
FT                   VKFMTDTCWCMITEPIVPATTNAIMTNSAKYAHYGPGLTERKFFLGSLMQCVEAACRTS
FT                   YTKEMPQWLLNTDD"
FT   CDS_pept        join(713967..714030,714084..714205,714279..714412,
FT                   714477..714599,714695..715309,715364..715450,7
FT                   15510..715579)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185898" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947688"
FT                   /orf_name="Pc16g03160"
FT                   /product="Pc16g03160 protein"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAP92986.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001831DBE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X8"
FT                   /transl_table=1
FT                   /translation="MGSIAATPFQSPFQDVPAGRTDGLAALVGQFREDTDPNRTDLLVG
FT                   VYKTEEGKAYVLPSVKEAKNRIFNDPDWHHEYRPSALGSQIYRDLSANLLFGRDHRLLR
FT                   EKSFNADARRKWRLPCGRSYVEKPLCAVEGEWEPRDFPSDRLLVLLPYFSSKTNRFDFE
FT                   SFSEAIKSLPAQSVILLQSGAQNPTGCDPTLDQWRELASIFSERGHLAFFDAAYPGFAS
FT                   GDIDTDLQAVRLFAEQEIPVVFVSTYGKSFGLYSERVGILSILVPNEEVGKNIETQLAL
FT                   LARAESGAPPDFGSRIIETVLSDEVLERQWRQEVRDMANQLKHRRDALREGLEKLGTPG
FT                   DWRHITDQNGMFSYVGLSVEQVTLLRNKYHVYLQDSGRISIAGLNNFNIDYTARSISAV
FT                   IKATA"
FT   tRNA            715890..715961
FT                   /gene_name="tRNA-Ala (AGC)"
FT   CDS_pept        complement(716612..717457)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947689"
FT                   /orf_name="Pc16g03170"
FT                   /product="Putative uncharacterized protein Pc16g03170 "
FT                   /protein_id="CAP92987.1"
FT                   /db_xref="UniParc:UPI0001831DBF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X9"
FT                   /transl_table=1
FT                   /translation="MAFSGFAEPTLLDLVPTLVGESNFTEWTTALKWTLDSRDIRYYQL
FT                   LTGVWSEPNAVDSAQPTSTEVEARAQWDTASRYLLPLLNATVHQTAKFYILDANNARTA
FT                   YANLHRAFAARSYAAGFANFLKFINTTYTSNQPQAFVNEWRAALGELQECNSTKLTPLL
FT                   IFYHFLHAVSANPAAHPWLDGFLNSKVSTDTTIEATFADFVVSEDRRLNALNQAHSFSL
FT                   NKGKHLPFFCEFHQRQAGHSSENCFRNPANHAPVNKPASAPAPATVPAQGPATQDPPAK
FT                   "
FT   CDS_pept        join(complement(719171..719221),complement(718937..719077),
FT                   complement(718740..718859),complement(718498..718667),
FT                   complement(718197..718256),complement(718056..718147),
FT                   complement(717866..717966))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824335"
FT                   /orf_name="Pc16g03180"
FT                   /product="Putative uncharacterized protein Pc16g03180 "
FT                   /protein_id="CAP92988.1"
FT                   /db_xref="UniParc:UPI0001831DC0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y0"
FT                   /transl_table=1
FT                   /translation="MAIYSAGYLTTSYVRILEDRHVKIETMPVLEQKTGPLYPEILAIM
FT                   RRYNLNVASAFQCGKMTMATPLANTRNLRMHPPPYPGGDSRPDPFWASQPGHHECCCSV
FT                   QRGQCAGGDKLGNLRVKNDTVICETTTAFALGDVVAPRSLVLMPRARRFFTHNRDKKPA
FT                   DIRSAKSISGSESGLLHKLPRSKHDMRVQPRQENIVLHFMSNRYGRVPGPQMPYAMFQI
FT                   WAIPYPYALYGDIDCRGRQSSY"
FT   CDS_pept        719554..720083
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(720269..720913)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(722187..722881,722934..723021,723090..723917)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824336"
FT                   /orf_name="Pc16g03210"
FT                   /product="Pc16g03210 protein"
FT                   /protein_id="CAP92991.1"
FT                   /db_xref="UniParc:UPI0001831DC1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y1"
FT                   /transl_table=1
FT                   /translation="MSSTTPETMTQRSPVSTKVEHEDFLMNKIIEQFRQLTFDPDFQKA
FT                   SATYSQVKDQQDQIQIRDEKLDKLQKHIKAQEENELVALSRFSAVNQALTTQKEKAEKE
FT                   NASLRKAVIEREKSLTEISRRIQELQGQIQTQLSERSQDERRMTSIIAQHKLDIGSLQR
FT                   RLTERDTSVDEMKATTANLESLLAKEQTKSVCLETEKKSLDENMQMARSRLEKFDAFIL
FT                   ESHQIDEQSIIDRFEGIWDYAINEIWTVLRQNLSDENLKNDRAWKKFRLDTAAAIRDGA
FT                   IQGQPAPLSASNSDAAKGMRLAVMLGILSREIDNEIFQPSYFPSETGNFRMSLNKLAKS
FT                   DNEKERFYRSVLLSIDRDGQETELQSRAKSVVQNVSHYLYELLSTAQYGELKERIKNVV
FT                   DRAIEVWRPIQNSTKRYETEFDPVDWAHDEDSLFQFPVGGEDTIGAEHQDDHLCVIFPG
FT                   LFSLERDDALILTSVVPLMSSQRLYVAANQELREEVRGQSSPTTKQPSRKRQNSVAKAQ
FT                   SQSNGIGFLGGHSSGGSSN"
FT   CDS_pept        join(complement(730307..730464),complement(730145..730247),
FT                   complement(729900..730085),complement(729748..729848),
FT                   complement(729553..729692),complement(729424..729485),
FT                   complement(729247..729383),complement(729075..729192),
FT                   complement(728871..729024),complement(728545..728809),
FT                   complement(728439..728493),complement(728160..728364),
FT                   complement(727869..728104),complement(727456..727818))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977568"
FT                   /orf_name="Pc16g03220"
FT                   /product="Pc16g03220 protein"
FT                   /protein_id="CAP92992.1"
FT                   /db_xref="InterPro:IPR020864"
FT                   /db_xref="UniParc:UPI0001831DC2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y2"
FT                   /transl_table=1
FT                   /translation="MGESKENLFNVWTYDKAEKTKITDRIVIGSIKDNATLADIREALI
FT                   KSKLDSKKARFPFCSKDGARIGDDAKWQLYKELTAGAPTKQSSKNGDDEQPTEGASKEG
FT                   DTPTLSITAHDVYFELSEEETNRKYGELGANVQKLLDTPLDLELGKDKVNLLRANIADF
FT                   ELEGYNHKQWKSKASSTDAISAGSLSDADWDIVSRTTHFLNGHRMVFLENAGGRRKFQR
FT                   IDKAPYPARSLDEMGMAGPNVTLPTDNPKTKILYKYPLYTVTDDSYVNVFETANALSNS
FT                   LASSNFSSMDVEASIGGGLFGYSAAAKGGFSKSDSDALATSEQSKQRTMNITYNFPRVV
FT                   LHLDNDTLELTKGCKEALDHIIKLREDPKVASWQERRAIIKFYQKFGHFFATNVELGGK
FT                   LFSKEEFSSSDVGKTAEKSNAMKISAALSFSSPVVQASASYSQESQSASGSASQTSNMS
FT                   KALSWEAVGGDTTLCNNPPEWSSTVKPFKNWRVINQKDVMAIAEFIGTFPDYGKIPEMF
FT                   KMISNESSQKTPCRFLLQADPGDDGKIKGIQYYGLRKDNGQTRNEGMFDTLRDWCLKDE
FT                   EVVNAFGVDGINKSTNNAKYKFKQDTYTDGWHEWVGIDPQSSRTVGGGCIFELDVETQL
FT                   GRPPRLTYNTPYKLFNKATKSYLAADVGWDAKIAGRTMGLLFYSRSDARIGTFVFQKAN
FT                   QPSATGTIDEGANVSLHLCDENNVPIGQVKRNINDQSTLGVERSDCELKFLFVTNNAYM
FT                   RYDESDN"
FT   CDS_pept        complement(732278..733354)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076671" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947690"
FT                   /orf_name="Pc16g03230"
FT                   /product="Pc16g03230 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP92993.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001831DC3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y3"
FT                   /transl_table=1
FT                   /translation="MAPLSEIIKLEPEREPWCAGYAPSQGRRCHARTNARGRSSAMMLL
FT                   NDGSKDLRVGRNIDTLLEDLAPHVLCIRFHKSQASDLVRRWKRQVRTYLDSQVVSTPYT
FT                   RPVRTSSQRIFEPAEANMEERIAILHQELRDAEEEVRRLKLAQSGLPVNTNPRHYEGRN
FT                   MSAVVNSSSTGSTSSRNPPVNCLNETLRGDLTESSTNRSAIAVPRPVQAQASRQTSAAS
FT                   ISSTRSLNTATMPRIFSSPGNTASQGETFQPNRREIEGECGICLNDLDGPQDEDLDAGE
FT                   GSENSGGYDHGDNDQDKDDEEDNYDGYDDDGDDDEPLNELVWCKARCGVNFHKRCIDQW
FT                   LETDQAPTCPACRSNWKH"
FT   CDS_pept        join(737147..737190,737258..737410,737470..737545)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166313" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947691"
FT                   /orf_name="Pc16g03240"
FT                   /product="Pc16g03240 protein"
FT                   /protein_id="CAP92994.1"
FT                   /db_xref="InterPro:IPR018824"
FT                   /db_xref="UniParc:UPI0001831DC4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y4"
FT                   /transl_table=1
FT                   /translation="MSTEDRLNQMRGYKATLSNPNVSEEAKQNAQAMLNELGGDQPREE
FT                   LYQARGDQNKDPMRVSAGLKAAQHNPGVTEGGKQEAAEKMEGPGD"
FT   CDS_pept        join(739329..739937,739986..740216)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000288287" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824337"
FT                   /orf_name="Pc16g03250"
FT                   /product="Pc16g03250 protein"
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP92995.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="UniParc:UPI0001831DC5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y5"
FT                   /transl_table=1
FT                   /translation="MIHRRVLKPYAAEFLGTALLIVIGDGVVAQCLLSDYNYGTWLSIN
FT                   VAWAAAVSLSSYLSDPSPTINPAVTLCLALVRPYEGQWKQVPGKLAAQFLGGFVGAAIV
FT                   YINYRSAIKAWDPEYTIPGGSILSPVGHHSAGIFSTYPGAFFESNWEAVFSEMLGSAVL
FT                   MFGCLSISDPRNAHRLPAPQIALFLLLLMIGAALGWQTGYAINPARDFGPRLFSAIIYG
FT                   REVFTAANCYFVVPLFAPIVGCVLGAATYDGMLFEGEGSRIADALDEAENHGSLRLQ"
FT   sig_peptide     739329..739415
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y5 "
FT   mat_peptide     join(739416..739937,739986..740213)
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y5 "
FT   CDS_pept        join(complement(741607..741695),complement(741494..741547),
FT                   complement(740462..741422))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000046976" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947692"
FT                   /orf_name="Pc16g03260"
FT                   /product="Pc16g03260 protein"
FT                   /EC_number="4.3.1.17"
FT                   /function="L-serine ammonia-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAP92996.1"
FT                   /db_xref="GO:0003941"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI0001831DC6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y6"
FT                   /transl_table=1
FT                   /translation="MGHFDKHELKKPWIETPLIESATLSKAAGCRIFLKLESLQPSGSF
FT                   KSRGIGNLILTSLSDPSNNGRTLHFFSSSAGNAGMAAVIAARDLGCPCTVVVPLSVKPT
FT                   MIEKIRAAGASDVIRHGASWFEADAYLRENFIENEDSKLDPLVRNIYVPPFDHHDIWRG
FT                   AGTLIDEIVKQLPRHNGEPDTDRSFPADAIVCSVGGGGLLNGIIDGLERHLPAYQPRTL
FT                   PNKEAKKVRVLAAETAGADSLAHSVRKSYLHTLPAITSQAITLGALCVARQTLKNAQSP
FT                   PPGVEVTSIVGTDADAAKGVVRLCDELRLEVELACGISVQVGLDRLREVMPELTPDSRV
FT                   IIIVCGGNDVSPEIISDYRQKLANGWR"
FT   CDS_pept        join(complement(742485..742987),complement(742138..742417))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824338"
FT                   /orf_name="Pc16g03270"
FT                   /product="Putative uncharacterized protein Pc16g03270 "
FT                   /protein_id="CAP92997.1"
FT                   /db_xref="UniParc:UPI0001831DC7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y7"
FT                   /transl_table=1
FT                   /translation="MYKVFTLISLFLPVHVTATPQNHDHALLRRDACDGIDSMPVLYHD
FT                   YLSDVCPPKHLNNSEGICDHVDYRSNSCVGFCQLRTRFVYGREFPLDVWCNGPPCKIAD
FT                   FTRIMTRSVDIEPQFEKGLNDGISGGWQSKTTADVGPRGMSYKMPLKAGQCGYWSWVPI
FT                   KKTVCGTMSYQQTEAHRCVDDMHTVENYCVDALQRYPDGTVDGETIFVYTDCMTRLPLP
FT                   MDQQTIIYRLPGVALNQGEHPSAQELGGYPSDSEQQVL"
FT   mat_peptide     join(complement(742485..742933),complement(742141..742417))
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y7 "
FT   sig_peptide     complement(742934..742987)
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y7 "
FT   CDS_pept        join(743910..744154,744210..744322,744501..744578,
FT                   744631..744791)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217025" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977569"
FT                   /orf_name="Pc16g03280"
FT                   /product="Pc16g03280 protein"
FT                   /protein_id="CAP92998.1"
FT                   /db_xref="UniParc:UPI0001831DC8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N3"
FT                   /transl_table=1
FT                   /translation="MSLRNLALLALLGLVNAQDKIGFGPYFSLGPTSSWIREAKTTLVL
FT                   PEVPSPQKDRLALWPGMGTSGGDLIQALAVSFSDPAANCGATAGQWCTWASTLQGTQLG
FT                   GKQVPANAGDEVTMHCSGQAQGWGTAVECQDDACKGTAAAHVYADTTIILDAADSSFGD
FT                   TLAINEATSSGLKTTDNGKTWTVSTINVQAHTYNL"
FT   sig_peptide     743910..743960
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N3 "
FT   mat_peptide     join(743961..744154,744210..744322,744501..744578,
FT                   744631..744788)
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N3 "
FT   CDS_pept        join(745934..745960,746072..746110,746168..746242,
FT                   746327..746592,746770..746777,746876..746895)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208396" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947693"
FT                   /orf_name="Pc16g03290"
FT                   /product="Pc16g03290 protein"
FT                   /EC_number="3.6.4.2"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP92999.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR005334"
FT                   /db_xref="UniParc:UPI0001831DC9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N4"
FT                   /transl_table=1
FT                   /translation="MSAEGASASPIPIEDLTKITDEACENALATTKGYDHENVGDWNSK
FT                   IINSILKALITATAPDASKPPSYRFTVNSTIVQQGVIDPSVAADGALSNAGKRGMHSAS
FT                   GAFWDVNRDGMWTYKYTGAEDRGMDIVVCVTCPMDMSRNM"
FT   CDS_pept        join(complement(748576..748597),complement(748480..748501),
FT                   complement(747889..748384),complement(747678..747833),
FT                   complement(747192..747449))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208395" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947694"
FT                   /orf_name="Pc16g03300"
FT                   /product="Pc16g03300 protein"
FT                   /protein_id="CAP93000.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0001831DCA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N5"
FT                   /transl_table=1
FT                   /translation="MSVILCTAGYDHTIRFWEALSGICSRTIQHPDSQVNRLCITPDKR
FT                   FLAAAGHNNVKLFDIKSTNPNPVITFEGHTNNITGVAFHCEGKWMVTSSEDGTVKVWDT
FT                   RTGSLQRNYVHRAAVNDVVIHPNQGELISGDHAGMVRVWDLGESVCTHQLIPEEDTAVL
FT                   SVSVASDGSLLCAGNKKGNVYLWRMVQTDDTTRIIPVCTFQAHKDYLTRVLLSPDVKHL
FT                   ATCSADHTAKTFTSSPDGPPMDPVNHTLFLETTLANHQRWVWDCAFSADSAYLVTVSSD
FT                   HYARLWELGTGNIIRQYSGHHRGAVCVALNDYSEPR"
FT   CDS_pept        join(749457..750071,750129..750560)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671657"
FT                   /orf_name="Pc16g03310"
FT                   /product="Pc16g03310 protein"
FT                   /protein_id="CAP93001.1"
FT                   /db_xref="UniParc:UPI0001831DCB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N6"
FT                   /transl_table=1
FT                   /translation="MGSIDPNHAAFGLDQPAFDEQAFLNGLANLDADGPFNASNGFNYE
FT                   GNPDLMKSFDEYFASIPLDNLDMPGLDQPMSATPANCSAQPVSNNLPVHAPHMQMAYDP
FT                   SIGVAYTPEDTDADKVRKWENLIAQANLANAGVPPSAPEPIAGETVEQVTQVPDSPNSL
FT                   FDSPRSPSVEIIRTPSPTPPTPSPPQPPAATVATFSAAPNATANAARAVQLPRALTSQK
FT                   GYVQHVSPFAPVATISPPASSAANSRELENARLRIQSLAKERSFYQRNLRKATTIDPKT
FT                   GKTSLQKLHAENLSLRRTNANQAQKLQDMKDEINQEKSKFAALGAQYNEVAKRLHKAMV
FT                   ELRELKGQ"
FT   CDS_pept        join(complement(751320..751460),complement(751221..751284),
FT                   complement(751128..751143),complement(750998..751084),
FT                   complement(750631..750955))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977570"
FT                   /orf_name="Pc16g03320"
FT                   /product="Putative uncharacterized protein Pc16g03320 "
FT                   /protein_id="CAP93002.1"
FT                   /db_xref="UniParc:UPI0001831DCC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N7"
FT                   /transl_table=1
FT                   /translation="MRSVVNAQYLPSQFVEPVSGSLIPTSRLVGIIVVIKGWEYQERTG
FT                   DQGLRRVDGREGYLGLMREVDERGESAVWKRVLQSRRSSSRKKSGTMCAGSQHIRRETV
FT                   IRTHHEYRYEGTVFRIVRWLNPSRAFTALSSPQLVQVDYWCLQPGGLGITSFTSFQGWN
FT                   NPGERTSPKSHTSKVGCTGTYKQVSGYGLPSGSDYACIRNIGTENEC"
FT   tRNA            753770..753841
FT                   /gene_name="tRNA-Arg (ACG)"
FT   CDS_pept        join(754317..754499,754567..755292)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217034" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671658"
FT                   /orf_name="Pc16g03330"
FT                   /product="Pc16g03330 protein"
FT                   /protein_id="CAP93003.1"
FT                   /db_xref="UniParc:UPI0001831E9D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N8"
FT                   /transl_table=1
FT                   /translation="MPLRIIEGESPEPVPWGSLPLDIYLLSEWETPHPSQPTESPSARR
FT                   RRLIRQFLALGLEGRRPYQARTETPPTPTKAQIAEILLPVRPEALRPYAAYTTCLEEGL
FT                   WLRLCYKKEEAHESIWSHNEDVAYVGPDGVVLDDEEIFGGLDLAAALEIFPERVTNGGS
FT                   SGHIKLREETLREILGDLEDDTGSGEEDYSDDIKEKVAEFRASRAKNPLLKYGLYHAAC
FT                   VVTHAFVEDEVALDGGGLLHVFWDDCGNVVRQWRVEDDGAEDNFDGAWAEGAWKENFIN
FT                   GIGELGPAYHEGGMRGPPYNV"
FT   CDS_pept        join(755459..755505,755557..755758,755818..755895)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947695"
FT                   /orf_name="Pc16g03340"
FT                   /product="Pc16g03340 protein"
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="CAP93004.1"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniParc:UPI0001831E9E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H934"
FT                   /transl_table=1
FT                   /translation="MGALTWRMGITSHLTISVWNPAVGEGCGSLKIEYYVCVGVSGDMI
FT                   PSTTAKKTTTTSDGGRVTVVPGDGCYDVAADHGISLTNFYSWNPSVRDDCSELKFDSYA
FT                   CVGI"
FT   sig_peptide     join(755459..755505,755557..755581)
FT                   /db_xref="UniProtKB/TrEMBL:B6H934 "
FT   mat_peptide     join(755582..755758,755818..755892)
FT                   /db_xref="UniProtKB/TrEMBL:B6H934 "
FT   CDS_pept        join(756722..756849,756930..757082,757142..757603,
FT                   757695..758634)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671659"
FT                   /orf_name="Pc16g03350"
FT                   /product="Pc16g03350 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP93005.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831E9F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H935"
FT                   /transl_table=1
FT                   /translation="MADQDEIRGNSVYEPEQPVTETSSPVEKPVAPKEQKKSGLMAKIG
FT                   RMLNQDVSEEMPAYKDIQIHTWDGPDDPENPFNWSLKYKWLLTITVCFISILTGLPAGT
FT                   YGSGNDWMGKEFNVQNEPFPNLYWATTSWNMGAAFWPLIFVPLTEASGRMPGYFVAYVI
FT                   LVISLFPSAFAKNFATLVVTRFFGGGASSVSINIVGGSISDVWLGDHARSLPMSIFGFT
FT                   SVVGIALGPFIGSAIVQIQKSEPWRWIFYVQIIYNAALIPVFWLILNETRPDVILKKRA
FT                   RKIRKETNLPVYAAAEIDAPSKLRLLKISFQRPTSMLLTEPVVTFFTLWISFAWGILYL
FT                   FFSSVVQTYSTNYGWGTLSTGLVQLAISVGAIIGTMINPLQDWYYLRSSRRNKEKPGKP
FT                   IPEARLYTSIPGSLLFAAGLFWYGWASQPDIHWIVPTIGITAAGIGIYSIYMAVVNYLT
FT                   DAYERYAASALSAASLGRNAFGAFLPLASPQLFSNLGFGWAGTLLGFIGIALSVVPVIL
FT                   VWKGPQIRERSKFMREAMWEPEEKVEVDRSGKEDLGPSAEGVA"
FT   CDS_pept        join(complement(760170..760291),complement(759964..759993),
FT                   complement(759809..759895),complement(759033..759747))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947696"
FT                   /orf_name="Pc16g03360"
FT                   /product="Pc16g03360 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP93006.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0001831EA0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H936"
FT                   /transl_table=1
FT                   /translation="MSETAQKPLPFVYQFAAGAVAGVSEVCVSCFRFEKRFRLDSYPLD
FT                   VLKTRIQLQTGAPVPGVDHYNGMFDCFRKIVKNEGASRLYRGISAPILMEAPKRATKFA
FT                   ANDSWGAFYRNLFGVDKQTQSLATLTGATAGATEAFVVVPFELVKIRLQDKAQAHKYNG
FT                   MFDVVKKIVAAEGPLAMYNGLESTMWRHVLWNAGYFGCIFQVRAQLPAVEPGNKNQQMR
FT                   NDLIAGSIGGTTGTILNTPMDVVKSRIQNTTKVPGQVAKYNWAWPALGTVMKEEGFSAL
FT                   YKGFTPKVLRLGPGGGILLVVYTGVMDFFRKMRDGN"
FT   CDS_pept        join(complement(761381..762050),complement(760674..761293))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208295" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824339"
FT                   /orf_name="Pc16g03370"
FT                   /product="Pc16g03370 protein"
FT                   /protein_id="CAP93007.1"
FT                   /db_xref="UniParc:UPI0001831EA1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H937"
FT                   /transl_table=1
FT                   /translation="MQILHALTVFCSLPQFATLISAEKINPSGDQESKEAETPLPASLI
FT                   LRRNAAIASQLAAGPALGVKKMSDDEGEKFFLDYWSFGNDSSSGNITEGHVSDDGFSPA
FT                   RFVAQSYPFAPSYSLGTDGDSQFLPWENSHSANNLLEKRDFKCPAGTWACTSIGRSDRC
FT                   CGSGETCEIVADTGHGDVGCCPSWKTCSGMIGSCQSGYTACSQALGGGCCIPGYDCVEG
FT                   GCAYITTITVTLHSTVMLSTVTYSTKPQDTTSTSASFSFPTTSSHSSKTTTNDGLAPPA
FT                   RPTNLSTVTSATRGDDVCPTGFYACSAVYHGGCCRTGRDCDTTSCPTISSTTVVSDGVT
FT                   IVAPAATTTEHTSGNRCAHGWFHCADTVGGGCCPMGFACGSSCTARDTAFATTVAKEQA
FT                   TASSGGSVVHRVSKMMLGMMIGMSVGVWIL"
FT   mat_peptide     join(complement(761381..761984),complement(760677..761293))
FT                   /db_xref="UniProtKB/TrEMBL:B6H937 "
FT   sig_peptide     complement(761985..762050)
FT                   /db_xref="UniProtKB/TrEMBL:B6H937 "
FT   CDS_pept        join(complement(765945..766010),complement(764848..765850),
FT                   complement(762896..764691))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824340"
FT                   /orf_name="Pc16g03380"
FT                   /product="Pc16g03380 protein"
FT                   /protein_id="CAP93008.1"
FT                   /db_xref="InterPro:IPR005613"
FT                   /db_xref="InterPro:IPR022782"
FT                   /db_xref="UniParc:UPI0001831EA2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H938"
FT                   /transl_table=1
FT                   /translation="MASQQSGRSSSASSRSQSSKSQIEKSVTHLLVATKQLLETLTQWS
FT                   RKQASENDVSDVYVRLGYEFNLACRAFSAIGVDTSDLGPVPDLLRTILEDTLSQDASSQ
FT                   SLDRYLPRIRDIIINLLKGLKKKQARLRSRHQREDGRPVPGRQASAGSIASGQAIGQLY
FT                   DEAAASTMPSTAQSTSQSPRRSNRRYGSGGSLEDQPAIARTSSAPSTSEPRANFTERET
FT                   SRREAQQMLSQPTPFDNDTTPRANAPNNTAPSTYITPTGFSAPPPPPPPKEDDALGALQ
FT                   RSGELERRASRRFSAYQIQKHLGTSTNGVPVLPTQNSPIPNRGRDVRESLNAVRLRGSF
FT                   AHTRQRSNNRLQEAAKMEATIVPPPIIPVPQEKPTLEDAFEPAKPTPQTPKGDSFGPSA
FT                   EVGTPLSAIQFATEQPSPGKELTLFLQYKSKIKKYVLPEGIAELTIGRLQLAFIEKFAW
FT                   NTHDNGVDLPEIYIQDPISGIRHELEDLADVKDRSVLVLNVDNLDEVKKHFDDSLGSVR
FT                   LLVEGVKETLSGQGNIIQRVSDRQLEAAKEIARLAASPPANSAPAAIGGNSKASIAGSG
FT                   SQIAELQSLRRDLAVLRQTYSNFTADITGSMSAVRAKASKVRTAADDVATPSYEGDAGR
FT                   ARVNTGKKELAAESERLVARVDDLQDLVEDLRKDVVTRGVRPLPRQLEGVSRDISMVMK
FT                   EIKKMQDFLGREKPIWTKIWEKELQLVCEERDQLTMQEDLAADLQDDLEKATQTFALVE
FT                   QATKEQVLTNATGGTAVRAPSRTLGIDPTIDPMKAKDGVLGEVRALQPNHESRLEAIER
FT                   AEKARKKELETRRIGLFQKELGAFVEEGKLKKSGGFEETERLRTAKDDRIRKEVWDRQQ
FT                   ARNAEMEKAEAEAAAAQAAEQNKEGEGDDDQQEGEKEVTREDGDEAEEAAEKAEEPKSP
FT                   SSDAAKPLPKSPEEDNGTSEQPSA"
FT   CDS_pept        join(768867..769024,769293..769482,769536..769809,
FT                   769868..772201,772255..772460)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208317" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947697"
FT                   /orf_name="Pc16g03390"
FT                   /product="Pc16g03390 protein"
FT                   /protein_id="CAP93009.1"
FT                   /db_xref="InterPro:IPR009604"
FT                   /db_xref="UniParc:UPI0001831EA3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H939"
FT                   /transl_table=1
FT                   /translation="MASALNSVAANNASGNASAGAPNPGRSTLRSSNSTKGSDNRRQSG
FT                   SPIDGGQRRTNSHKAWTQGTNPITQRSSYTSSNGNMTHQKQSGSSRLNQKESNTPDSHA
FT                   HDRLVFLFASFTGLHTTITTKSGEKFTGIFSSSTMEPNELSFLLKMVQRTSQEGQPRAN
FT                   GISDVATPYIGSAPEHIMSFDIKDVVDIAVPNVTTAEVSAKEPNGASQGFRTDSDISGN
FT                   LAMRERTLQRWEPAETDIDMSLETSNTSAGWDQFEANERLFGAKTNYDENIYTTRLDRS
FT                   DPNYKQKQAEAARIAREIEGQDVDNSHMREERGLVAPDTGDQDEEDKYSGVRREDKAFP
FT                   PLLSGQPNKYMPPGRRQAAPQSTATPSASTKQPVAPVPTAPIPIPSQAVAKETTPADQQ
FT                   TELVASLQPTTDTEQKSALGKGVTPPVSTASPAPAGKRTAPENATANVEVEVLDHFRQF
FT                   ANSEKIKMQERRRNQASYDRTMKLNELMKFSKSFKLSTPVPKDLVPILAKDRLKQEAIM
FT                   QRALQQGDDKATPKVTTPPTEQQPPTRGAGPSGAVPPSAPADRQNYNRTRQGYPPAGPL
FT                   AGAGGRFPQQVPPGRPGVGMLSHRLADNLQQRKGAGMGPVPTPLPIQDARGPPTGPASD
FT                   QQRITSPVKSQAGSSAATKFNVKAMEFKPNPAASTFTPGTSGTAASPRPFSRNRSVSRA
FT                   TTPTAFFGSRKPLPVSERPSISDQFNPIKRMKKEHAETAERLIMLNGGIPPPYKTLPTW
FT                   DIADGSEEKTYDEMFKQPVAVPTVPPQGRSVSNNTNIPQQHQVPFHFQQGNPAMPPSSG
FT                   PSNGPHGLHSQGPHGPSHVDDHHRMQLSASNSQVFPSPRMQHGYPSPMAPHAQLSFPQP
FT                   VPQFYGGPQPGHIRPFQGGGPQFVNGAPMMVQQASNGPYMGVPQGMSPYNAQMPMYSPN
FT                   PGHAYPQHTPQPHSGYPSPSRGAPMMMHQNSQSGQPPQSMMFMPGQPGYPQQSGHMPPN
FT                   RGNYPQQPHFSSSPHQSHHFPPNQHRTPSNGFNQMPQMPPQMPAATPATTPGASHPAEA
FT                   TDEGK"
FT   CDS_pept        join(complement(775039..775141),complement(774656..774781),
FT                   complement(774180..774448),complement(773994..774101),
FT                   complement(773758..773905),complement(773527..773666),
FT                   complement(773363..773426),complement(773044..773228),
FT                   complement(772518..772643))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947698"
FT                   /orf_name="Pc16g03400"
FT                   /product="Putative uncharacterized protein Pc16g03400 "
FT                   /protein_id="CAP93010.1"
FT                   /db_xref="UniParc:UPI0001831EA4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H940"
FT                   /transl_table=1
FT                   /translation="MWQVGDCLGCPGARVGAANGQGFNMRPVVRMRSIVNAHSHQSTVD
FT                   SPIEQSKCPVAFPRVSIQPATQVALSNDANSELCSDHDDILLRSHSRQPTSHNNIPTAW
FT                   PPLFQQNTNVSRRNAGTLQRDPSQRTHGWWPRWTKRRWSWIMGDIVYIYASVRPELVSQ
FT                   LGLVHLGIVSLKCFGDSVHRAGSMARESMGNGEAAPLSGGKVWVVGGNSYGVLGGLGVE
FT                   RILAGGVLLAMRNTGFSIVFSPTPWGGIPNGEVCWLGCGLEVFGFCDAWWCFGGLFWGL
FT                   FMAGVWAEESAMGRSTAGWFAAADICNSYLASSTSTVSGGHRSVGAICTVKFTHLQPHV
FT                   TASLAPPDRSPSSTSPFDQPSSPPRRNPLQTYFPPWKMQSPNSNVLRTASVTGKQMKTR
FT                   SWKSNRGIGVGGCQQCRARASHS"
FT   CDS_pept        join(775158..775280,775353..775490,775548..775658,
FT                   775718..775864,775934..776307,776371..776665,
FT                   776716..776919,776970..777142,777195..777960)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208340" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824341"
FT                   /orf_name="Pc16g03410"
FT                   /product="Pc16g03410 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP93011.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831EA5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H941"
FT                   /transl_table=1
FT                   /translation="MDFLKSAIGSAIAKGGGLPFSLGDRVDIGDTVWALHNGTKRDDGS
FT                   ACSVFAFDINGNKSRLPLAKNAVRKSRTLRHPGVIKVLDTIETEHNLYIVTERVVPLSW
FT                   PVKRRSLSEETAKWGLYTVASTLKFINDDAASVHGAVRASSVFTSESGEWKLGGFDILS
FT                   SMKEDDAIIYTYGSSVPDAARYTPPEVVKTGWDTIKRNPLAAVDAYGLGILIFEVFNGG
FT                   FSGGDQAGKTTNIPPSMQQSYKRLCTANPKLRLSPGHFVEQGKKQGGFFQTPLIRMTED
FT                   IDSLGLKNDAEREEFINELDDLSGDFPEEFFKMKVLPELLKSVEFGGGGPKVLGATLKI
FT                   GAKLSAEEFNAKLTPVIVRLFGNPDRALRVCLLDNLPSMIDNLPQRVVNDKIFPQMTSG
FT                   FTDVAPVVREQTVKAVLTIVNKLNDRIVNGELLKFLARTANDEQPGIRTNTTICLGRIA
FT                   KNLSQSTRSKVLIAAFTRSIRDPFVHARNAGLLALSATIDVFSEEDCAVRILPAICPAL
FT                   LDKEKLIRDQANKTLDLYVQRTRKYASTMPDTVLPPAAPAEVNKPDARVGTPSDNSWAG
FT                   WAISSFTNKIATANGEIEPTANTNKTLDPDTARSASVPRPSKPTPPTELPKQVLRPTAQ
FT                   PLNRSMSDRPAPVVHDEEPEEEGDDVFDAWGAMDDDEKDDDPFTAAVATPKPTSPVPSS
FT                   TKAPVVPYDDGGEPDFAGWLAAKSQTKAKNPLPKGLTKTASANAVTTRSTISSAKPRTV
FT                   VAPKKIDTKPKDEEADDWGDAWD"
FT   CDS_pept        complement(778253..780637)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824342"
FT                   /orf_name="Pc16g03420"
FT                   /product="Pc16g03420 protein"
FT                   /protein_id="CAP93012.1"
FT                   /db_xref="UniParc:UPI0001831EA6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H942"
FT                   /transl_table=1
FT                   /translation="MSKGKRRRRHSKAVQQTQPPAPSLPTPVTEPGRQRKRKRNHHKAK
FT                   KRPLSSSQVYRKDGLNSESPQGGSSNHPPTDQERKNPRSVHSSQVKVQEQRSPAKRSTT
FT                   PLQRAPKTKGGYGSDSEFEFEYINKAQAQLKPRVALRSPPSSPQKVAGPKNTTPVSGNE
FT                   RGNDVRAISADGDSESERERELASPSPLLPSPQRALPLENTTPVSNHDRQRTSRGASLS
FT                   NTTLESQPVFTPEPERRSSQSSGTSLERVVGHEEATPASYSVYGHRIRESSASDTDVEP
FT                   ENASEAEPGHGPEWSLSSSSPCNKTARNRKRPNAHIASRRKAAPLPAPSSLDCLPEIES
FT                   EPTLPSMDNLTFSESALRNFRVDHWRKACEPKEPPLPSRSDLSKVIGPSSPSVFVLMSE
FT                   FQPPESEVESRYASPSPTQITPASSPPVPPTVPRVRSRVRSRLPSPQRWLSRLGRPVQK
FT                   PALRETVWTSRLRPTCEIYFTNKPLLINSMRYPHLSAEFPPDAHGNPEFEFWDNSDDDS
FT                   DFELPEDIEPPEAKRRRLWSSEDSPETELAERESSLESEELSELELLESSEPEAHIDLE
FT                   PLLLDIAGSSDPQPLPELERSSDTGRSSNRESEHPHPPTSIRDELPVRQSRQLNKRIDE
FT                   AIARDKEENPKFWGGSWMKEYERGVPIKERAEAEYKEEMAKKKEEAETKKREKQERDRI
FT                   LKEKRERKRKEMAEQKVRLEREKQKRMEEQERQQKERQKREELERRRAKARAGKRPKNV
FT                   ESALQEMLDERETTDVEMSVDPEGLKVAQTAYRLYMRKKAR"
FT   CDS_pept        complement(781313..782782)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000221615" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947699"
FT                   /orf_name="Pc16g03430"
FT                   /product="Pc16g03430 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93013.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="UniParc:UPI0001831EA7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H943"
FT                   /transl_table=1
FT                   /translation="MRLVLSRSSFSVMHLFLIAIPLCHALVATPSIPEVDVAIIGGGLS
FT                   GLSAAKELAAANKSIVVLEARDRVGGRVLNANLAGKDVQELGGEYIGPTQNRVLALAAE
FT                   LGLPTYKTYTEGNSTFYRNGTARHYKDGLGGIPPVGLDTLVELAVFMTDINNLASTVDL
FT                   EEPWNTPNATALDSMTLETYVNSKLSTSDSRVLLDVAIPAILSTEMKEPSLLYSLWCIA
FT                   AAGDETGPGTINRLIGVDGGAQDSRVSGGTQLLATLLAERLGSENIYLDTPVRKVQLKE
FT                   SRYLVSSDENTVSARHVVCAMSPPLVTRITFDPPLPAGRDQLNQRMPMGALGKAIAIYP
FT                   SAWWRDEGLNGVGVSDTGAIRVTYDNSPADGSFGAMMGFIEADEMRKLDTASEDEVKRQ
FT                   VKQSFANLFGPRVDDATDVLIQRWDLEEFSRGGPSALMPPGVLTQYGSYLRAPVGRIHF
FT                   AGTETSLRWIGYMDGAISSGERVAGEILENW"
FT   mat_peptide     complement(781316..782707)
FT                   /db_xref="UniProtKB/TrEMBL:B6H943 "
FT   sig_peptide     complement(782708..782782)
FT                   /db_xref="UniProtKB/TrEMBL:B6H943 "
FT   CDS_pept        join(complement(784730..785049),complement(784542..784560),
FT                   complement(783190..784491))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947700"
FT                   /orf_name="Pc16g03440"
FT                   /product="Pc16g03440 protein"
FT                   /protein_id="CAP93014.1"
FT                   /db_xref="UniParc:UPI0001831165"
FT                   /db_xref="UniProtKB/TrEMBL:B6H944"
FT                   /transl_table=1
FT                   /translation="MASDQRFQRTVQAVAEAVQTFAVGTFDFAESIKKIWGPQTQPDAV
FT                   ETSDPLPVEGMQDVQTVDQLRDRTPVSQDSDHLSTHSHSYPLSEAMDDGESYVMHERIA
FT                   PSEQIPCQMIPADGIGKILHYKMEAGIYLTMQNGFGQIERQRFVDVFREAAELLGISLP
FT                   SPIADLPQQQVGSKRVYQGSDDQQPVAKRQRTQDLLQEDVQGAPEDGEFSSSEEEEVAQ
FT                   IKVQLNRQERSPVKIPDQVPVVHKMTQEYVIHPEEENTGSSSFTQKESSEHSSSEEDGD
FT                   DYFSEEEEEGVQNPTKEVSQAEHNAKAKTAIRPQDEHSELSSCSSEDESSEDDSSERES
FT                   DDEAEPRQQQTTKEDSPKGPTYNSKEPIQSPDDKSSDSSAEDESSDELSEAELEEQIEK
FT                   HLATPEAFFQMEPILLEDSDAFESSASSSEDESSSEESDDEQEEPKQQPTTKEQPPNKG
FT                   GTHNSKEPIQLTNDKSSNSSSEDESSEEESGDEPEGPKKQPAVKSEPQRREERPEEPIE
FT                   VAGGESPSPSSSSSSSSEDESSEDSEIET"
FT   CDS_pept        join(786192..786440,786504..786625,786684..787255,
FT                   787304..787932)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169152" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947701"
FT                   /orf_name="Pc16g03450"
FT                   /product="Pc16g03450 protein"
FT                   /function="chromate transmembrane transporter activity "
FT                   /protein_id="CAP93015.1"
FT                   /db_xref="GO:0015109"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniParc:UPI0001831166"
FT                   /db_xref="UniProtKB/TrEMBL:B6H945"
FT                   /transl_table=1
FT                   /translation="MPLAPFSQALSSLARLNEKRASRVSSENEGSVKPLPTRLLDVFLR
FT                   TWDLGFTAFGGPPVHFQILHSRFVEGKGDKEKWVDEQTYQELFAICQGLPGPGSTKMVF
FT                   CLALLHAGFIPAMLVFLIWALPGAIGMYALSLGVQSMSETLPEPAYALLSGLNASTVGI
FT                   VALAAVQLAEKAIRDKISRILVIFGACAGLCYNALWYFPVLMVIGGFATTIWDGWMYQQ
FT                   FLRAKLAWKNRHHRPQQADEANGDSIAMDDTALEENGVQRSETPRSRRADRRVEGLPQN
FT                   TGNTTSPTPPVEAALQQHIIRIRVGVLIMCLFFASFIAILVARGQLAAPPLVLDLFANM
FT                   YLAGTVIFGGGPVVIPLLRSYVVDPGWVSSRDFLIGLAIIQAFPGPNFNFAVFLGALAL
FT                   QRSQFPTVFGAFLGGLGIFLPGITLAVAIQSFWRVLRKKKYVVDFLRGVNATAVGLVFT
FT                   AVYRLWEIGYLTSERNNGQSLGKEPWWVVVAAVTYSGSAWFKVPPPVAIVMGAILGLCW
FT                   YGAVGR"
FT   CDS_pept        join(788358..788621,788704..789392)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(790621..791033,791093..791204)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824343"
FT                   /orf_name="Pc16g03470"
FT                   /product="Pc16g03470 protein"
FT                   /protein_id="CAP93017.1"
FT                   /db_xref="UniParc:UPI0001831167"
FT                   /db_xref="UniProtKB/TrEMBL:B6H946"
FT                   /transl_table=1
FT                   /translation="MVHQTDMLAPPEAASFYITPEYADKLANKTIPWVRQKLDTDNLGD
FT                   RLFATSRVQEADPDDILQRNKYRTIILGALMIRAGARIKAADLQHLRDLVPQINCTSRR
FT                   MLFDHGFRTPGKVQFLAALDYYQPGVPRSFQEPSCFMCGKIEDDIGHTPLQCKKCKVAT
FT                   YCGKVSRMDTS"
FT   CDS_pept        792281..793333
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076676" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671660"
FT                   /orf_name="Pc16g03480"
FT                   /product="Pc16g03480 protein"
FT                   /protein_id="CAP93018.1"
FT                   /db_xref="UniParc:UPI0001831168"
FT                   /db_xref="UniProtKB/TrEMBL:B6H947"
FT                   /transl_table=1
FT                   /translation="MTRLTTIFTTLYALYSLPLISAWTFVWRNAANNPTVEKGTDAQSC
FT                   KAIDHAKGKDFKFDAEDSLFRIYMYGSPNCTDDNIESAEDYLARNSTSPLRAFAVIDLR
FT                   GANTSTGGELTPFPGADWFKSSPNSPIITAMGERLVAENCGKYRVGPGPQWSEVDRESY
FT                   QCWQKKLGYTGTDANGWPGKTTWDQLKVSLTDGNDGGSSKTTETPPSATTSTATSTGTG
FT                   TGTGTPTSTSVPDTDTSSGSALSGGEIAGSVVGSVAGLGLVGAMIYLSRRIFRHRAPAS
FT                   GDEGPEPDSEGGAMAVGGSKRWAREKLPFEVEADPAKNRKKYISELPGDTAAAELSDSR
FT                   RVLELGDSRT"
FT   sig_peptide     792281..792346
FT                   /db_xref="UniProtKB/TrEMBL:B6H947 "
FT   mat_peptide     792347..793330
FT                   /db_xref="UniProtKB/TrEMBL:B6H947 "
FT   CDS_pept        join(complement(794658..794946),complement(793702..794442))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(795553..795885),complement(795163..795495))
FT                   /pseudo
FT                   /gene_family="HOG000166324" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(798588..799796)
FT                   /pseudo
FT                   /gene_family="HOG000209827" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(801679..803790)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216303" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947702"
FT                   /orf_name="Pc16g03520"
FT                   /product="Pc16g03520 protein"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP93022.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniParc:UPI0001831169"
FT                   /db_xref="UniProtKB/TrEMBL:B6H948"
FT                   /transl_table=1
FT                   /translation="MALTSGLQALTVDDTSRPACKPLITTPVGEEETAPAEPNRSSNSK
FT                   EKKMETPQECVGLDASLSRIYRYHPIPTLIVDKSLCVVEVSDSHCAFSGQSRDELVGTC
FT                   VCDVPVHTIPAPDTPTLYGALRTAIVSEKVQILDGIHVKSKNSIYQLRITPIFEKSSLI
FT                   YVVLEAQNAPQDHCVGTDEQHANMNEIYKILVDTMKDYAIFMLDTRGNVTTWNLGAELL
FT                   KGYSPSEIIGKHFSIFYSPADLDIDKPGRGLARALRQGRMEDEGWRYRQDGSRFWANVL
FT                   ITPIYQLGRHMGFVKVTRDLTERKAAEQRMIVAFEESAKMKTDFLANMSHELRTPMNGM
FT                   QLALAMMKDSDLTEQQLEYASIIEDSTSVLLRIINDVLDYSKLSSGSFSLHSDVVEIKG
FT                   ILDAVMRNCRSLLKPGVELSCLIPPDLPKFMRGDPLRYRQVIQNMLGNSVKFTETGYIR
FT                   VSTTFSPVESDPETYTVTTEFADSGVGIPDCALNTLFTPFTRFADSSTRKYQGTGLGLS
FT                   ICKSLAELMDGTVGYRPGPQNKGSVFWFTARMGRVGTGYSNAQPAIPSTDDAKDLLNRV
FT                   RGIAPRKRVLLVEDNLVNQTVMLKLLQSLEFERIDVAGDGAEAVRQVKQTPLSYNVVLM
FT                   DISMPVTDGLEATSQIRGMGIDVPIVALTANALKGDMETYLANGMNDYIGKPVNRDQLL
FT                   QVLWKWIGA"
FT   CDS_pept        complement(804873..805734)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(809678..809749),complement(809162..809611),
FT                   complement(808975..808980),complement(808788..808916),
FT                   complement(808623..808676),complement(808360..808519),
FT                   complement(808322..808329),complement(808056..808260),
FT                   complement(807395..807410),complement(807170..807365))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947703"
FT                   /orf_name="Pc16g03540"
FT                   /product="Putative uncharacterized protein Pc16g03540 "
FT                   /protein_id="CAP93024.1"
FT                   /db_xref="UniParc:UPI000183116A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H949"
FT                   /transl_table=1
FT                   /translation="MSLLLIHYIRNFGYTTKDGASSWQRKGPTALRKRCGDYPICYFNA
FT                   LSHDQEISGVQVASVSLRLPIYCAVNYSLSGINLWALRRYVRQFQPDNVERSRSSGLRA
FT                   AVHCAYETAPLSIFDNHKWRDPHLAPVGLFIYMLVGTKDIHHAIADDVDLVSLPANISL
FT                   LSPSIQYNALRWTHNAFIGAEVHIFGNFALQVPGSAILIHKCEADAFYLSSKTFSKKYL
FT                   EVQERPLEMIMDQLRIISLSKIELTWASFRHQRIPSGDSEVAQLLWFPEDISSRPAVGL
FT                   VPGSRKLTLGPKGTFVWVAPLCGNTAATLDHKDDLQVGIATIVKNPARLTYSIIVSITI
FT                   AQRPVRLWQTTAFARRIRLLEVILVSRLVQPLAAELHTKVMGYRPSALSFQQPLALPSI
FT                   CLWEVHFSILQGDLPREQPGISFSSYDPGERY"
FT   CDS_pept        join(809986..810007,810201..810266,810382..810489,
FT                   810587..810694,810788..811010,811113..811202,8
FT                   11638..811704)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977571"
FT                   /orf_name="Pc16g03550"
FT                   /product="Putative uncharacterized protein Pc16g03550 "
FT                   /protein_id="CAP93025.1"
FT                   /db_xref="UniParc:UPI000183116B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T5"
FT                   /transl_table=1
FT                   /translation="MDLWGEAGAIALMIIGDESRHWVQSLSDGVDPVKYPKLDFLSPTP
FT                   IPGDTAFLDRSPRQQQYNSGATGLDVAVASWAVTLPVVKTFTDYFTPASIRARDFAAKD
FT                   PRTYAPIVSHFLQQSLDDWMPSSVASCARLAAPWSCFTVSEAMPSIGIQFYRLVRNVLP
FT                   IEDFWSWVTSYSIRFYGICLADSTNASLSALSIHHPLFTLLSRGQSRDQHEQLSQSEPP
FT                   TYLPT"
FT   CDS_pept        join(812947..813329,813389..813495,813562..814222,
FT                   814275..815358)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182535" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947704"
FT                   /orf_name="Pc16g03560"
FT                   /product="Pc16g03560 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93026.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000183116C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S2"
FT                   /transl_table=1
FT                   /translation="MDSKEARTFSPHDNALGATSNETPASSVQSWFDRHPNTLESNVSS
FT                   ALSSNPSQPLTESLASQPPIEKIAIPRGPDRRIWKSNRRVSRACDICREQKVKCSGDRP
FT                   ACRRCHEGDITCIYTDGKREEEARQSAQLMSQVRVYEDLLRSLHPLLDRQLAIQIEKVV
FT                   STPSTTPKTTPDTQQVQRNPIQPTDHTIEDFNRSENTQAAGLLGRPSEVAWLSRLHCEM
FT                   DQHMKPEYPLGRSEQTPLLSTNYFLDDLQNPMAYPNEFLEWPSEEAASQLVDSYFHIVH
FT                   ASFPFVGKLYFLKQFRIFYANPRKQPGWAWMAVFNLVLAIATRHSSLMRKEPEAGTGTH
FT                   MSYFTRAWQLCMRNYAMFDHPNLQQVQVESLMSLYMLSIGHVNRAWRMCGVAMRSAVAM
FT                   GIHLRSESESISYISKETRYRLWWALYSLDIQLCSMTGRPPNMSLEYCTAFLPAPHREE
FT                   DFHEDHVSRFIADDHTRRALFSSFISRAFKLDGQGNNLHAEPLHHSAISEEDDVPRIAS
FT                   VASTAKPNASVYFLYRLSLTCIGRAALDEIHSPSTASLSWDELESTIAKNNASADDWLA
FT                   ELPHIYHFEKPSPNCPFVRQRTSLAFQFYSIKLIILEPCLRRAIRVSFDGPCSKHCQSM
FT                   ATLCMQVAGSVINLLCDKVDVRWLYGYCPWWSIVHYIMQCSTILLVGLVGQIDLGEIQN
FT                   AATVRNVKKACGWLFEMSKTDDYSKRAWGIYSRLAAHHNPDLVLPSTSTS"
FT   CDS_pept        complement(815712..816176)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        816215..816769
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947705"
FT                   /orf_name="Pc16g03580"
FT                   /product="Pc16g03580 protein"
FT                   /protein_id="CAP93028.1"
FT                   /db_xref="UniParc:UPI000183116D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S3"
FT                   /transl_table=1
FT                   /translation="MRFTFAPDTFRLISHTQWLQTGFNLVLGCKLAVTGAKYAPRSPHV
FT                   RDLCSALNMPGVLRAALQRIQWLSKDRVTVDGKQHSKYFYEAWLCRILVWFEQKYHLVP
FT                   SEDTTQISTGPSTLANSATSQDVPLTGENYGATQVAQVDDTALWPDFLWNISTDDILNG
FT                   YMGFPDMPYPTLQPGYHVPLP"
FT   CDS_pept        join(complement(817205..817364),complement(816879..817155))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(817906..818299),complement(817614..817837))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158505" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977572"
FT                   /orf_name="Pc16g03600"
FT                   /product="Pc16g03600 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP93030.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000183116E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S4"
FT                   /transl_table=1
FT                   /translation="MGSATNSLVLELATPEDIPAITEVWFASFTQPVIGKLFPNTPGMH
FT                   QWHRDWHLGDIQKPHHRYLRVVDTESKDEQGRPRLVAFGKWDLAMPDERGRRFPQWHAD
FT                   SPYQECEDFIAELEQARKRVMGDEKHYYLDTLGTHPDYQRRGAGSMLVQWGCDLADKDG
FT                   VAAYVDASKEGASLYLKHGFVNFNPPGSDVAAMARRKAAPSC"
FT   CDS_pept        818395..818739
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947706"
FT                   /orf_name="Pc16g03610"
FT                   /product="Putative uncharacterized protein Pc16g03610 "
FT                   /protein_id="CAP93031.1"
FT                   /db_xref="UniParc:UPI000183116F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S5"
FT                   /transl_table=1
FT                   /translation="MGNGWGMFPGEIWPRDENKTRLMVAGDMGMGFKGRVGQGHIKRKR
FT                   EETGADKRVAMGAWIYNSSNDKDTLKNAAYARGLAACRDEDFCFGPRQPHVSSYDALNH
FT                   DFPMEPGPQG"
FT   CDS_pept        join(complement(819915..820181),complement(819614..819838),
FT                   complement(818882..819316))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947707"
FT                   /orf_name="Pc16g03620"
FT                   /product="Pc16g03620 protein"
FT                   /protein_id="CAP93032.1"
FT                   /db_xref="UniParc:UPI0001831170"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S6"
FT                   /transl_table=1
FT                   /translation="MGTRFKDDTKDPAVNVTNWVLLVTIIFSVSARLGTKIRLFKRLTT
FT                   DDLLIIASLVFGIGQSIVVSLAVGSGYGKHFKDVSSADMQQVMKNLFAGSVLYLLSLTF
FT                   SKLSLVVFIRSLTPSAKDKWLARGVETIVYVWALVTIFGTAFQCSLPRTWDFQSGHCFN
FT                   LCDDRNNWRDRHPQEKHERQRSNISDVRNHHFRSDHAVPQYCDGLLGTTEPLPVLDAIE
FT                   RAQALWRGRPDFLELQDALAITRAVQVARSQEQIRKPRDLPSVYATRSNSGHAGLGGRQ
FT                   SVKPGAHNGVANTPLGYHELQVADHLS"
FT   CDS_pept        join(821097..821207,821264..821334,821415..821558,
FT                   821616..821698,821761..822158,822220..822552,8
FT                   22606..823088)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947708"
FT                   /orf_name="Pc16g03630"
FT                   /product="Pc16g03630 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP93033.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001831171"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S7"
FT                   /transl_table=1
FT                   /translation="MVAYEFKTTTSVTSRGGGPVDRDNAHLQRMGKRPVLKRNFGILSI
FT                   LGFSCTILGTWEGLLGVFPYPKPAVLQRSLTDISGGSGGAIYAYIFGWVGCFANFMVLS
FT                   ELASMAPTAGGQYHWAAMLAPGRLQKFLSFITGWFAVLGWQSAFAACAFLTGKMIQGAA
FT                   ILGNNLYNALPWEGTLIVWGSLSLALAVNLVGGNLLPRIEVIILVVHILGFFGIIIPLV
FT                   YMADHNTKEQAFLSFQNGGGFATQGLSWFVGMTSCAFAFAGGDAAVHMSEEVANASTVI
FT                   PNALMISVGINGCLGFGMIIVMMFCTDSDLGGKLGKITGYNFMGIFMEATDSVPGSLTM
FT                   ISIVIIIYVCSLMGLLAAASRQLWSFSRDRGVPGWRLWSQISSTRQLPIFAILLTVTVA
FT                   TLLSLINIGSNTAMEDIVSMAVAGIYLSYLMVSVLLFYRRVRGDISRYNDNEDDIVNVP
FT                   GAKLVWGPFHCPGIVGTVINGYAIIYLTIVVFFSFWPSTMDPTVETMNWSVLAIGGSSL
FT                   LAVIYYVVHARHIYKGPVMEVSL"
FT   CDS_pept        join(complement(824584..824783),complement(824502..824530),
FT                   complement(824323..824449),complement(824138..824265),
FT                   complement(823977..824077))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169930" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671661"
FT                   /orf_name="Pc16g03640"
FT                   /product="Pc16g03640 protein"
FT                   /protein_id="CAP93034.1"
FT                   /db_xref="UniParc:UPI0001831172"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S8"
FT                   /transl_table=1
FT                   /translation="MQLLSLFTSLALVSAVVSSPAADLNVNVARADDQHGSYIVSGLGA
FT                   RKQEILKAGGNTRDMAIAMLETDNMTTDYKYGDGKTGDGTNFGVFKQNWFILRNSAADF
FT                   LGQTVDQVDNGVILNTDLAKDIKARHEGEAKYGYEKWFSGHRNGETGLKNPGTDDIKTY
FT                   MSGVAWIQQQLESDEKYQSDDTRFYVQVVAI"
FT   mat_peptide     join(complement(824584..824720),complement(824502..824530),
FT                   complement(824323..824449),complement(824138..824265),
FT                   complement(823980..824077))
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S8 "
FT   sig_peptide     complement(824721..824783)
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S8 "
FT   CDS_pept        join(complement(828058..828241),complement(827690..827995),
FT                   complement(826805..827637),complement(826476..826751))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947709"
FT                   /orf_name="Pc16g03650"
FT                   /product="Pc16g03650 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93035.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831173"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S9"
FT                   /transl_table=1
FT                   /translation="MSLDKEEKQLEDISKDNVEQIEHAEHFDLKDQSDLSSIEATAASK
FT                   TAWLICIVVSIGGLLFGYDTGYISAVLVTIGSSLGHVLSSSEQEMVTSLTSGGALVGAV
FT                   GAGLTADRFGRRLPIWGACVVFVIGTALQTAAFSVGQFATGRFVVGLGVGSASMIVPLY
FT                   IGELAPAQYRGRMVAFNNMSVTFGQFLASALGAGFAEAKGEAWRATVGLGAAPALALAG
FT                   LLFVCPESPRQLVTHGKREAAEAVLLRIYPTSTVGQRQAKIRSIELSLQEVSMDKESLW
FT                   VTFKRIFTTPSTGRAVLTACMIMAISQLGGFNTLMYYAATLFSIVGFSNATAVGITVSG
FT                   TNFVFSILNLLLVDKFGRRIILTITVLGMSLCMIVAVIAFRYIPIDTETLVVESNNIGW
FT                   PGILVLVAIICYVACYSSGVATIAWIGTELIPLEVRAMGTMLNTVTCWSTNIIISSTFL
FT                   SMMKAWTPSGAFGFYAGICFFGWVFVVFFYPECKGMPLEAVREVFSTGFGVRYSKKWQK
FT                   DHKDDVKVQTIVLGH"
FT   CDS_pept        join(829700..829947,830003..830340,830400..830719,
FT                   830775..831015,831075..831265)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947710"
FT                   /orf_name="Pc16g03660"
FT                   /product="Pc16g03660 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP93036.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831174"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T0"
FT                   /transl_table=1
FT                   /translation="MNTIRPSIPRLSALLRKKPFPTPSPGPPLLPGILIDEEISPVYDS
FT                   KYFYPAKPGEVLADRYQILVKVGWGVSSTVWLARDLQGHFEESESVVALKIANSNASSA
FT                   GHEREVEEHISTADPSHRGRSLIRTLLDSFEIKGSEGSYSCLVYPPMREPLSMYQRRFG
FT                   DRKMPLPLIKTYIRALLTGLDYLHQKCRIVHTDLKLENIMVSFEDATVLADFMDSQLER
FT                   PMAFKIDSTGRPVYQSRSDFGPLKSLSSIPQLVDFGLATRLEEDDDWGVWPIQPDHYRA
FT                   PEVILGNGWQMPADIWNLGVLLWDMIEGKELFQHIHDQQGRYDAKLHIAEMIALLGPPH
FT                   PEVIQRYQFMREYSWPQPVRREDGRLCETAEEYFGGPFFDNNGRFLYEDMIPDWKLGDT
FT                   VSFLEGEEREAFLDLAKQMLVWHPNIRKTAGQLAGHPFLQLKQTSV"
FT   CDS_pept        complement(831736..833853)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128688"
FT                   /orf_name="Pc16g03670"
FT                   /product="Pc16g03670 protein"
FT                   /function="ammonia-lyase activity"
FT                   /biological_process="L-phenylalanine catabolic process "
FT                   /biological_process="biosynthetic process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP93037.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006559"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016841"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005922"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="UniParc:UPI0001831249"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T1"
FT                   /transl_table=1
FT                   /translation="MTLKRHSQSAHMNATLQLLGRVRDLKNKKRSIVLNGNDLDIASTV
FT                   AVARHGVEPTISTDECLAKRLEISVDTLADVISRKCVIYGVNTGFGGSADTRTNELIDL
FT                   QTHLLQFIQSGIITTADKDPASNSEREPSHVMPLAWVRAAIVARTNQNLRGHSAIRKCV
FT                   LKSLIDLLHNDITPLIPLRGTISASGDLMPMAYIAGAIMGNPDVFVQVGKGAQAIVMPS
FT                   SEALKMSGLSPSGLGPKEGLGLINGTAPSAALASLALYNTQQLALLSQMLTAFASECLA
FT                   GNVEWAHPFVHATRPHAGQIEVASNIRRFLKGSKFVVGLESQEASGDGLCQDRYSTRTA
FT                   PQWIGPYIEDLLLAQHQLEVELNSTSDNPLVDTSKQEDGSSGKVYSGGNFQAAAVTSAM
FT                   DKARLAIQMIGRMLWSQVTEMINPATNNGLEANLNATAQENFTMKGIDINMSAYMSELA
FT                   ALVHPVSAHVMSAEMHNQGINSLALISARRTMEAADLLAHMSACHIYVSCQGVEIRANH
FT                   LRFLSTLRTKMKDFTANGALYGLGLDDSQLETLCTSLLPIVQSSWYRANSNTWKDRVLS
FT                   VVDAVALAVNEFVASHSPDCSVSTMMAFKKRFHGLVSSTAEQMFYPGPTISPEEVAMQL
FT                   GGGTAQIYTWVRSNLNIPMNRGLQDDPLFNAQKGLPTKGKRSIGSSVSMVYESLIKGEM
FT                   MDVILEGWTQD"
FT   CDS_pept        join(835571..835680,835752..836864,836931..837505,
FT                   837621..839113)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235018" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977573"
FT                   /orf_name="Pc16g03680"
FT                   /product="Pc16g03680 protein"
FT                   /protein_id="CAP93038.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000183124A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T2"
FT                   /transl_table=1
FT                   /translation="MSFGFGVGDFLAVVTLANEIRKKFVDAPAQFKAISDEVRDLSLVV
FT                   HNVAIDLSGKELSSQQDAELRGIARNCRNVLTDAETMIDNYGVLAPNNKKQNLVKRAWK
FT                   RLTWEPNDIQELRLRITSNVVLLNAFNGKITQNTVTRLAQHQDDQERQVVLDWLSPMNY
FT                   ATLQKDYINRREQGTGQWLLESPEFEWWITGVNSNRTLFCPGIPGAGKTILTSIVVDEL
FT                   YGRYGNDSDVGIAYVYCNFQRHNEQDAASLLGNILKQMVQRKHTVPSSARALYNTHMHT
FT                   GTRPSINEISEVMHSLSTASDFSSIFIVIDALDECQISDRSRDILLDVVISMQAKRGCN
FT                   VYLFATSRFIPEIIEMFNEQPTVEIRARENDVKRYIQGNLTMLPSFVSRSSDLQEEISD
FT                   AIAKAVDGMFLLAQLYLNSLVGKRSAKAIRSALEGLSCSTRPYGFAYDDVMERIKGQVP
FT                   DQIELAMQVLAWITCATRQLTTTELQVALTVEVGESDLDKENLPDLDDIVSVCAGLVTV
FT                   DKQSNIIRLVHYTAQEYFERNQSTWFPKAHDDIGNICVTYISFDVFKTEHRLTPKELEM
FT                   RLRQYPLGPYAAASWGHHFRASWGLTRLLVTDSTPPKSLRRVDSSFYQAEQPFLTTGLH
FT                   IAAYFGLPNIAQRFISLGTLVDSNDAVQETPLCWAAQHGRDNLVRLLIENGANPNHKDG
FT                   LGYTPLHFAALNDYDEIAGFILDNGGDPMCGDAQVYLPFHIAVMTGSEKVARLLLQRGV
FT                   HPHARDFEDHTPLWLASIFGHESTASLLLDWDVQPQSVDLDACLSTAAEYGYDKLVQLF
FT                   LNKGADIDVTDYMGRTPLMLALLAVNESVIRLLLHLDIDLEVKNRQGRTALSLAAKLGN
FT                   WDAVRQLLEKGANPNSYDIDGRTAVFLAACQQDATVLTLLLPSGISTFERDRYGRTPLH
FT                   VAANRGHSECVRALLDAGIDCEVKDNFGRTALSDALTRGRNDAANIIRAFSIKDPIDMD
FT                   ELACRTAQLTGAPRGVSCDICCAHILIGEAFYYCRLCNGGNFDICELCHHGGARCLHST
FT                   HNLEQLQEQRSLQIRPRIQLLQLMSPKCRPNSRSWIEEASIFRESLNG"
FT   CDS_pept        839511..839990
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671662"
FT                   /orf_name="Pc16g03690"
FT                   /product="Putative uncharacterized protein Pc16g03690 "
FT                   /protein_id="CAP93039.1"
FT                   /db_xref="UniParc:UPI000183124B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T3"
FT                   /transl_table=1
FT                   /translation="MPTGVGTIQFSAHWRPMPPTERQLRSCILLAYQLLTYFDNAKNPH
FT                   QELQAPELTNDIIYITHTYDTPHLPKENPFPADWLLRRELAKTIREFQRLVAVIPSKRF
FT                   PPEAVLKRPISSDQHEAQKHGRYPSQSGITQITCVSYDSCKGLAKSLAAITYFHR"
FT   CDS_pept        complement(840147..841022)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217182" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671663"
FT                   /orf_name="Pc16g03700"
FT                   /product="Pc16g03700 protein"
FT                   /protein_id="CAP93040.1"
FT                   /db_xref="UniParc:UPI000183124C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T4"
FT                   /transl_table=1
FT                   /translation="MSKSRDGYVVHHFSHFELLCACAKILVESLQTKSANQWIVVLGLP
FT                   QSAIGKLDEDHSCLGGVEYRFAWEGNAGLIKIVPSFEHDSVTDGFTRVLDLHLIGMGLV
FT                   SATSRKWVATTTYKPTANKGKQADQGFLPPPRRPSAPGLPPGRPTLIIETGLSESLSQL
FT                   RQDALWWLSNSSGAVRIVLVISISKRKDRVFIEIWQLAPPNSPRPLTRAYIQTLCQQSP
FT                   NIPPLVQQQAASQQAYCAHEIEISANGVTGAPLTLPFVAVYDRPPAQGEGDIVLVEQDF
FT                   LDVTSDLLCS"
FT   CDS_pept        join(complement(842024..842547),complement(841895..841969),
FT                   complement(841684..841846))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076659" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671664"
FT                   /orf_name="Pc16g03710"
FT                   /product="Pc16g03710 protein"
FT                   /protein_id="CAP93041.1"
FT                   /db_xref="UniParc:UPI000183124D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T6"
FT                   /transl_table=1
FT                   /translation="MSSLESPTRPESPVDVVDVGPSRWAIVSKLQERTNILSQQDVTDG
FT                   LGPAYVTEKFLCSSLDSSNTPAFMRVYKQVPIAGTEIKKASVRAAQAVKSYEPIELVAL
FT                   KSLQEKGCDVIPRLLAYQCDEQAEDDTVPGGFIAYVIWEKVPGESLNTQKFWGYSLSER
FT                   EEIRLKFREAYKAVQACGYGLFPGIKKIIYHRPTQTIYLSGFSGPYRTEDTQWSDDIYC
FT                   AYGLVRPPTALDQIFPITSTDLKYDDKGWRW"
FT   CDS_pept        join(842863..843022,843107..843179,843256..843333,
FT                   843379..843498,843634..843799)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977574"
FT                   /orf_name="Pc16g03720"
FT                   /product="Putative uncharacterized protein Pc16g03720 "
FT                   /protein_id="CAP93042.1"
FT                   /db_xref="UniParc:UPI000183124E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T7"
FT                   /transl_table=1
FT                   /translation="MGIFEDHDSSLRLGTFGSFAEVIGGVNTRPNSLSECDLQGVDGGL
FT                   RRPAAPAAVLLEVMIPLAALRSSLFDIWVQVRGDARQQARAGRNYTALLVRSTDSYHMR
FT                   GHCSSGNCRTTAGRLLPQSESGLIRHLRRGYRYARRVACQGQGSNRTPQRFPRESLEET
FT                   VGPRRGEVGLNALVTEEGDAIVSFSVDSECSDLVA"
FT   CDS_pept        complement(844520..845128)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(845730..845738,846076..846390)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947711"
FT                   /orf_name="Pc16g03740"
FT                   /product="Pc16g03740 protein"
FT                   /protein_id="CAP93044.1"
FT                   /db_xref="UniParc:UPI000183124F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T8"
FT                   /transl_table=1
FT                   /translation="MQMSAISTGINNAGSLLGYHYIPGGAEECDGCPAYNNQICKSAAA
FT                   GAAPIQSPWGPIISSRRTLYLSHIVRIDSTEKATGTIRYRSSYLANRSPTALIEAKSQK
FT                   EGY"
FT   CDS_pept        join(complement(847752..848317),complement(846616..847687))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000237402" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947712"
FT                   /orf_name="Pc16g03750"
FT                   /product="Pc16g03750 protein"
FT                   /protein_id="CAP93045.1"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="UniParc:UPI0001831250"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T9"
FT                   /transl_table=1
FT                   /translation="MEKTKKARIRGKRDPKQTEAWILGTGTASLASAFYLIKHAKAPPR
FT                   KVHILESCDSLQEIWHHKGDPTSGYDQFAGCLPVPIGEPLKELLSCIPSAFPTTSRRAS
FT                   FLHAIQSAEVNRTFATQVNNTCIVVQKDGKLQNIVTSSLDLNFKQRLNLVRFMLKGEGR
FT                   LGRNHISDFFPQNFFETSFWAIWSAQFGLQPWHSATEFRRALRHYLGDFHNLSILNCLD
FT                   ITGYYQFESIFLPICLFLESLDVDFQFDTKVRAIVTTSNNDTRTISRLELSQNGFLTHK
FT                   DLGPHDIVIATLGSTESGAAVGSNDHQPVMLSFDACDQFDENWSLWLTLAPIGRDFGNP
FT                   YAFCTRRPQSMVESFTITTKEVNFFNYLTSLSQSTLATGALIVLRESRWKLNLCIPAQP
FT                   VFQYQPEDVRVLWGFAIFPEGIGDYVKKPMLQCSGAEIMTELLKHLNYPSELVFRHTVN
FT                   IPRVMPRMSAIILAHSRDERPEVVPRNTSNIGLVGQFVEIPQYSCIDMSYAARSAQMVV
FT                   SRLMGIDIPSAEVKRSLTALLIRILLWK"
FT   CDS_pept        848990..851065
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        851671..852510
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000219622" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824344"
FT                   /orf_name="Pc16g03770"
FT                   /product="Pc16g03770 protein"
FT                   /protein_id="CAP93047.1"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniParc:UPI0001831251"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7U0"
FT                   /transl_table=1
FT                   /translation="MGNDQKLGAYYAPKGGLPPQTQILTDRAMFTEAYAVIPKGTFSDI
FT                   VTSFLPFWDKTRLWVIARPLSGFAETFSQYIMEVQPGGGSDRGETDDSAQGVVFVVEGE
FT                   VTITLGSQKHTLAEGGYAYLPPKSGWTLRNTGATTARFHWIRKAYEYVEGLDKPEPLFL
FT                   NEKDIPPTPMPNTNGAWATTRFVDPSDLRHDMHVTIVTFEPGGLIPFAETHVMEHGLYV
FT                   LEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYAGGPGKFRYLLYKDVNRQMKLSRL"
FT   CDS_pept        join(complement(854037..854145),complement(853030..853970))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294684" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947713"
FT                   /orf_name="Pc16g03780"
FT                   /product="Pc16g03780 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93048.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831252"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Y7"
FT                   /transl_table=1
FT                   /translation="MATQSAIVVQGPGRATLEDVPLPEVPDDYILVKTKAVALNPTDWR
FT                   HIDFVPCTGATVGCDYSGIVEAVGPRVKKAFKKGDRVAGFVHGSNAVRNNGGAFAQYVI
FT                   AKGDLQILIPESMSFEAAATFGVGLTTVGQNLYQSMELPFPGNQDSESDDTNILIYGGA
FT                   TATGTLAIQLAKLSGLRVVTTCSEANRSFMFELGADAVFDYHDPLVGEQIREDTDDALE
FT                   FVLDTISTPQSAAICSAAISSAGGSYNALLDVASARDDVDSHVSMAYDVLGEPYRMGTN
FT                   ERAPDSTNFEFGVKWWGLAQKLIEERRIHPHPYQVKPGGLAGALAGLQILREGKVRASK
FT                   LVYRVDESE"
FT   CDS_pept        join(854618..854677,854767..854963,855072..855111,
FT                   855191..855244)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947714"
FT                   /orf_name="Pc16g03790"
FT                   /product="Putative uncharacterized protein Pc16g03790 "
FT                   /protein_id="CAP93049.1"
FT                   /db_xref="UniParc:UPI0001831253"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Y8"
FT                   /transl_table=1
FT                   /translation="MPPSHNSQMPHGIVILIAKEVELVSNRGLGEESDSTAGEEKQKEK
FT                   KGKEKRKRGRQGIFTLACWNRLEWRLEASPGNTVTDTRIVSGKQTTFRKVWNSLGNMDS
FT                   TSQNPDVIRAPT"
FT   CDS_pept        join(855495..855698,855758..855902,855964..856232,
FT                   856290..856652,856717..857644,857721..862063,
FT                   862121..862790,862853..863004)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160879" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671665"
FT                   /orf_name="Pc16g03800"
FT                   /product="Pc16g03800 protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAP93050.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="UniParc:UPI0001831254"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Y9"
FT                   /transl_table=1
FT                   /translation="MPGRPTSAPTEMEGIAVIGMGCRFSGGATSVENFWQMLCDGRTGH
FT                   GTVPTSRYEASAWHHPSHERKGAINHDSGFFLQEDPSRFDAPFFSITAKEAAGMDPAQR
FT                   LLLEVAYETFENSGIPIDTLPGSNTAVYSGSMTNDYELLSTRDIYDMPHNSATGNGRTM
FT                   LANRLSWFFDLQGPSIMMDTACSSSLTAVHLAAQSLRSGECGMALVTGASLILHPNFTQ
FT                   RLSYMHMMSADGISHSFDESANGYGRGEGIGAVLLKPLSAALADGDNIRAVIRGTGINQ
FT                   DGRTPGITLPSPTSQANLIRSVYERHGISMRDTSYFEAHGTGTPVGDPTELSAVGATLG
FT                   QARTPTDEPIYVGSVKTNFGHTEGAAGVASLIKVVLCLEKGMLVPNAGFKNINPKIRLD
FT                   DWRLRLSDKTMPWPDHLPQRASINSFGFGGSNAHLILESTKEALGGNAEDKEPAPHVVV
FT                   FSTFDQAGIERASQNWSTFLQRQQKTEQEIPLKDLAHTMLTRRSQLGFRSFAVANSQDQ
FT                   LQTILDKGLPKFPRASRKAQTRLAFVFTGQGGQWAGMGRELLRISTFRESIARSQDILS
FT                   SLGCPFDMVEEIKAEAKDSQINRPDRSQPITCALQIALVDLLASWSVYPNAVVGHSSGE
FT                   IAAGYAAGYLSREDAMRVAWFRGFFSQQIAQSDRRGGMLATGISAADAQKYLQELPPRS
FT                   VVVACVNSPASTTLSGDVDLIDKLEARLQQDGHFARKLRIDTAYHSPHMEDLVEVVGNA
FT                   INCIKPEDRYSGSIPMLSSVTKERVYPAELGGSYWVRNMISSVEFTAAVSQLANLSESI
FT                   KSRRRPVPIKWTALVEIGPHAVLKGPVTQILQSVNPSMASLPYYSLVSRNQHALRTALE
FT                   VAGSLWSTGHTVDLAAVNSSVDTTSPKMVADLPSYPWNHQTSFWHEPVETAQLRQRKHP
FT                   RHDILGAAVDYQNALEPRWRNFLRLSENPWMADHVVAGSIVFPAAGMLVMATEAARQLA
FT                   DDQANIKGIEFQDLRFMRGVVIPDEERGLETLLQVSPHPGMPGWYQFGIFSLPSGGAWI
FT                   QHAKGAFIARYENRDNDEHNANWEAALERIKNTQTVAKMADVRQSREWLSHTGGLTVGP
FT                   AFQTITGVSFCDAEPRLWLSGVVTDTKQSMPFEKESPSFIHPTTLDCLFQSALLSCSDA
FT                   LSNNNANIPVGVDNIYISNAFQPQAGEQFVVHTETKWRDGKSRSHCIASDPSWSQPWIT
FT                   FEGVHLGRLPFNPNSQKKVEATSESRYSSIVWDEHLESPLVTNQIHDGNKKMAVQASRL
FT                   QLTDWIKRLCHTNGDAKALITTSETSNSWIENLQELISSAGKRPCLGKVTIASCGPNDQ
FT                   VNGITPAENSLPGTQLMPLATLDELPSSSLAQEKYDLVVIDEPRLWEDKLTQVILSCLP
FT                   NILEHGGLAAMRVSDTDLDSAAEKLQRFDGLEIHSTTQNRKFIIARRTPVSWTTDSEIY
FT                   VLSPADNSNSFPVFEHLEKIFATHNVRLVPVGLGQVATLAGKTVISLLDLAAPWVAGWT
FT                   ENDLERLRELIRVQYVLWVSPCWSQGAVDNIGSGATGGLLRTLRNEQWNTTIPHLLVDV
FT                   EDMEDKFGLACGILQVMQLTTQESARRPDLEYRLANGRLLVPRVLETPAVDEAMHTLIN
FT                   GPRPVLSDLTLDPRPLELKFQDADNARWEEQQLSEEQLRPDHSEIKVEMATIFDLHGEQ
FT                   GKTPETVLPMFEIVGTVTRIGSDVHDSAVGDKVLTLASANSGLSTTMRVSESDTIRIPA
FT                   NTDATKAISTPLAYLNAYQILTQVGRLSSSSSVLLVGSVNQTLQAMIDYALAMNMQVIV
FT                   ATDSLDSTESLRSRYPVLADRILGVQGSLETSVSRLTNGCGVDATICFLGGYAGRNAAR
FT                   CLVQGGQYINLSSEMKLSALPESFVDSGCTFSSPRLQKAFSEKPGNLHASLRHVIDFMK
FT                   QHRMLDRVESYSLFPISDLQGALKHCKATNTRAIMDLQAPGRVPIVLPLPDLTGLPAGG
FT                   TYILAGGLGNLGLALADTLVQSGARHLVFLGRSGGTQPSQQLALDQLRDRGCCIDVLRC
FT                   DISQQGDIDHLSYKIRSKNWTVAGVIQCTTVLRDAMFEKMTFDDWTQSTQSKIRGTLNL
FT                   HHLFSEKEGLTFFVALSSVASVIGNMGQANYSAGNGFIDALMEWRRSHGLPGHSINIGL
FT                   VPDASGLSDIAEDQEQRRRRYKHLEGTEIMTHELQTLLRVIINSKLSLPSQIIAGMTDS
FT                   LSRSNGSTPWVLDRKFDHRLCLAVEDTQDSIQTSTLLKECDSIDAATEIVLNTLSEYLA
FT                   DAMATTADAIDSDLPLSALGVDSLKATAVQNWVSRELGAELSSFEFLGSQPTKALARKI
FT                   ASTSSFVSVPS"
FT   CDS_pept        864367..866034
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176579" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128689"
FT                   /orf_name="Pc16g03810"
FT                   /product="Pc16g03810 protein"
FT                   /protein_id="CAP93051.1"
FT                   /db_xref="UniParc:UPI0001831320"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z0"
FT                   /transl_table=1
FT                   /translation="MADAEKNDLCMPAPPAKAIVVDHDMPTGPDHEQTIVVDHDMAIAP
FT                   DSEQIIVIDDDLAIDPDLEKVTDNNDASKETPIPPNGHDSSDATDLEAQQTEPRRKRFA
FT                   RFRYAMFTVYRRLFTVVFCANLAVFLYVMIADRRLLALVNATAVNLVACGLARHPMMVN
FT                   AIYRAVCSIPRSAPLSLRRRCAKAAHYGGVHSGCGTASLVWYIGFVAMVSQIYWTNSPI
FT                   STVTDASFSAAPIAVAYVILVLLFVMIVVAYPTFRRKMHDLFELTHRFTSWLILALFVA
FT                   LVMIFAHEVGRAEKHSLGHAVVTLPAFWLLIVAILAVAHPWLLLRRVPVKAEPLSKHAV
FT                   RLSFDFTPISFAKGVQVSKHPLRDWHSFAGFPDPIPADAKPVAKNASRKKPFVKGHGHK
FT                   RSWSIVVSKAGDWTADTIREPPTHLWKRGSLMRGVGYGLRMFNRIIIVTTGSGIGPCLG
FT                   FLGDKKRPLIKVIWQTRDPLKTYGQDVLDLVHQMGPDPIIFDTSRDGRVDMLPVVRQQV
FT                   KEFQAEAVFVISNPKMTQNIVYEFESQGIPAYGPIFDS"
FT   CDS_pept        join(867608..868722,868775..868952,869209..869295)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824345"
FT                   /orf_name="Pc16g03820"
FT                   /product="Pc16g03820 protein"
FT                   /protein_id="CAP93052.1"
FT                   /db_xref="UniParc:UPI0001831321"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z1"
FT                   /transl_table=1
FT                   /translation="MHSSQLKKRHVVRSETLQDLVPSLPAAPLTSTLFTVLPAEIRNRI
FT                   YTLALESEDVLTDDSSRSLYKQNAFYYRPGYKQPKRIQTALLQTCQQIYAEASLLPPAV
FT                   NEHTFWFYRSPPHVNDASSPLNYFRKMTPKQRAQVQHLHLFTQQYFLEDNHWSQIWDGL
FT                   KIGAEGRSSRGECRIAPKKMTITFRHTDWWYWENNDPLGIDPFRPGRTHAADMGRAVSP
FT                   HAAARSWGNQFSSLPCLEELVIEFETIMRKRDQLDAIIQQALEWNFPMQADKGLYLVAD
FT                   PTSKRAYTWIGAKEAELQRQRPAWPVDTEAGSESQSGQEQPIPAAPALVPFDHPSDMGT
FT                   NIDTNIGNRQVGADTEKFYVVFLTWKKRRVQESDVDGISWYIYFAFELDSLLSLSWGGS
FT                   GLGFCNCDTENASSTAYNLVFIYMFLGSTKVKNPLPYKGAVSPTSAFVTSLAWVTPISF
FT                   M"
FT   CDS_pept        complement(869776..870426)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201237" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824346"
FT                   /orf_name="Pc16g03830"
FT                   /product="Pc16g03830 protein"
FT                   /protein_id="CAP93053.1"
FT                   /db_xref="UniParc:UPI0001831322"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z2"
FT                   /transl_table=1
FT                   /translation="MFGPLDKATIRSIDFNRTSRCMLQDMREETWGWVVYRTTYRSDPA
FT                   FHKAIEILTSWIKAGVYEDLNEYGLENPDPTPNDQLWARHQLTVIEEGGTLDGASLDIV
FT                   RGHFEGWVKAQDKQDTWNKYRACLVIDEAAVQRLGEAMTPEEHQEKHGERRYTELRQWF
FT                   LPAVEAFLELEEGETDFEGWMNCSVFNLIRLWTSLDDGMYMEDASNEVQDGVY"
FT   CDS_pept        join(complement(871134..871366),complement(870809..871016))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977575"
FT                   /orf_name="Pc16g03840"
FT                   /product="Putative uncharacterized protein Pc16g03840 "
FT                   /protein_id="CAP93054.1"
FT                   /db_xref="UniParc:UPI0001831323"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z3"
FT                   /transl_table=1
FT                   /translation="MEMPQRLGLDESEHLYGRNSFILPDMEIYIEIWPQRLELDESEHL
FT                   YNVNSFILSDIDIYMVCTVEMPQRLGLDESEHFLKSGKIRQNQAKLRHPPYKIRHPTPG
FT                   RYTPSQIPLFVFVNYKVLDLVLGKCSTSVKKWINNASSGLIQ"
FT   CDS_pept        join(complement(877290..877643),complement(871894..877242))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178230" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947715"
FT                   /orf_name="Pc16g03850"
FT                   /product="Pc16g03850 protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="ligase activity"
FT                   /function="phosphopantetheine binding"
FT                   /protein_id="CAP93055.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0001831324"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z4"
FT                   /transl_table=1
FT                   /translation="MGEYIEPSASPWVGEELTKPNDAGWSDCMTLPTLSDIKHEEIIAL
FT                   AWVLLLFRGTVQNEDGGFSWLKEGSLQGGSISDVIEGEGSSLRSALEAIRRRGQFDGEF
FT                   SDTLLFRNASLDNEWTFALEAKLASGVVYVRGTPQSRTATQPVESVLPHILADLILSIA
FT                   NNLDQSVAEAVRIGRQELSQLWKWNGTMPPTIDQCIQDIISEKAQSQLDRPAVVSWDGE
FT                   MTYRQLEERSTNLARHLVDLGLQTGKAVPLCFEKSMWTIVGVLAVMKAGGALVLMDPSQ
FT                   PEGRLSTIASEVEAGFILTSEAQATLGARIVPGGKQVIVGPQNDEAEFKSLSVDLPVVP
FT                   ASSTLYIQFTSGSTGKPKGVLISHSNYTSGALPRAEAVGYKEHSRVLDFPSYAFDVSVD
FT                   CMLCTLANGGCICVPSEDQRVNDLSGAIRKLNVNMAHMTPSVARVLAPDIMPSLEVIGL
FT                   GGEAISASDAAEWGQKTKIVIAYGPSECTVGCTINNDIPPGRSYTSIGQGVGGTTWVVD
FT                   PSNHDRLMPIGTVGELLIEGPVVGDGYLNNPEKTAEVFIEDPTWLVEGGGDVPGRKGRL
FT                   YKTGDLVRYDPDASGSVVFIGRADQQVKLRGQRVELGEIEHHVRNYFPAGASVAAEVIF
FT                   PGGKKADATLIVFVAEEKSETTGTTSEITSFSSSFQKLIAGIDDILATNLPRYMIPTAY
FT                   IPLNQMPLLVSLKTDRKQLRALGNDLTRRHIAEFRSSTVVKIAPRTEMERKLHGLWLKL
FT                   FGDETDIGVNDHFFSLGGDSLKAMRLVAAAREQSLAIQVTDIFQSPILESLALKVKEVE
FT                   NKGPLEVPPFSLLPAGWEADAARVEAASLCNLDPSEVEDVYPCTPLQEALMALSAKYTD
FT                   AYVAQRVIELQDIQTAKRLQSAFEQVSAECAILRTRIAQVPRRGLMQIVVHANTPWLNS
FT                   SNLAEYLSSDTLKGMSLGTELARFAIVNDETSGKTYIVLSIHHALYDGWSMPLVVDRVN
FT                   RAYRGESIGSPAPFKNFIKWLGETDRSFTEKFWETQLEGATSLQFPPIPYTGYQARADS
FT                   LLEHYVNLPRASSSSTTSIATAIRGAWGLLAAHYTSSDDIVFGETMTGRTAPVAAVEEI
FT                   EGPMITTVPVRVCIDRKARASSYLQQIHDQTVDRIPHEHMGLQHIRRLNADAREACELR
FT                   TGIVIHPTIGEVEPSSKEEPATAFVPTSEAEAAREALKFNSYALMLVFTVDTKGFLVMA
FT                   SFDSKTIDIPQMDQALKQFDRLVQQILEDPTQKIQHIFDSTIETDVAEQCRLAKIGPAS
FT                   LPTEEVYSAATSTWIVNPNDHECLVPPGGVGELLVEKEDEMTSGNPVANPTWCKQPTKL
FT                   YTTNQLAKYTNDGSVIILRAKDAQIGQLQPRNKNLNGGAAITTATQQKLQRVWSQVLDI
FT                   PCEDILLDDSFFDLGGDSIRAMKLVSEARMDGLQLTVTTIFDHRSLFDMADHAVEAQAA
FT                   VTTSQDYAPFSSLNVTDLDEFINKITPLLAQPEWKIVDVYPSRPLQEIAVQGTVQLPRY
FT                   SMRYELFYMDTKVDRAQLFQSCQELVSRNEILRTVFVDHEGVSLGVVVDDLPCQIVEYE
FT                   IESDVEEFSQKLCDVDVQSRIPLGSPFLKFLFVRHVDGPSSLIMRISHAQYDEICLPIL
FT                   LQQLSALYEGRRVPKSLPFSSYVGHVTRTNLPASIPYWRDLLQGSSMTRIQPDIPVVSA
FT                   AHFAISKDVNIAARPREITVATLPTAAWALCLARRLSLDDVTFGEVVSGRNIDLPNADS
FT                   IVGPSWQYVPVRVKFGKEWTVMDLLQLVQRQHLESAQYEGIGLKEIVKDCTDWPETVDW
FT                   FDSVVHQDVEHVEDLSFMAASSRMQTIYPHFEPLREIKVQAFPKGDTLCIEIVTVESWS
FT                   DFAVSLLDDMIDTVGQLVNQVDSKIL"
FT   CDS_pept        join(878527..879492,879546..879908)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178241" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671666"
FT                   /orf_name="Pc16g03860"
FT                   /product="Pc16g03860 protein"
FT                   /protein_id="CAP93056.1"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniParc:UPI0001831325"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z5"
FT                   /transl_table=1
FT                   /translation="MSSSTLPLVRLPEPYKTTYELHVVSTDRNLRKFQLLRAPRGDEGI
FT                   PPPKPLDHASLKFTDLAQPDPSSTPDEGNNSPWARAQRSPVTYITWEGSDTPTVGQIWN
FT                   VVYAIETLRSEFEIFRGVLSGTGSEILARELEGVGLAIAHPEPSAAPGKPIPTTTNHLG
FT                   QLVFSRSSFWQGAGSPFGTRPAWVSDPGIYSYMRKPLSEYPCRPRQHTVTTGFPERRVH
FT                   ALHPVRPPKPSPGSCIYSRYIPHLDEFFSVYALDYTNEEHLGLFNKWQNDPRVAQGWNE
FT                   TGTLEQHREYLRKIQEDPHQIAVLAKFNDTFFSYHEIYWAKEDHLGAYYDAGDWDRGRH
FT                   SLVGDERFRGPHRTIAWWSGLMHYIFLDDPRTEYVTGEPKYSNLAPLTYDHATGMNLAK
FT                   LVDLPHKRSALILGSREKFFHVAPLRFDGSDTLDRNPFRSLKL"
FT   CDS_pept        join(880563..880595,880644..881562,881621..884634)
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19824347"
FT                   /orf_name="Pc16g03870"
FT                   /product="Pc16g03870 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93057.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI0001831326"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z6"
FT                   /transl_table=1
FT                   /translation="MAEDAPAQKRSWRDRAVFFRLFVYGEPSRSDIALLVLGLVSAIAS
FT                   GIPFPIMSIVFGQLVDEMNSTTCNVNDTNGDAYQAGINDKVLMIVYIGIAYLVLIYIYV
FT                   FSWNLTGERLAQRLREKYFKALLRQDVAFFDNLPAGEASSRITGDITTVQQGTSEKVGI
FT                   VINSLAFFVTAYVVAFIKDPKLAGMLVSLTPAYLIMSLLGGYFVQKYFGRALESMTKAS
FT                   SVALEAFSNTMVVHAFSANARLEEKFIEFLNPGRIAGIRKSIATATQAGLLYFIAFSAN
FT                   ALAFWQGSTKIADSVESNDSSMTVGATYTVIFILVDASLILSTVAPFIQSFDAASVAFT
FT                   KLKADIDHSSAIDGTSKDIGEVLPEVKGHVELRDVSFCFPSRPDKPVLQNLSLSCPAGK
FT                   QTAIVGLSGSGKSTVAGLATRFYDATEGTVMLDGHDVKDLNVRALRSHISLVQQEPCLL
FT                   DRSIFENIAMGLINSPAHTHLQPILTGTALIEIAAAVREGQALSAAALEHGDQAREVVD
FT                   LVESATKLADANVFIEKLQEGYGTSVGSSGNLISGGQKQRISLARALVKDPRILILDEA
FT                   TASLDSATEMRIQRALESVAVGRTVITIAHRLSTIRNADNIIVMRQGKLVEQGTHTELL
FT                   AANGAYAELIRLQNLNVENSQEGTSTRSASPVTQITEKVEPNLSVTDDVPDKDETVDTP
FT                   AAQESKPKETGGVVDTNRSFASTVGSLGSMFRPYSFVLVLAVTGAVVIGGTYCASAVIF
FT                   GNVVGKLSGCEEPQNIRDAGEFYGLMFFVLAIIEFFANFFSWSLFGWMAENVIYKVRVL
FT                   SLRAILEQDLQWHESNDRNPSLLLSLITKDSNALAGLTGSVVCTILSILINLFAAIIMS
FT                   HIIAWRIAIVCLAVVPLLLAAGWMRVTSLAQFEERHLEAFARSVGITVEAVNSIKTVMS
FT                   LSVEDEIMGTYRRSLAAPMREITRQSAWANVWLAIGYGLSNFLYGLAYWWGAKNIIAGY
FT                   YSQTQFFIVQLALLVSSQLWGQMFALAPDVSRAFQATRRLLNLLDLGTTKKLSAPIELL
FT                   PSKLLQSTSDVESTANAREKVDDTRNGISVSLKQVHFAYPARPDTRVLHGLDIDVKPGQ
FT                   FAALVGPSGAGKSTIISLVERLYSPESGTIHVDGRDVAYGDISFRDNIAYVPQQSVMFE
FT                   GTIRFNLALGARPGHEVTQDELEEACKLANIHDVISQLPDGYDTHCGPNGDRLSGGQKQ
FT                   RLAIARALIRKPKLLLLDESTSALDAESERLLQDGLEKAAKNMTVIAIAHRLYTIRKAD
FT                   VIFLIEDGRCVEQGTHTQLIERSETYRVNALNQTVDG"
FT   CDS_pept        join(complement(885998..886193),complement(885592..885942),
FT                   complement(884877..885539),complement(884789..884829))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203127" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947716"
FT                   /orf_name="Pc16g03880"
FT                   /product="Pc16g03880 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93058.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI0001831327"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z7"
FT                   /transl_table=1
FT                   /translation="MPGLEEQPPFKVLIVGGSYSGLAATLNLIDLCHGRKCRFNLDENE
FT                   KGPGHTIPVQVTIVDERDGYYHLIGLPLAMASNADASTFWKKFDDIPALQSPDINHIQG
FT                   RVDSIDCKSRIARIRQNTSNDGHKIIEEKYDFMVACSGLRREWPSAPKSLTREAYLAET
FT                   AESVQTIEEASAGVVVIGGGAVGIEIAAEIKMVQPEAKVTLIHSRQQLLSSEDLPDEFK
FT                   EKTLEMLKESGVEVVMGARVQDTVRGDESAPAKYTLKLSDGRELAADHVINAVSRFAPT
FT                   SSYLPKEACDAEGYVRITPGLQFSADVPNKKYHYAAGDIVAWSGIKRGGQAMHQAHFAV
FT                   FNIHQQMLAERYNTEPKFVELVDVAPMMALALGKTAVGYFPAMGLSSGDEIRNMFFNDD
FT                   LGYEICWKWMRLGEATE"
FT   CDS_pept        join(886545..886935,886987..887288)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076664" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947717"
FT                   /orf_name="Pc16g03890"
FT                   /product="Pc16g03890 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP93059.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001831328"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z8"
FT                   /transl_table=1
FT                   /translation="MGFVVVPATLPDIRAIYDVWFAAFKGQLILDLIYPGTDINDEAFR
FT                   KVHTEGALEYWKGLSTEHTFQCIDTDTGKIAGMATWQVYWRERTAEERQKPWIGWLEGD
FT                   QRSRAEGFLEQLWEKREKWIGPKKHVYCHTVAVHPDYQGKGVGAQLMQWGMNVAEQLDL
FT                   PVYLESTVEGVPLYKKLGFQTLSEGIVFKPEITRVDKEVRAPLMAKMPTSAGNMTFEEW
FT                   AEGKTSSV"
FT   CDS_pept        join(888312..889145,889206..889889)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175484" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824348"
FT                   /orf_name="Pc16g03900"
FT                   /product="Pc16g03900 protein"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP93060.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012718"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI0001831329"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z9"
FT                   /transl_table=1
FT                   /translation="MAMRKAAPPYPSFFKWVASVLKDEQGRPFIVVRDQGKKKRQHGTE
FT                   AVKSHIVAAKTVASIVKSSLGPRGLDKILISPDGDITVTNDGATILGQMEITNNVAKLL
FT                   VELSQSQDEEIGDGTTGVVVLAAAMLEQASDLIDKGIHPIRIADGYDQACEIAVAELDR
FT                   ISDEITFSKDDTTNLLKVAKTSLGSKIVSKSHDQFAKIAVDAVLSVADFERKDVDFELI
FT                   KVDGKVGGSLEDSLLVRGVIVDKDFSHPQMPDEVRDAKLAILTCPFEPPKPKTKHKLDI
FT                   TSVEEFKKLQDYEKEKFTEMIQQLKESGANLVICQWGFDDEANHLLLQNDLPAVRWVGG
FT                   PEIELIAIATNGRIVPRFEDLSSDKLGTAGVVREMSFGTTREKMLVIEECANTRAVTIF
FT                   VRGSNKMIIDEAKRSLHDALCVVRNLVRDNRVVYGGGAAEIACSIAVEDAAVKSPGIEQ
FT                   YAMRAFADALDAVPLALSENSGLSPIETLASIKSRQVKEKNTRLGVDCMMTGTNGIRRS
FT                   FHIQFRSWANLDSSDMREHFAIDPLIGKRQQLLLATQLCRMVLKINNVIISGDDQSEF"
FT   sig_peptide     888312..888371
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z9 "
FT   mat_peptide     join(888372..889145,889206..890096)
FT   mat_peptide     join(888372..889145,889206..889886)
FT   CDS_pept        join(complement(891934..892148),complement(891580..891867),
FT                   complement(890263..891514))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159237" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947718"
FT                   /orf_name="Pc16g03910"
FT                   /product="Pc16g03910 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP93061.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00018313F7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H800"
FT                   /transl_table=1
FT                   /translation="MASKETQIAQVTAADVTYPTEKETETAQPPAYAADGNSDQESLDQ
FT                   EAQAGVKGVQAAAAVWTKSHLILAYVIIWFIYFVTSIQEVVIRSLNPYVTSAFELHSLT
FT                   AATNIMANIIGGLSKIPLAKILDSWGRPQGMSLMLLIWVVGFIMMAGCNNVQTYAAAQV
FT                   FSSVGSQGVSYCLTVFISDTSSLKNRALMLSYATSPYIITTWIGGPIAQSVLGGPGWRW
FT                   GFGIFTIVVPVVVAPLCLLFFWNQHKAKKMGLLAPSRGPLTLSTIKQYCIEVDLIGIIL
FT                   LAGGMALFLLPFSLWSYQKDQWRSAMIICMIIFGGLLLIAFALYERFWAPVTFIPFNLL
FT                   MDRTVFFGGLMFVFEFFNSMVWGSYFGSMLQVVWGLDVTEASYVQAIYRVGSCLFCLLV
FT                   GVLIRWTGRFKWLAVYFSFPLMILGVGLMIKFRQPDAGIGYICMTQIFVAFAGGTTVIC
FT                   GELAMMAPSNHQHIAVILAMLNLFGSIGSAIGSTVSAAIWTSEFPKALAKYVPAEVNVA
FT                   KVYSDITAQLSYEWGSPARNAIAHAYGDAQRYMLITSVCMLVVAWGCAGMWRDIKIKDV
FT                   KQVKGRVI"
FT   CDS_pept        join(complement(893573..893635),complement(893255..893524))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824349"
FT                   /orf_name="Pc16g03920"
FT                   /product="Pc16g03920 protein"
FT                   /EC_number="4.2.3.6"
FT                   /function="trichodiene synthase activity"
FT                   /protein_id="CAP93062.1"
FT                   /db_xref="GO:0045482"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniParc:UPI00018313F8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H801"
FT                   /transl_table=1
FT                   /translation="MVGLSPEVKAELPEIISMFFPLNDIISLYKEMDEMDKCNFVIKSA
FT                   RCKELTQVEVLRKLCGDTSDVIRTSRPPGKAHFGLSKVIEAFLPGYKTYHRHWFLTLEN
FT                   SSRLLL"
FT   CDS_pept        join(complement(894677..894758),complement(894535..894610),
FT                   complement(894343..894479),complement(893980..894071))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128690"
FT                   /orf_name="Pc16g03930"
FT                   /product="Putative uncharacterized protein Pc16g03930 "
FT                   /protein_id="CAP93063.1"
FT                   /db_xref="UniParc:UPI00018313F9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H802"
FT                   /transl_table=1
FT                   /translation="MPWCLGDPLAGVVRVYPRRSCEGSDTRCTKEGARLSSPLVKKGSW
FT                   ELAEPECRYIRWREWDKLWGLGSANLLLLKHMLTVYEDGAWIAVMPMSHGRKEGGSKGY
FT                   NAERLMETSRCTVECEMILNSCGS"
FT   CDS_pept        join(894901..895012,895077..896497)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824350"
FT                   /orf_name="Pc16g03940"
FT                   /product="Pc16g03940 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93064.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00018313FA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H803"
FT                   /transl_table=1
FT                   /translation="MAGDIEESPEKHSHGTSHKLPDLQRRLKSRHLQMIAMGGAIGTGL
FT                   FIGSGSAIATAGPVGALIAFTFIGSIVYSVMIALGEVATYLPIAGAFATYATRLVDPSL
FT                   GFAMGWIYWFSWASTFALELTATGLIIQYWDDAIPMAIFIAVFWVVIIILNMFPVSCYG
FT                   EVEFWLSSIKIITVVGFMIFAICINAGVGREGYLGFRYWVHPGPFRAYLIEDSGQDALA
FT                   KFVGFWAILIKAGFSYQGTELVGIAAGETENPRRNIPSAIRKTFFRIVFFFVFTIFFVG
FT                   IVVPSDDKRLTSDDSGTNADASPFVIAAKRAGVNVLPSIINAVLLTVVLSAANSNVYSG
FT                   SRILVGLAHEGFAPRFFLKTTKHGVPYASVGFTALFGLLGFLNVSNAGATVFNWLMQIA
FT                   GLAGFITWASLNICHLAFMKALAAQGIPRDTLPYKAPWQPFFSWYGLFFNILIIITQGF
FT                   TAFIPKFSVTDFFINYLSLMLFAVLYIGHKVVFRPGFVKPKQADIDTGRFEE"
FT   CDS_pept        join(complement(897258..897508),complement(897066..897189))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207796" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128691"
FT                   /orf_name="Pc16g03950"
FT                   /product="Pc16g03950 protein"
FT                   /protein_id="CAP93065.1"
FT                   /db_xref="UniParc:UPI00018313FB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H862"
FT                   /transl_table=1
FT                   /translation="MSMSVSANTRPQAGAPASPASRRLLIFQETCNPQNVAEIVYIPVN
FT                   KLGLPICGDGPELPSILLLPLRVLRVFTDIFNQPKYKGWAVVSAGPYRDVSEEGKFYAV
FT                   LLEQTQNTVHASHETHMGTP"
FT   CDS_pept        join(complement(900296..900913),complement(898855..900230),
FT                   complement(898326..898737))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947719"
FT                   /orf_name="Pc16g03960"
FT                   /product="Pc16g03960 protein"
FT                   /protein_id="CAP93066.1"
FT                   /db_xref="UniParc:UPI00018313FC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H863"
FT                   /transl_table=1
FT                   /translation="MPSLTLTDPDMILPYEGERESQTPSPPRIAYLSHLNSRQPDHNAS
FT                   MSAPRQKKNFSRHAWTHDDVSVSRRLSDIGEELSPDRSEGFGDSDEHELASSPLLHERD
FT                   NQNKDNAAWSSSNSTISAGSRRASASRDVSEAHNGRDESPVHPEVARAQATAVVGTGAS
FT                   SVPASSAVASAAAEGKGPGEEFSSAILSSEAERILENAKKRLNLMENNLTRARSTTPRT
FT                   TASPSPSPSNSGYIQPMGMHQPVGGLYRSISRTDPKNSSLRRQSLIASQDTTNNRHSRV
FT                   HSETNFPSDSSFSNDKRISRSVSAMGASTSSSLHTDDRSFHYAPTRAYLTHRSSVSSMQ
FT                   PPRLAHEQEHHDQPAQSPVSAGGSSSDSPQGLGNSEEESKSSSEGFSPVYSSFGPPSRA
FT                   QSQLQVRDLQYQMKGLHIKISSLKVKNQEDNLRRRSLQSLRTPSPLTAADHWYANALEL
FT                   RDGQGSRGSNPRRNASSENIRRASNDAAEDRHRSDEHAAGHKSKRAGNWQGNEPADYAD
FT                   DQSVAETMYEDAEEGDFDEDIDREALNEILREPLDDDFENDMEAFPDVPSHTDATPHEM
FT                   REDAFDYEHFILHSALGNYTQQLRRVSNSSNGSVETTRPPYTARHSRTNSNMSDSTVAT
FT                   FATATEGERPDDEDDIDSVMYWDRRFNHGAHSYQPSPIQELEAEGDRSETPRGPRHESD
FT                   TNQVDPNNLSPQKLTGRSSSATAGSATPTSLVSSLVSTVRAASSTPSVGGINDDDTQML
FT                   EALFASLGNVCKDLQDITTSPDPDVKAARVLRRRLDAARRVLDGELDA"
FT   CDS_pept        join(complement(903499..903874),complement(901731..903439))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947720"
FT                   /orf_name="Pc16g03970"
FT                   /product="Pc16g03970 protein"
FT                   /function="RNA binding"
FT                   /protein_id="CAP93067.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012959"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018313FD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H864"
FT                   /transl_table=1
FT                   /translation="MAGLKRAVDGSEERNGKRSKTKEASTSKSKSVKSSSSSKKDSKKD
FT                   FKSTKSDKKPSKKVQKEESEDDDDFDIDDVSDEDIDALDALSDDEEMPDVSDEEEKQVS
FT                   DKKSDADDEDQQEAPKKANPNNNNSRESHIKQKALQQERKAAKPNADTVARSKKLWEQL
FT                   RRKSHVPLEQRKKLVKELFEIITNRVRDFVFKHDSVRVIQTALKYGNLEQRKLIAHELK
FT                   GTYKELAQSRYAKFLVGKLIVHGDDETRDLIIPEFYGHVKRLIRHPEGSWILDDIYRTV
FT                   ATKAQKDRLLREWYGPEFVIFQDENDTTSDLRKIIEAHPEKRGPIMNYLRELINLLVQK
FT                   KSTGFTMLHDAMLQYFLCTKPGSNEASEFIELLKGDEEGDLVKNLAFTKSGSRLMCLSL
FT                   AYSNAKDRKLLLRFFRDTVKVMAGDIYGHQVILAAYEVIDDTKLCAKSFFPELLNQNDG
FT                   EEARNEELCYQVNDLTARIAVLYPFVGERVKWLLPEVDNPVLEEVRDVRKETSKKDPAI
FT                   RRQELVKAASPTLLEFIAARASTLLETTFGCQFLAEVLFAADGDKTAALAAVAEAAKSH
FT                   TEARDTAHVGRLLKSLVQGGRFNPATKSIEKVEPALNFHAALYEQIKDEVMDWATGANP
FT                   FVIVALAESEDFEKKSELLKTLKKNKKALEQASASVVEKDGQKKPTPTSSGAKLLLSKI
FT                   "
FT   CDS_pept        join(complement(905175..905325),complement(905063..905091),
FT                   complement(904870..905007),complement(904441..904806))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947721"
FT                   /orf_name="Pc16g03980"
FT                   /product="Pc16g03980 protein"
FT                   /protein_id="CAP93068.1"
FT                   /db_xref="UniParc:UPI00018313FE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H865"
FT                   /transl_table=1
FT                   /translation="MPPFRNFLGRKSQPNGDTTALDDNHLSPNQRPAPIPIRNSHDEPT
FT                   EYKLSVVNDSGVYLPPSPPERPSFWRRYPGSSKSVNHRDLVDDNEPFSISRESFDSYRR
FT                   SFDISARSPIIHPDAAPSRTSLDSRFSRLTPSVTQCNSLSKSEIMEEETFEEVGLNDEA
FT                   KPKKKGFLSRFGDSGNDAQTSGPKSSTSSFGFHIPGRKRGQSGGGSELASVKVAPSAPA
FT                   PTDET"
FT   CDS_pept        join(complement(908115..908616),complement(907560..908062),
FT                   complement(907379..907490),complement(906962..907326),
FT                   complement(906523..906912),complement(906281..906470),
FT                   complement(906101..906207))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207785" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671667"
FT                   /orf_name="Pc16g03990"
FT                   /product="Pc16g03990 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93069.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00018313FF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H866"
FT                   /transl_table=1
FT                   /translation="MGRKPNQLILEFFHRGPKLEDASNRYQHTCKACGEVFPKGRIDSL
FT                   TNHLVKKCQAIPLRDRQRVLLRLHELPDLTDGDSNKDSPSGSKGKSADGGFPNRQNFDG
FT                   LNVLAEASRQVGASDVTKRGPGYTQSVTAGGKTVIVDPALEAEGFQGHSQGPDSKAEGT
FT                   ANAEGTPQSSNAPSIPALPSHTPGEHPASMSPPLGDASMSPESTSNARQSQLSMIAASA
FT                   NEMVPQGMSIDSDSDMKMNQWNQQLSTHEQLLFDSLQEHDPSLTAATQRAASYPRPIAM
FT                   NPNTQAKGFVNEFGNSTKPMKPKVRGRFTAERRREVQDVRKKGACLRCRMLKKPCSGDT
FT                   PCTTCASVESARLWKHPCLRTRLSDEFELYNANLNSTLAYHDTNSIKNQIKFEHYSGRI
FT                   EVTHFEESNSFMTFSGLQGHRTSVSALDPQLQALGDDQFAGPSQEVYLLDADSDDIPSK
FT                   LEMYIKKNASYFYERETSPFMKPTLLLAAELNQGKKDILLERVLELWVATHILVDTELT
FT                   WKTYYNPTLPPNSLHSLSQPSDEGRLPIEEVSDPESYGLLCSQLRAAMEKRASQLSKFV
FT                   INDLERRLLQRQKCGWFDTFIVAIILLNCVDRTCWLFRSWDNENFSQRWPLDKRPPYYF
FT                   NQSDRFADILEMLLRMRHIPPKATFRPDNGILKAVDGSDEHAIRWFDMIQITPYFIEER
FT                   KNAVFDPSDSRSLDCHHSASLLEPNNAT"
FT   CDS_pept        join(complement(911514..911850),complement(910791..911412),
FT                   complement(909559..910737))
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        912015..912297
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   gap             913901..914000
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(914704..915398),complement(914576..914650),
FT                   complement(914439..914526))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169819" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671668"
FT                   /orf_name="Pc16g04020"
FT                   /product="Pc16g04020 protein"
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93072.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI0001831400"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9G8"
FT                   /transl_table=1
FT                   /translation="MSTICTEITSQCPVEATTYGYYPNLGGNIFFTIYFGLLGVCQLGL
FT                   GIYTRTWTFLAALGIGTLMEAAGYVGRILMHDNPWSTSGFRLQIFCLILAPTFIAAGIY
FT                   LTLKHIIIYIGPQYSRMNPKLFTWVFIGSDVGSIVLQAAGGGVANAAGTDQAMINTGNN
FT                   IIIAGIAFQVATMSVCGLLASDFFIASRKHLREGFQGEAATEKPQQRMWLVLVAEIGAY
FT                   TTVLIRCIYRLPEMAGGWGNKLMRNEMEFLVLDGMMIALACLVFTVVHPGLYLHTMRTG
FT                   RSRP"
FT   CDS_pept        join(915645..915679,915780..916803)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216713" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977576"
FT                   /orf_name="Pc16g04030"
FT                   /product="Pc16g04030 protein"
FT                   /protein_id="CAP93073.1"
FT                   /db_xref="UniParc:UPI0001831401"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9G9"
FT                   /transl_table=1
FT                   /translation="MDAINARSGVSSACTARELPCVYSTPCPRRYSPTETSLKPEPKPP
FT                   AKPAFISPKYHAQHLLLMHKFSTETYKSICGDHSDIEGWQVLIPKLAFEHEFLLHGIFS
FT                   IAALHMAATNADPEQVLSYLDTALQCNELAFAPFREALAHLTPLNCDAVFAQSAIVTII
FT                   GIALPRLNAQHRGESFSMIETMMTVFELLQGASKISQISKPWRQASIFFKYDWRENTTL
FT                   DPDVANAIAQLRMLNGPIESTDSAQNSINQEAIDSLEDSFAKFTNAPHPAPILAWLTYV
FT                   KREFVHGLRERQPFQLLILMNWAVLLNELEASFWWAKGCGKALVAELLTELKDHNEKWK
FT                   SALQWPQQMVGI"
FT   CDS_pept        join(complement(921026..922497),complement(920829..920978),
FT                   complement(920071..920757),complement(918775..920032),
FT                   complement(918144..918728),complement(917785..918093),
FT                   complement(917317..917736),complement(916908..917159))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671669"
FT                   /orf_name="Pc16g04040"
FT                   /product="Pc16g04040 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93074.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831402"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H0"
FT                   /transl_table=1
FT                   /translation="MSSGPEKPKKVPRKHVTTACVPCRESKIRCDGATPHCQNCQRKGK
FT                   ECKYQHGDDKRNPHRQSHYLIFPRLKANVTRVSLRASTELFSARIDQLCHFIKEQGLEP
FT                   PPMNPEDEAGMNRVLDTLQIPRGFPQVSAVADEKRPPVEATASGVSSKSPSQDPPTVNP
FT                   KGQSPSTNPVACGASPAQDTASSGKVPSPEGWNPFGMVPGASDNQNFVHWGFTLPTAES
FT                   LDTIYANLNGGPRAPTMPRIPVNTEMNPDSYQLGMDMAQQPGSLLGQLPHEGDNDSDSG
FT                   EEDEAENDVIEQLSHRIGTLKIAGDGHLRFYGATSNLNLVDVSATQQRQRPDARTVRHD
FT                   GQDILNHLRVGQPVDQALEDHLVELYFTWQNPSTYIVDKEMYMTARTKWRNELDDTPFY
FT                   SEVLTNAMCAIGSAFEARYHPTFITFPKSLAEFFADRAKALLEIELDSPCVATVQALVI
FT                   MSCHEGASNRDARGWLYSGMSMRLAFDLGLHLDMTAYVNKGEITQLEADVRRATFWGSY
FT                   VADHFWGFYLGRPFRMNAGDIGVPKPGSALSPEKEENWHPYGHQAAHALSQNGLRNPME
FT                   LICRQFVVLWEMITPVGHILYGCSDISRHDLQRICYQVTEDLFAWKANLPSILQIDLND
FT                   DTSPILPHLMMLHMQYHQIIIFFHRPWLSKSYIQPRSPRQGPGYHHARRMCVESATAIA
FT                   RLLQLFEKHYTFRRMNNQVVAIIFSAALMLLFVTVSSSPMSPGKQGDSPTYPRSTEMVA
FT                   YLNLCFRALDELGQSFDNAKRTRDYLVTLQRRWQANMRRSGSATKRQNSSANLAALGSQ
FT                   KPSTQNTHASNAHGIDGWRKKSRLSVSGAPPNMQSTAPATTNHYSRLSQHTMPPQHQYH
FT                   QQSSYQQQAPFPVPRPDSQLGDLDWIPNSDMRLMSETQNGNALNDMGQIPSPPFPEDPS
FT                   MLSDIADIDAWWAPDNYTRTSMPP"
FT   CDS_pept        922724..923455
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217123" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947722"
FT                   /orf_name="Pc16g04050"
FT                   /product="Pc16g04050 protein"
FT                   /protein_id="CAP93075.1"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="UniParc:UPI0001831403"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H1"
FT                   /transl_table=1
FT                   /translation="MYDPRTTGLSDGEPRNNIDPFTQTDDYSDALSFLAVHPMVDQARM
FT                   GIWGMSLSGAVALACAAVDPRARFVVAVCPASEYSFAQAKIPSVLGKIAKDRESQLKGN
FT                   VPFYLPMLNRAGENPAGFNLGVDKDAALRILSAQDEKNPTRQALAANHVNRTTIQSYRK
FT                   LLMWSPAPIYRHLAVPVMFVVPELDQLISAARQQETFENLPGTTNQLHVEHGVGHMDVL
FT                   EGEQLPDLMKRKLLFIQGVVG"
FT   CDS_pept        join(923691..924232,924414..925371,925422..925535)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160991" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947723"
FT                   /orf_name="Pc16g04060"
FT                   /product="Pc16g04060 protein"
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93076.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831404"
FT                   /db_xref="UniProtKB/TrEMBL:B6H867"
FT                   /transl_table=1
FT                   /translation="MKMDPIPSHPESSPNSPTPTSDRSFLQTFTILTALCAGVFVAALD
FT                   VTIITTALPSIAAHFESSSAYTWIGSSYILANTATIPAWGKVSDIWGRKPLLLVATVIF
FT                   FSGSLICAVGNTIAIFLFGRAVQGLGAAGLITLVNICVSDLFSLRDRGLYFGLISVVWA
FT                   LASGVGPVLGGVFTEKASWRWCFWVNLPVTGLVFLLLWLTLKLESPDTPIWSGLKAVDW
FT                   TGCLFVIGSTIMLLLGLDFGGVSHPWNSATVICLIIFAGVLLGLFVVNEWRLAKYPVIP
FT                   LVLFHHRSGIASFLVCFCHGYIFMGEAYYLPLYFQAVLSSSPIMSGVYIIPFVLALTVS
FT                   AALTGFFIQKTGVYVPAMWSGLAAMTLGVGLLINLEVTANWGKIMGFQVIAGIGIGMNF
FT                   EGPLLALQAIVGSENTATATATIGFVRTLSTAISVVIGTVVFQNQMARKESQLVSTLGQ
FT                   QLASQVSRDAMANIKVIDTLPLDQKLVARQAIYGSLQTVWIMYVAFAAVGLVAGVFVEG
FT                   HHLDTEHKAPVLGLRDDNEG"
FT   CDS_pept        complement(925609..926549)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947724"
FT                   /orf_name="Pc16g04070"
FT                   /product="Pc16g04070 protein"
FT                   /function="RNA binding"
FT                   /protein_id="CAP93077.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI00018314E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H868"
FT                   /transl_table=1
FT                   /translation="MASEASTSANGGSLAAMLEQQHARDEAHKATVEETVDEEDLKHPP
FT                   PTSLQPEEPLLVNSDTSEPTTIAQTASPTPSPKPPTKKAPTFDVQSEELFPALGSGPKP
FT                   AAPAAATWGAKKPSAAATVANGSPASQWVRGLFWSPPGVGQISDTGTEIPRIMALPGKH
FT                   MEQLRLAPSQMQPRGQMKKPLRDILRDISRRSKANVDMRGGPGGSIIFEGKGSVDAVRQ
FT                   ALREVAQQQSVRVPIPTSARAHIIGRQGTVVQDIQTRTGARVQVPRADGNAADDDDDDT
FT                   IDILIEGDAVAAEMARREIEAIVKERGSNMSFRLKTVPPEFFPFIAGAHDANLRAIEER
FT                   TKAQINVPRYDTWSTQPPPQEANPGQVQFVAVPDKHILISGERAAAQEARAEIERLAAQ
FT                   LRQQLTLRQLAINRGQHQFILGNEPDALHQFVAQTGCAIVLPPSSDESEFLTITGPVDQ
FT                   IEAGIEHAMDLATSMQMASIDLSRQHPNAPAGPHAHASALSQYLRRRQVIKELESTYDA
FT                   HIALPPSVGGPVTWEVYSRDGKNTIRARSDIMNLVQALPPSRLRHVSVDPYFHQYLRDR
FT                   SATTLQGDYGVHLMVPDDVNCPEVVLVYEGPSSTASSFEVPRQRPSPADVAAFEKGLQE
FT                   AQEYLLGALGDQRDIVAKSVSVPAKYQEKARKFINREQEAKGEDSIPVRAIVGDAKGSQ
FT                   CQVSLRGPSGLVAELAAKVEAFVVEQEKDDLERGYTTSFDFPQKYANFLIGKRGENINK
FT                   LREEFDVDIKVENGKVEVKGPKAKADATRMRIINMGKKLEDETTHILKVPAQYHRELIG
FT                   QRGNQVNRLQDRYSVRVQFPRATVPNDDATETGSDAGGARPQRAQQAPDEVLVKGPSKG
FT                   ADSARDEILSLLQYVIEHGHSASISVAQSQVASLIGQRGREMEKLRADTGAQIDVPNAN
FT                   DAPDASGRVEIRVKGTKQQVAEAKKILQQRASEFDATVTKTIEVEKKYHKALIGGGGAN
FT                   IRKIVTEAGGPTDGSAARMVRFPRPESTESTIRLEGNGKIVDNIIAAIEEFVKERQDQV
FT                   TEILDVPTAQHRMLIGRGGEARRGIETKFNVTLDIPKQGSGRTDVKLKGPSSAVQSAKE
FT                   HIQSMLKEQHAETIEVPSHLHHFLADNGQIFRRLRNDYQVTVDHAGQAVPVPAPSAAED
FT                   TRTTAEGTDMPLIIDDPNVTADAHSWTVVDNNATEVPSSPFPWVLSGTPENVAKARAVI
FT                   EKNLASATQQSTTGYLILPDPKTYRFVVGQGGSQINAIRKKTGCRINVPKEQARGEAIE
FT                   IRGSPSGLEEAKEMILEAVQNGLHPSAR"
FT   CDS_pept        join(927092..927273,927413..927840,927888..928419,
FT                   928475..929192,929244..929348,929401..929930)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947725"
FT                   /orf_name="Pc16g04080"
FT                   /product="Pc16g04080 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAP93078.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI00018314E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H869"
FT                   /transl_table=1
FT                   /translation="MAVVSTLKLPSQGLGDPVLLDKIDQLLACNLAGYVNLPQLVVVGD
FT                   QSSGKSSVLEGLTKLPFPRDSGLCTRFATHIIFRRTRADTKRSISASIVPAYGKPAEHA
FT                   SRLGAWKATHMESLDSESFASTMREVHETMGLSRSREESSKPTFTLDVFRLDICGPEED
FT                   NLSIIDVPGIFKNTTHGLTTKQDMDLVKDMVLSYMRNPRSIMLTVIPANVDIATQEILE
FT                   MARECDPEGSRTQGVFTKPDLVDKGAEDKVIDLVEGKTSSLKLGWIVVRNAGQQQLLDQ
FT                   DSNRDEVESQFFREAHPWNNLPKDKVGIASLKIRLQEVQTTQILESFPRHMRAEVGRKL
FT                   KAMKQDLSALGIERSTPEQQRNFLLDIIVKFQNIVSQAMATSYGTHELFEKDEDTRLAT
FT                   IVRNRMDVFKSDMEEYGFEYQFLNWAPALHAGVGPVPEPESGSGDDSDDDDDEEADGIP
FT                   VRKNMNTSEHSGAIDGILHEQVNVRKPRGGSILAWIEDQYRASRGFELGTFQTALLCTI
FT                   MNKQSDKWTELALGYVSDVIDIMHTFILKVLLSICPDEQIRDKLLNVLVDELSKRYRAA
FT                   MDQAQMILEVERMNLMTLDDKFQQTLDIAQKRRCVRLIHSISGEDTILNYFTSHQEQYE
FT                   IVKGKEKVPMSNTQQTVRYIHDILAAYYAVASKRFIDSICMQATGYCLLTGPRKPPGLF
FT                   SPQFVADLAEDQLMEIAGENARLSRRRVQLKKGIQDLETGRKIMM"
FT   sig_peptide     927092..927175
FT                   /db_xref="UniProtKB/TrEMBL:B6H869 "
FT   mat_peptide     join(927176..927273,927413..927840,927888..928419,
FT                   928475..929192,929244..929348,929401..929652)
FT   CDS_pept        join(complement(931075..931226),complement(930572..930995))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201304" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824351"
FT                   /orf_name="Pc16g04090"
FT                   /product="Pc16g04090 protein"
FT                   /protein_id="CAP93079.1"
FT                   /db_xref="UniParc:UPI00018314EA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H870"
FT                   /transl_table=1
FT                   /translation="MSLLRKPMKQYNWLPDYMQNIYQWLYYCEPTWGYTIYRTTYTPQS
FT                   NAAFPAANEFNITPWDEIWPNYQPRVIEDASRFDGASIDQLRKHFRADAIERDMLDVFP
FT                   SYRMFIVIDEESFQTLRNAPFPENSKYEERRYHYVKLVEALEVDLSEDFQGWMKCSLPS
FT                   LWEIWSDMQDTTYMKDTSSMIPDDTDVL"
FT   CDS_pept        join(931746..932170,932259..932895)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000207761" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128692"
FT                   /orf_name="Pc16g04100"
FT                   /product="Pc16g04100 protein"
FT                   /biological_process="mitochondrial proton-transporting ATP
FT                   synthase complex assembly"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP93080.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0033615"
FT                   /db_xref="InterPro:IPR007849"
FT                   /db_xref="UniParc:UPI00018314EB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H871"
FT                   /transl_table=1
FT                   /translation="MWKYTLSTLVADLPLLQTGRCLSCQFRNPATLSQLRTKPFSLRQY
FT                   SNKPGKPIDAKETPPVKRNLKNEAHRLSTAIEFKQNQPQDGPQPGDADFVPPSLDRPIG
FT                   SPQAPLEGQNTGIDTRSMRQRRDDFTNYDRHIKRRKELTKQVAKPYFREWSNLRFAEGK
FT                   TFVSNPRLFKADRALYFPNMHGITLASPKDPQNTTTQLRGSISVVNLFSSVWAESQVAT
FT                   FTGPEQNPGLVEAMASGGKLVQRIDINLEENRLKAFLVKTFMWRMRQKLAKEQHSRYFL
FT                   VQKGFDQALKETVGMMNSKVGYVYLVDSECRIRWAGSGPAEKSELEGLNAGVRKLIEEK
FT                   KNVLRVHDPSRGY"
FT   sig_peptide     931746..931808
FT                   /db_xref="UniProtKB/TrEMBL:B6H871 "
FT   mat_peptide     join(931809..932170,932259..932892)
FT                   /db_xref="UniProtKB/TrEMBL:B6H871 "
FT   CDS_pept        join(complement(933952..934017),complement(933782..933895),
FT                   complement(933211..933714))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207760" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824352"
FT                   /orf_name="Pc16g04110"
FT                   /product="Pc16g04110 protein"
FT                   /protein_id="CAP93081.1"
FT                   /db_xref="UniParc:UPI00018314EC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H872"
FT                   /transl_table=1
FT                   /translation="MASSTSSGWTQLRQQARSLETQTENLFHTYSQFASITKPPPSPTE
FT                   EELRLESQLKDLLERRESVIAQLSRLLDSEATLTSSALKQNNVSRHREVLQDHRRELQR
FT                   LTAAISESRDRANLLSNVRSDISSYRASNPAAAEAEYMLEERGRVENSHSMMDGVLSQA
FT                   YAINENFGVQSETIANINRRIVGAAGNVPGMNYLIGKIGNKKRRDAIILGCFIGFCFLM
FT                   LLFFR"
FT   CDS_pept        join(934381..934383,934446..934585,934815..935046)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207749" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947726"
FT                   /orf_name="Pc16g04120"
FT                   /product="Pc16g04120 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP93082.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="UniParc:UPI00018314ED"
FT                   /db_xref="UniProtKB/TrEMBL:B6H873"
FT                   /transl_table=1
FT                   /translation="MSSKVKAGQLWGKNKDELATQLEELKLELNQLRVQKIASGASSKT
FT                   QRIGEVRKSIARVLTVINANQRAQLRLFYKNKKYLPLDLRPKLTREIRRRLTKHERTQT
FT                   TDKLRKRAIHFPQRKYAVKV"
FT   CDS_pept        join(complement(938918..939060),complement(938517..938862),
FT                   complement(938188..938431),complement(937671..938134),
FT                   complement(937395..937614),complement(937216..937362),
FT                   complement(936724..936990),complement(935728..936479))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234768" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947727"
FT                   /orf_name="Pc16g04130"
FT                   /product="Pc16g04130 protein"
FT                   /protein_id="CAP93083.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR021665"
FT                   /db_xref="UniParc:UPI00018314EE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H874"
FT                   /transl_table=1
FT                   /translation="MPLIMEDGINMDDLFGEPNSLELGMPAASPIKGLAQCLDEMRLLG
FT                   CCQKIVWSRMGCIASISQGGLRVNVRYLQCRPSDGKWVLGEETSLAPVLEAHNGNQLAH
FT                   ISWNETGSELAVVDCSGRISIYSISIALNSITGLRQASFDSGDDGSQVVGMMWLNTYRH
FT                   IHAFHQAAKVNGRWAYSPFRRRSTGPFHPANKGALICVTRAGQIKLIYQNPDSKWAELP
FT                   AELKNTGYSDRLLTHASMTATQDGILLSTYSACQKMCLYRVDIGWNPSQWEPTLGKPPG
FT                   QFPVPTFRLIHCKVDMPSNILNVNRGPDHSDQSLPFLNSVYSLTRLEIMPGQFDSLAGS
FT                   TANPWILAVLSKPLHAIHDYPDQQGPPSVILRWHLESAPQILHSKFDEVPSKKSNAEAK
FT                   PKMELRRLEDIYCDKYIVSVDLIEHGAVLAVSHDDSSITCYETRTMTVLNGLGDSSTVT
FT                   CLAQAGFHYPLETSGAWLELIWTGLHIAFSPNACVAVTLDVDGHVQLRVMEHSFGSTEG
FT                   LYDEKARTTFISEVYRALPVNCNFTAEQDKLMSHPYIPRCLSLQAGLGFKGRLQRRNLS
FT                   SAVPWASLQLRHASVLFAYFFQYNKGGQTESHDPVKNSSSLPLLVLLASMSRAFLRFIC
FT                   RGLRGVHAGFASTNPASLVGDSRVYYTEICQTLESSPVRIDVYEKFLAGVDSAVKHAYQ
FT                   GAGFGDAERPGPEKELLVNARIPPVLTTAVATLLRQTVPALKSEINRMAIYLGDYSWLG
FT                   FGNDRRTALYRKQREVDILKKCPLRPPLPLGIDGRVALLKKRRCVRCTEVSGDTNLPRS
FT                   LLSFKMIAKLSLLRSCLCGGMWVLETDTGDVGVRTASTNGNGNKVSQS"
FT   CDS_pept        join(940226..940562,940620..941980)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207728" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947728"
FT                   /orf_name="Pc16g04140"
FT                   /product="Pc16g04140 protein"
FT                   /function="NAD+ binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /protein_id="CAP93084.1"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="UniParc:UPI00018314EF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H875"
FT                   /transl_table=1
FT                   /translation="MGDFNLDFSSDSELSSVPPSPTLAARSSPEPAERYPTPSSQEGAE
FT                   PAEGSARQARPAKRRRNPLPKERTTQYLDLSKCLYEQNDQHNLLVQTLRHQKDIVVIAG
FT                   AGISTAAGIPDFRSTDGLFKSLQKKHNLKASGKLLFDAAVYQDDALTAPFHEMVRSLSE
FT                   EVANIKPTAFHQMLARLGIESRLKRLYTQNIDGIETSMEPLATEIPLNVKGSWPITIQL
FT                   HGSIEKMVCQKCRYLDNFKPDMFKQADPPACTECTDNDNARQIVGQRSHGIGRMRPRIV
FT                   LYNEHNPDEEAITSVMNADIKSRPRVLIVAGTSLKIPGVRRLVKSLCTMIRSRKDGVTM
FT                   FINNEPPSGKEFDGCFDLIIKGSCDQVAHQVNLKSWESKDTTPCVYESSPEPIPRNFNS
FT                   TDVSVVVTPKKRPRADTGLATPSSSHDEKPTKKPASKATKIKIENPASNGRSIQDIIKK
FT                   EKPAACKPTSKFVTKPAPNPRPRKAATTAASKKRGTPAAPVSKIASFGRVTKTSQAAGK
FT                   LSTKADGKPMQPVPAGASRNNGPLPKTEQPEKADKLNPESLPRPVASS"
FT   CDS_pept        join(complement(943794..943946),complement(943526..943659),
FT                   complement(942854..943382))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207717" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947729"
FT                   /orf_name="Pc16g04150"
FT                   /product="Pc16g04150 protein"
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93085.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00018314F0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H876"
FT                   /transl_table=1
FT                   /translation="MPPRKSASSVTPADPDDSLLQQSPPVPQSEKPVFATEQQLKARAE
FT                   AGASVEDYLLPRSLTVRLAKSVLPPNTTIQKDAVLAMQKAATVFVSYLSSHANDATLKR
FT                   TIAPSDVFNALSELELDSFRGRLEQELEAYTEIKAGKRKPKKADDNGSTQDALGEGATQ
FT                   GDGDVDMVDNPAKKVKRDEDVEVAVGPPAGDDGDETQEEDVEEEEEEEEESEDDEEEEH
FT                   APREDDLEHVEDLDREPGAKKGPYDPDAEETDEDEDGPGGQLRDDLGLG"
FT   CDS_pept        join(complement(946179..946200),complement(946020..946114),
FT                   complement(944447..945958))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207716" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671670"
FT                   /orf_name="Pc16g04160"
FT                   /product="Pc16g04160 protein"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP93086.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR014813"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="UniParc:UPI00018314F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8E8"
FT                   /transl_table=1
FT                   /translation="MVTKSGFGKTSKRVPVRLRHKIEKSAVQKQRKQRKLAKKNPEWRS
FT                   KIKKDPGIPNLFPNKDKLLHDIEERKRIKAEEQQRIREEARARKAEGLPAKAGTEAVDI
FT                   DENDMMDDDMDAEGNDSNPMAALLASARARAVEYDDNQSEDEDMEEDEDDDDDEMDEDE
FT                   EEGGATIDESAPPLVNSKSYSKESSRRQFDKVFKQVTDNADVVLYVLDARDPEGTRSKD
FT                   IEREIMMADGGNKRLILILNKIDLVPPPVLKGWLLHLRRSFPTLPLKASSGTTANAHSF
FT                   DHKQLTVKGTSDTLFRALKSYAGAKQLKRAISVGVIGYPNVGKSSVINALTARLNKGSS
FT                   NACPTGAEAGVTTSLRQVKLDSRLKLIDSPGIVFPSSSDKSGKKNKKQEEQARLILLNA
FT                   VPPKQIEDPVPAVNLLMKRLSSSENLLAKMLELYGITALFPTNGDKTTDFLVQVARKRG
FT                   RLGKRGVPNIESAAMTVINDWRDGRIQGWANAPVLPVVSADAPAGDVEAGVDTTKVAVV
FT                   TEWAKEFSIEGLWGNGQGDDEEMAE"
FT   CDS_pept        join(946589..946688,946766..946787,946853..946962,
FT                   947030..947511)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947730"
FT                   /orf_name="Pc16g04170"
FT                   /product="Pc16g04170 protein"
FT                   /function="phosphoglycolate phosphatase activity "
FT                   /protein_id="CAP93087.1"
FT                   /db_xref="GO:0008967"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00018314F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8E9"
FT                   /transl_table=1
FT                   /translation="MSSTTGSFSAPTQVHTFDGLLSDFDGTIVDSTDAIVKHWHKIGDE
FT                   LGVDPKVILATSHGRRSIDVMGLYDQTKANWDYVNEIEGRIPKEFGTDAVEIPGGRDLI
FT                   AALETSGARWGVVTSGTRPLVDGWLEVLGLPHPKNLVTAMDVPLGKPDPRCYLLGRKQL
FT                   GIEESTSIVVLEDAPSGIKAGKAAGFKVIALTTTHSLQKLQEAGADWIVEDLRSLSVKA
FT                   VVDGQVQIEIRNAYQ"
FT   CDS_pept        join(947783..947843,947951..948073,948149..948200,
FT                   948246..948501,948573..948905)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977577"
FT                   /orf_name="Pc16g04180"
FT                   /product="Putative uncharacterized protein Pc16g04180 "
FT                   /protein_id="CAP93088.1"
FT                   /db_xref="UniParc:UPI00018314F3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8F0"
FT                   /transl_table=1
FT                   /translation="MSTVWSYSWKLRTVATGAENAGLDAPRPQALGSAYPEMVKGYKVL
FT                   KQLSWFPGRGCNRTRQGMEFTAALHTDRRMTADSCIAVDTVTGRPRAPWHAWRTPFVGM
FT                   QLRNPCSSKPDFFDRALQHATVPATHIWSNHLGRAGRELPFMHAWDMEPDREHGNVSPE
FT                   KLYGGETTAAAASSFGKGVRCSRGYGYSFVPATLEQQHSADVIGGSSGLGDGHILPDWG
FT                   SLGRERMFSPMVLRKATRPVRTACKGATLHPAHESREEVMFECRLLNIVTID"
FT   CDS_pept        join(complement(949994..950152),complement(949722..949814),
FT                   complement(949038..949391))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947731"
FT                   /orf_name="Pc16g04190"
FT                   /product="Putative uncharacterized protein Pc16g04190 "
FT                   /protein_id="CAP93089.1"
FT                   /db_xref="UniParc:UPI00018314F4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8F1"
FT                   /transl_table=1
FT                   /translation="MTPPFGRLCSLSSWHIMPHQPTHKMVSWSKVMARTVLRTEYIIGK
FT                   CERHGHGPVVQHPWIGTPYFVKIRGIGGSAMTTPGSIRNPGYFRRPEYFGQKSQVAELC
FT                   RSINVIDPRGHPRVSLVALRKGLWRCATISSALHITLEFRICQFRGASAPAGRIIHRTR
FT                   HKGTVYNMIGRAIQPGASPWAWSRSELGKRMRTQPAVM"
FT   CDS_pept        join(complement(952854..952887),complement(952667..952761),
FT                   complement(952249..952318),complement(951440..951577),
FT                   complement(950606..950805))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947732"
FT                   /orf_name="Pc16g04200"
FT                   /product="Putative uncharacterized protein Pc16g04200 "
FT                   /protein_id="CAP93090.1"
FT                   /db_xref="UniParc:UPI00018314F5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8F2"
FT                   /transl_table=1
FT                   /translation="MEFGGAGGKIGDETILRRSVPILGTGYMRLMYYEYRDCGYLYSNR
FT                   VGPEHNSDPVQTPLVNPFHHGLFPRTGVTGDRCSGSGDRAQPGMIIQLYDSRIVMMMGN
FT                   DDVYSIYKEPLAAKIQDIWATNLERGVERSPNACLLIGTRRDPNSDLVDTWIVEPGENK
FT                   ATMNRCSGTSALAAR"
FT   CDS_pept        join(953291..953620,953678..955510)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000207695" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977578"
FT                   /orf_name="Pc16g04210"
FT                   /product="Pc16g04210 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93091.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniParc:UPI00018315E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8F3"
FT                   /transl_table=1
FT                   /translation="MSYIHPSWNYQGHQGIPMDQHMAYDPSMVPPPMMHPIDGYMYPHP
FT                   PMEMIDYYHQPIMDYDEYTENLSRPRLTKEQVETLEAQFQAHPKPSSNVKRQLAAQTNL
FT                   SLPRVANWFQNRRAKAKQQKRQEEFEKMTKAKAEAEEAARRKSETLDQLSGSRKGSIAN
FT                   EESEKSATPKQTPTSTSSGHAKTDSTSSRSKHHKTKSESAREATFASLQRALNAACAAR
FT                   DRFGRRINPRSKNESVPEEDEEEEAVSPGSMPPPKAVTPANDHGNLANINSSFSGWSGI
FT                   KEEPASWGSAEHNDNVGYSTTEQTSYSTSCHQAMADISNPSHSMQQNLDVYSNHLPPHT
FT                   EEWSEDRESRHDNLVYSNMQYPMPMQAPDISVTRRESSSALTSSLEGIGICTTGQSGLS
FT                   QPVDRVEATWKEPGKELDLAARRKRPRPAAIGTSGTRPLANSTSMSSLSPTARMPSSGA
FT                   GNSMRQSKSTQSLNSRYAGVRKASAAQRSPLNFTFADSGSIKKAEKMLRPSISTTSLAP
FT                   PTPLTPQDLQHFMPASPTDSNYCLSAHSTAHFFPTSQPMQVNMASPPATPLDIYSPFPY
FT                   QNVAPPMSAPAQVSSFPEYLTCDSVPIPARSWADTGSISSPEYPAGLQVPHSSTVSPMG
FT                   YNATTDHTGQAFGMESVSGSPSLIYSIEDTDIPGSAELAERKRPEFMMHEFPEHDTHFG
FT                   GHHLSSMQKPKAYTFANNTTPSNYPS"
FT   CDS_pept        join(956487..956618,956725..956943,957002..957721)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185073" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977579"
FT                   /orf_name="Pc16g04220"
FT                   /product="Pc16g04220 protein"
FT                   /protein_id="CAP93092.1"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI00018315E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8F4"
FT                   /transl_table=1
FT                   /translation="MRLSTLGSALVGLAVAQASTINYTTVTGYFLQDEESTDPTTFDYT
FT                   AENFGLIGRAYPADKEHKKHGSLTQWERFYHQVTKLNEHSPKHVEYKVLFLGRHGEGWH
FT                   NAAESYYGTPAWNCYWSELNGNSTASWADSDLTPGGISQALKANEFWQKEINEQRIHTP
FT                   DHYYVSPMTRALKTANLTFTGLDMPKHSAAFKPTVKELFREGISVHTCDHRRSRSYIHD
FT                   LFPHWPIEHGFTEEDELWNGVTAEPSGAQDVRSAQALGDVFFTSSKKKSFVSITSHSGE
FT                   ISSILRVIGHRTFKLSTGAVIPVLVKAEKVDEEPATSSVSWEVSPHCTEPPVTSVTACV
FT                   CPSSAVPVTTPLATGF"
FT   sig_peptide     956487..956540
FT                   /db_xref="UniProtKB/TrEMBL:B6H8F4 "
FT   mat_peptide     join(956541..956618,956725..956943,957002..957718)
FT                   /db_xref="UniProtKB/TrEMBL:B6H8F4 "
FT   tRNA            complement(958139..958212)
FT                   /gene_name="tRNA-Asn (GTT)"
FT   CDS_pept        join(959757..960176,960241..961452)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947733"
FT                   /orf_name="Pc16g04230"
FT                   /product="Putative uncharacterized protein Pc16g04230 "
FT                   /protein_id="CAP93093.1"
FT                   /db_xref="UniParc:UPI00018315E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L0"
FT                   /transl_table=1
FT                   /translation="MDPSETQSPPSSRLSAMVLSSSPSDPLAVMASNCSPSEQLSAMIL
FT                   NSSPTQQAPPDASRDAPRDAPTKAPSSRASLFGNGRPSRTPSPPGTPSPLDRRISNKLN
FT                   RSPSRAHRVDALSDQTSGDFPYLAREPSLPYEAWENVFYAMLATYSYEEYDFTYGDVFE
FT                   QPETKKTLSTLRLVNRIWNRIATPLLFRNIQAVVGYSAGRPLDSILRISESPYALYVRD
FT                   VRFGFVGSWLPGLDYDRYIDDLAAGALPILISRFQNIQTLRLQTPTVIDTFSEEGQLKP
FT                   AMLAKLTNALVHTLRLVSVPILKCLHISMPTTAEFARFFESNSYTGGFTNIFGQLEELH
FT                   ITINDSTGPDGRRDPKWPRSVIKTKYPPDRFAPYLIQLIAYARRIQVFSLDARTWFDVS
FT                   DLEAESFTKLKSFRLEGVRINHKTLRQIFIEARDTLHRIQLVHVRLMSGTWQEVFDHSA
FT                   LPPKDLSWLYVHGCGYSMTGASARYMGSTFSRYPTALWTRYAPDWLAITHWRTVVNTNR
FT                   QRRSLPICPYCYYPSIEPILRDLGSN"
FT   tRNA            962023..962096
FT                   /gene_name="tRNA-Asn (GTT)"
FT   tRNA            963543..963616
FT                   /gene_name="tRNA-Asn (GTT)"
FT   CDS_pept        join(complement(966869..966932),complement(966568..966681),
FT                   complement(964539..966427))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207684" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977580"
FT                   /orf_name="Pc16g04240"
FT                   /product="Pc16g04240 protein"
FT                   /protein_id="CAP93094.1"
FT                   /db_xref="InterPro:IPR013933"
FT                   /db_xref="UniParc:UPI00018315E3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L1"
FT                   /transl_table=1
FT                   /translation="MNGMDIIDGSGTIDPANLSNSVSVALPAHSHAIASPRGVKRSRTP
FT                   DRMGNGRGQGGQDDEEQSRRKRGRPPKTPRPSSSDQAIANTSVQTPQMQARPLSQATAG
FT                   SPSLASPDSKGTPTKALVKALPTVRDHTSDQLNEEGDEYIPKEFDEAGETKADPMGYPL
FT                   GGREYKCRTFRVPLRGRKLFMLATECARVLNYRDSYLLFNKNRSLHKIIASQIEKDDLI
FT                   QQDILPYSYRSRQIAIVSARSMFRQFGSRVIVNGRRVRDDYWESKARKQGFTEDDLAGE
FT                   KRPGAAKARDGSVSEPATNMLPALPHNDVVYSNAIEPLPHGLSLDTSESSLSLAPVPMI
FT                   QMSTTDDPRLRDYTVMPRARQELTGQAYHDRTQTSSAADLMNQAQHTSDFNKMLSIQRS
FT                   FRQKGLDEFYSKPREAPVSETQSNTALESGLSVSQPVQVSQMPSAGMPNPAHTQHMLPQ
FT                   QVPMQPNPMMAGQPNYPQQPHPQSVGQAPLRIPPNMQPNLMQQRSNPSMGGGMGQAPPY
FT                   GYTPQQQQIWGQPPPQPQPSPLPSSGHHGVGMAQYGQQMSAGPQQSPSPLGHHPQQQHP
FT                   QQSPRNQQRQSIPQMPQQYSQMQHPQAPQTQGMQGMGYPGANPAGYPSVARAMYPPNQS
FT                   QPFMGGNPQQAGIAMNMAGNGMPGWPAGPGGPMQPGQPQPGQSGSPLGGGWSY"
FT   CDS_pept        join(967000..967101,967143..967243,967655..967773,
FT                   967945..968006,968114..968215,968315..968452)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947734"
FT                   /orf_name="Pc16g04250"
FT                   /product="Putative uncharacterized protein Pc16g04250 "
FT                   /protein_id="CAP93095.1"
FT                   /db_xref="UniParc:UPI00018315E4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L2"
FT                   /transl_table=1
FT                   /translation="MARQVNAQGTRAEEEWKVAQESRGMLMQDFQTSKVGSRMNLGLRG
FT                   EGTRGGEDGSLRVQVFCKEDVHGLVILSRDRSDINRILATVKRIRSKWKRREWGSFCDV
FT                   LVAAIESSIWIEKHGEGPCVFWATESTTLFGFETPNYRYSGRNTRSTQGTVHIGANHET
FT                   MGRVYGRTNNFVWNVPEWRFFLFRFRARSITTRVGVPDTVTDSG"
FT   CDS_pept        join(969664..970103,970216..970264)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128693"
FT                   /orf_name="Pc16g04260"
FT                   /product="Putative uncharacterized protein Pc16g04260 "
FT                   /protein_id="CAP93096.1"
FT                   /db_xref="UniParc:UPI00018315E5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L3"
FT                   /transl_table=1
FT                   /translation="MSQVSQQRGLAELPFSTLGAGFSSPSHRWQDLCQAHRAQGDLVAP
FT                   NKERLDLVSLVDAHYIPYMSHLGPLASGPSRATPDATCFLNYHLRKWTGIDFMDHRLAP
FT                   SGVSVLCYADLLGYVLFLNDMHKYTWTYIDIMSLSISSKGNRRHIGHVRGQLIDADMR"
FT   CDS_pept        971962..972840
FT                   /pseudo
FT                   /gene_family="HOG000234604" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(972915..973268)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(974216..974266,974409..974627,974691..974759)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977836"
FT                   /orf_name="Pc16g04290"
FT                   /product="Putative uncharacterized protein Pc16g04290 "
FT                   /protein_id="CAP93099.1"
FT                   /db_xref="UniParc:UPI00018315E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L4"
FT                   /transl_table=1
FT                   /translation="MAPANAAQLLANTCKQFEISIHPKHKILNYASLTVGAISTSVAPS
FT                   SKQYHTITNSIKQTRGSLRVPGAEPLNYSVDRAAPLARNYLTKDEIVSSSSRLPFQDYI
FT                   SRITIRFV"
FT   CDS_pept        join(complement(975088..975612),complement(974876..975004))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948767"
FT                   /orf_name="Pc16g04300"
FT                   /product="Putative uncharacterized protein Pc16g04300 "
FT                   /protein_id="CAP93100.1"
FT                   /db_xref="UniParc:UPI00018315E7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L5"
FT                   /transl_table=1
FT                   /translation="MAVARLRNLHVRPQFSPSHSLPLSLSLCLCLCLCLCLCLSVIQNL
FT                   RGTFTSDISNSSYTWDEMSQATPVRIVLPYREQPFQKPTAIINAFFTWRGIQPLREDYY
FT                   THICSDPRSSRLYLVLDLHCKTHPNVDLSNLDLEVFKVSGIDPLCVILFYNLTKLTVFS
FT                   TFQDLGEVARKQGGQYPAISMSCTSRSNGRSLRNPEGGMHGSFTVLLAGVQKIM"
FT   mat_peptide     join(complement(975088..975498),complement(974879..975004))
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L5 "
FT   sig_peptide     complement(975499..975612)
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L5 "
FT   CDS_pept        complement(976909..978222)
FT                   /pseudo
FT                   /gene_family="HOG000234693" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(980179..980301),complement(979691..980113))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234872" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948768"
FT                   /orf_name="Pc16g04320"
FT                   /product="Pc16g04320 protein"
FT                   /function="carbon-sulfur lyase activity"
FT                   /protein_id="CAP93102.1"
FT                   /db_xref="GO:0016846"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniParc:UPI00018315E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L6"
FT                   /transl_table=1
FT                   /translation="MAAAADKIKPYIPLAGCADDGWTKEDQATATCYCGGVQLAFPTQS
FT                   PGLVDTFICHCTDCRKITASMFATNFIIADTYLKHIRGEEILTAFKQSKTIASGKAMTN
FT                   CFCSTCGSLMYRISEAFPGHSILRTGTVDDFNLHETKLKPRTEMYAKDRVEWLCGASGV
FT                   KQVEGSMSTPKTTGPPRL"
FT   CDS_pept        982455..983162
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948769"
FT                   /orf_name="Pc16g04330"
FT                   /product="Pc16g04330 protein"
FT                   /protein_id="CAP93103.1"
FT                   /db_xref="UniParc:UPI00018315E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L7"
FT                   /transl_table=1
FT                   /translation="MSPATRLLDEYLKEGGYQKWGWVIYRSTYQNDEDWNCFKGVITEA
FT                   MRKSIEHHKTPDLDHSLNQSLSLTFLEDRPNFENASKDQLRAHFQEWAQRAYYAENPRP
FT                   FEEFNPDLATAPRYRYFIQIDEKSLQSLLHDTESGPRLRGLQSNGYVNFVDGWWKSLRE
FT                   QYATSQDPDLKEEIDEQLAHGYQSIEGCVEENTGWTMLHRLDMSVSFYHYTSGFVEDVW
FT                   PLYYQRPPGIALW"
FT   CDS_pept        985719..986294
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207673" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948770"
FT                   /orf_name="Pc16g04340"
FT                   /product="Pc16g04340 protein"
FT                   /protein_id="CAP93104.1"
FT                   /db_xref="UniParc:UPI00018315EA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L8"
FT                   /transl_table=1
FT                   /translation="MNTGTTQRAPKTPKPTASVPIVQNKRWPPMANRNALPYKLTHLSK
FT                   EKLAREATAPDPDLRRCVAHFRLHCGSVSWTENDMKSRISSFDFEDTDEEDDVDEINTE
FT                   LPVLKNRAPTNETPVEVTQQLSQKSEPVAVAATPTPPAPPASPESTSSTSSENSSEHGF
FT                   LEKGRNCLEATSKHLWTGGSCIVSPIAG"
FT   CDS_pept        join(complement(989283..991210),complement(989108..989221),
FT                   complement(988395..989037))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217652" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948771"
FT                   /orf_name="Pc16g04350"
FT                   /product="Pc16g04350 protein"
FT                   /protein_id="CAP93105.1"
FT                   /db_xref="UniParc:UPI00018315EB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L9"
FT                   /transl_table=1
FT                   /translation="MKLDSRFFFFSLALAVQAYDDALGLSNGYTSLSTANFDIKLVKDS
FT                   QVLASLKPAGEAFDFLPFDDITYRAANGQYHNGDIAYRYRLSGSTEWTAGDSSKTRKSL
FT                   KSAESDALAAAEMTRTLPTSPIHILREWIDVDGDLGLTFTLTNKGKQTLEIGSLGFPTE
FT                   FNSIFSNRTAEDMVAKCSLTDPYIGMDAGYLQVNPTSGTGASLIVTPLFNTSTPLEAWR
FT                   NLGEPSTEPLLYGSQTFEGFYEWQTHTKAYAENEWSGVTPWNEPSSRLVSPGESVTYGL
FT                   RFTVVKDGVRGIHDAVKATNTPATPGIPRYVVPVDLTARLYVFHSRISEVVSEDNSFKI
FT                   TQGANGILSLTPTGSVWGRTRVTITYEDGKVQTVHYFIMDSVPATIGKLGEFSTTSMWF
FT                   NDTEDPFHRAPSVITWDHSTQAQVLQDPRVWISGLSDEGGVSYLASAMKQSGLADATEV
FT                   SKLEQFASDVLSKTIQNPDFTVRKSIFFYETAQLPEYTYDRSIDWGNWWSWNKDASYAT
FT                   DRAYNYIHVIGAYWALYRAGRDNGSLLKTHTWQWYLSQAYNTTVTCFATDSAGNGLVGY
FT                   SRLGLMGETVVGELLSDLRREEWTAEADAVEAAMKLRAEAWDTEDVPFGSEMAWDSTGQ
FT                   EGIYYWSNYFKLTNTATKTINSILGYMPTVPHWGWNGNARRYWDFIYGGKLQRIERMIH
FT                   HYGSSLNALPLLSHFRQNPTDTYLLRVGYGGIIGPLSNIRQDGSMYNAFHSFPDTLQGD
FT                   DYSGDYGPNFLGMMLGSAVYVVDDPDVGLVAYGGNIDTNGDTVTVQPRDAVRRRVYVAQ
FT                   MGVYVTISAGLIEEVSFDISRPTSLQLRIVPGSSDVSSVVAWVETPGTEDEYAVAGDQL
FT                   ERVRGGWNVKFASEEANVVVSKL"
FT   mat_peptide     join(complement(989283..991156),complement(989108..989221),
FT                   complement(988398..989037))
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L9 "
FT   sig_peptide     complement(991157..991210)
FT                   /db_xref="UniProtKB/TrEMBL:B6H8L9 "
FT   CDS_pept        join(complement(993381..993511),complement(992887..993319),
FT                   complement(992636..992833),complement(992308..992583))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211110" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824609"
FT                   /orf_name="Pc16g04360"
FT                   /product="Pc16g04360 protein"
FT                   /protein_id="CAP93106.1"
FT                   /db_xref="UniParc:UPI00018315EC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q5"
FT                   /transl_table=1
FT                   /translation="MNEHEHNKAPNHSRPLLYVPNTLWTRLFAATVVIETVLTVAIESW
FT                   ILMSLWDDLDSDSESNGTMRLQSFLGLYIFALLYELALSYDALRRKNTIQLVGLCICNQ
FT                   GLFTYGLLQMNEIKDTISSSTNKDFGDRLKDVYHIEIIIVPVILGVGTVCMSFFTWKLR
FT                   AEFSWSIYKNVSADLQMKRRYFTYQVYIALLKFDFFFVFGTQLQILLVIFQAPEDMDFV
FT                   VNASVIPITIATLVLSAQFCKREKRKSLMFMMFLMLLIVGFLVLILLRMYSPGDHTDFS
FT                   SFRTSLTLFAGVSLLLMVLTIINSVMCILNFNKGLKNHVHPPKKGKTVSLELESQETPT
FT                   RFLLN"
FT   CDS_pept        join(complement(997463..997627),complement(996642..997385),
FT                   complement(994573..996591))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207662" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671905"
FT                   /orf_name="Pc16g04370"
FT                   /product="Pc16g04370 protein"
FT                   /protein_id="CAP93107.1"
FT                   /db_xref="InterPro:IPR013948"
FT                   /db_xref="UniParc:UPI00018315ED"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q6"
FT                   /transl_table=1
FT                   /translation="MASRIVPNILDPLSSSALNKLHEPAPPPIKKRKRGEQEELNDTAG
FT                   QLATSSIVIRAHSASLSDEPLILEPITALPRTRLPLSWLDDTPASRSDEQAGGLFTADI
FT                   PTLEIDLRAKTEPTVLAVRLVPNGGLYIIERVKMGLYSLSKLARWIHEGNLVVAAKGWQ
FT                   GIDAAVDGEAVDETGGIPDGFDWWQVAQIDEPLSDVEMGEKSAGLDIAVVFGSSESDVG
FT                   NIETSFVGVVEHRGQSLAPSRSFDAAEGGAFLLPESQGLGDDAAAMEVDGVDSNVVDVQ
FT                   QSPEELLDGMRDNYLQALYVSKTSVAYFAKGPLTRCRTAFQARDSEQPHGSIELIESYR
FT                   EAILATKKMDLKYRETLPSAIRDAVLALSDDGAKSKKRKSKKKKMGKNGLYPEEEAFIH
FT                   RWWKDRILNESSAQETSREAESKKQISDLRLRETQLQILLILEVMVLEMTIASAEKNNT
FT                   SKEKDVNGEQGTSKKTKPKRSTDLNVLLELHLDRMCIWHAVTMEETSAADTAKASSFSG
FT                   SHLSGKKVESDAVRDFCTEVIIPFYAARLPDKCKLITRKFGVSGGISPAAKKTQSSSKS
FT                   HRVEPGAEVKRQQPAPKPRRTLQRVLTDDKAAASQARHPGLTRSNTAPSQHNAKRDTEP
FT                   LLPTVLSGSVRGGIQKAKRTENREVDLNAVARQHEAKLRKVQMLANQKKELDAAIDALR
FT                   KPNRELVSKDLADDASKRAMSGGGSSRKSRNPVRNPFGEGVQVMATPRGNRRKDAAPRS
FT                   LAPSRSFAGVENSPFGESPIMIPSSSRRAISFSGADSDPFNSHDNPPGGRSPRSSQPDG
FT                   AIQETPTRPSSKIFQSDTIAARRPSSSTGKGLFRVPNLPAPRSSTQPMVPGSPVHSRPK
FT                   NISAFTENLSTSSRQFSQSLNHARASAIMETPPRRQAPQSISTPTAVPFSLSLDAMVTD
FT                   NPRAHSPPAVMGTPVKGAAAVPVTPDKSQSKSIYEQLGWDDEMEF"
FT   CDS_pept        join(complement(999657..999733),complement(999472..999557),
FT                   complement(998417..999417))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000245710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948772"
FT                   /orf_name="Pc16g04380"
FT                   /product="Pc16g04380 protein"
FT                   /function="ATP binding"
FT                   /function="magnesium ion binding"
FT                   /function="methionine adenosyltransferase activity "
FT                   /biological_process="one-carbon metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP93108.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004478"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniParc:UPI00018315EE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q7"
FT                   /transl_table=1
FT                   /translation="MGSVSNSGTFLFTSESVGEGHPDKIADQVSDAILDACLAEDPLSK
FT                   VACETATKTGMIMVFGEITTKARLDYQKIIRGAIKDIGYDASEKGFDYKTCNVLVAIEQ
FT                   QSPDIAQGLHYEEALEKLGAGDQGIMFGYATDETPELLPLTVLFSHKLNAAMKAARQDG
FT                   SIPWLLPDTKTQVTIEYAHDNGAVKPLRVDTVVVSAQHTDDVSTEELRAVIKEKIVRKV
FT                   IPAELLDDRTVYHIQPSGRFVIGGPQGDAGLTGRKIIVDTYGGWGAHGGGAFSGKDYSK
FT                   VDRSAAYVARWIAKSLVNAKLARRALVQLSYAIGVAEPLSIFVETYGTSSKTSDELVQI
FT                   IRNNFDLRPGVIVKDLDLAKPIYYQTAKNGHFTNQEFSWESPRTLKF"
FT   CDS_pept        1000084..1000953
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207661" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948773"
FT                   /orf_name="Pc16g04390"
FT                   /product="Pc16g04390 protein"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP93109.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="UniParc:UPI00018316DD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q8"
FT                   /transl_table=1
FT                   /translation="MSKFGVLVMGPAGAGKTTFSNAVIQHLQTTRRSCFYVNLDPAAET
FT                   FAYEPDLDIRDLITLEDVMEEMGLGPNGGLIYCFEFLLQNLEFLSEALEPLSEEYLIIF
FT                   DMPGQIELYTHIPLLPTLTTFLSRQGPLNINMCAAYLLESTFVIDKAKFFAGTLSAMSA
FT                   MLMMEMPHVNILSKMDQVRDMVTRRELKRFTNVDVQLLQEKEEDDLTAGANPMAADSLM
FT                   SGGSFKQLNRAVGQLIDDFSMVSFLQLDVSDEDSVAAIVSHIDDAIQYHEAQEPREPKD
FT                   EVEVNYED"
FT   CDS_pept        complement(1001567..1002028)
FT                   /pseudo
FT                   /gene_family="HOG000217059" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(1005747..1006015),
FT                   complement(1004621..1005623),complement(1003121..1004568),
FT                   complement(1002966..1003053))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207640" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824610"
FT                   /orf_name="Pc16g04410"
FT                   /product="Pc16g04410 protein"
FT                   /protein_id="CAP93111.1"
FT                   /db_xref="UniParc:UPI00018316DE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q9"
FT                   /transl_table=1
FT                   /translation="MASPLGFGGSPAHSESFSSPNPHPITPPVRRKPLPHNGAPVTSGP
FT                   DHPSSPISLEGDKPTSIPTAPVSRPLSPLSVDGDSNISVQKNPNRVWKTNRVPLSHLPR
FT                   YSRGRHPIQPLHIDTAASRHGSASYLRSVLEDDDDDEDEGPDYFDEEYEHQFTNGTPLH
FT                   SRLDSEPFIPVLKSPPPTKRSSRRATSMALHPPMSRPPPLHIDVDPRSVSMSMGAGDPR
FT                   HPKTPGNKISSFFGWKAANNNTVTSPGGESSSTEISDSGRSAMPSPMPPLANVPFKPGS
FT                   PYDPKTNGYGLPARTPSLGASSLKESIFTSKMAEIENELREISSELAGSIRREMELEDL
FT                   VERLQLEGPDVNRRTSDYFSDSGTSSVRYASDPGKNEDIEKIRRAAEQERAQLKVELSQ
FT                   KLQEERSQRLASESHVQILESQVQQLRRERTDLSDLSSKNKELETALENTKRKLLEERQ
FT                   SKDNFEDLLTAMRVELEQLRNDRDQLRDNSLVEEIEALKIENASLAQLQGGRFASIAEE
FT                   GGSPRNSAFGVSRSSSIARKPSGLARSGSLSRSNSINNNNSGGKSPETRESLVDKVHDI
FT                   EVQRDALHRTLRSLLDRQAYQAREYEKRTRILEMELARAQQSGQPRKLGYERDVRNLRD
FT                   EVNHLRMRAEDALDGKWQCEKNLAGLKMDLDRAEQETSSLRALLLEDTSAGAELMTGQE
FT                   GFAEVVTTSSSLQSAFQQLQADRAEAEAGVADSEELSSSLARTEALGSKIDYQLQNNAS
FT                   LHSRLAAAIDKGDKDQQISVERINVLQNRMRELEEVLLVAQNHSEEEMGKHEEEIRLLK
FT                   ESQHAQLTRMMNGGRSTVGLSPRPPNAPFDSRSPRLDQTTSGQGVPLTEVVQAEILERR
FT                   VKDLEKLLRDADMEMEQVVGRMNRTQIDVAQLQTDRDDALRQTRQLQTEIQAERDALRG
FT                   LINAL"
FT   CDS_pept        join(1008183..1008314,1008362..1008853,1008910..1008957)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128953"
FT                   /orf_name="Pc16g04420"
FT                   /product="Pc16g04420 protein"
FT                   /protein_id="CAP93112.1"
FT                   /db_xref="UniParc:UPI00018316DF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R0"
FT                   /transl_table=1
FT                   /translation="MGEETAKPSGRKRGRPRTVTDDQEVPEVGQTLTLQLHMLIIINLX
FT                   RRRKQLRLAQQAYRKRKETTIGNLQNRVHELETGIENISHSFLSFSSLLIEEQLLSQYP
FT                   HIASALQIITQQCVSLAKAGSEDPSEGALPVVRATKESQTTNNNIPPTRVLDGAHSEGS
FT                   TDAEDIIRPAATGWPGPPTPPYQGQSISPFDLVMSSSTVQFPHTTPPLSNYSTLDPQSS
FT                   NIMPARQWNIAQRIVRTCSELGYRLLIDKPNSSLVQHIFGSALSLQQRNRLISALYAVM
FT                   QEDTGVLTDPKADVLHTLLSGHNMNPCSDEQLQISSRTWQIALESTSGEWMDAIGVQRY
FT                   LRDKRAIFENFTDSLGPHGYSVSPSLDITAFIKSLSKEAICVGNGPAFRRQSVDKALRL
FT                   ATISGPWDLDNFCNL"
FT   CDS_pept        join(complement(1010557..1010593),
FT                   complement(1010162..1010449),complement(1009988..1010062),
FT                   complement(1009749..1009930))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977837"
FT                   /orf_name="Pc16g04430"
FT                   /product="Pc16g04430 protein"
FT                   /protein_id="CAP93113.1"
FT                   /db_xref="UniParc:UPI00018316E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R1"
FT                   /transl_table=1
FT                   /translation="MDMDNTSRPAINIWTFFALAALDLAANAAAGPAAVATAAHVNGSP
FT                   LTARAMQIGALAGVTKSGVLAFVEFAAYAGLPTAAWILLALVASSFGICVLVTAEVSNL
FT                   VLGETPSALLVAAVVAAIPLSGECMGIYQSAGGLYGGQAQSQLFVLGLDALGGYVFARM
FT                   AHNGGQSLSLLYHESFGSTLFAAPVAPLDD"
FT   mat_peptide     join(complement(1010162..1010372),
FT                   complement(1009988..1010062),complement(1009752..1009930))
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R1 "
FT   sig_peptide     join(complement(1010557..1010593),
FT                   complement(1010373..1010449))
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R1 "
FT   CDS_pept        join(1011311..1011364,1011460..1012401)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948774"
FT                   /orf_name="Pc16g04440"
FT                   /product="Pc16g04440 protein"
FT                   /protein_id="CAP93114.1"
FT                   /db_xref="UniParc:UPI00018316E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R2"
FT                   /transl_table=1
FT                   /translation="MNSTACVIEANPDVSGVGIRISIYALCLGGSIVNYLLRVFAPGED
FT                   QEEFSRGVSSALGLQGLALLCTAIYQTVRGELTLFHAICVVHLLAILGMDMVSKGRYSG
FT                   LGPWRLYFFSAIQVLVLAAFLALNVYVWVTAPQFGSQPQCNKNTVYVVFGVSINATSPV
FT                   FRYIILGTLGAIVAGYVLTFTCMLPCWCGYVVYRRRHPDAGNRTEGQKRGWMNWFVQVN
FT                   HPVYQDRRGPPERLYGQALLNFTLNKVAYCSFCIYLIVSLEQTIHRNNLDPEEEGWTFG
FT                   QVIAIFLLLGVANELLNVLLASWDRRQAESSQQLVQFRPGTGNTVHSLSS"
FT   CDS_pept        join(complement(1015448..1015655),
FT                   complement(1013929..1015412),complement(1012927..1013871))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671906"
FT                   /orf_name="Pc16g04450"
FT                   /product="Pc16g04450 protein"
FT                   /protein_id="CAP93115.1"
FT                   /db_xref="InterPro:IPR022091"
FT                   /db_xref="InterPro:IPR022092"
FT                   /db_xref="UniParc:UPI00018316E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R3"
FT                   /transl_table=1
FT                   /translation="MAQNSQTQKPKWGVGSFFQQAVAGVESRLDHILMDEEGNQSNSTA
FT                   KPTETQGGEAPPTKAPVPCMRPTTPVSRSSSTARRNDRLQERLARAMVKQNTSSLSSKS
FT                   PQSRVSSLPASPVPSNGARSSMDMDSSVASVNSAVEDPKAPQSNDDSNPAKLASPRISY
FT                   DSGVSPRVSTEISVTDSAPRTSVDVVQPSIDSAKASQETSDSQRDSVLNDLDSGDSPRV
FT                   SVESPSEVPEEGENPDIARLRAERKTAESQWQEEMHGYIERIDALQSKLKYLAKDAAES
FT                   AKNAAASATPGSTQKQLLEKDEKIALLLEEGQKLSKSEMDHRTVIKKLRQQLTEHTKSQ
FT                   AEMKRKTDKLERDLANSEARAKRAEAAEKRATESLSSQTKSTKDLEAVTNERNALSQTV
FT                   QDIKSQLSRAVSRAEAAETKANSDALELEKQRARELDEELCNLKIEHDISEERSKREIT
FT                   ELKEKIDQEKERARMLEAELKGEQSVLESKMESLRSRAEEASSGATGETQAKLLRQIET
FT                   LQTQYAAASENWHTLEGSLLSRLASVEKERDDAGRREIDLRKKIREMNHKLKKFEEELD
FT                   NAKEAEHDLSSRLEERMEELQKLQQKLEKAADDLASTQKDMAEQKKTCDTTWAQKLEEE
FT                   RAKWREQVNSPSQLRGVSPVASLRRSSTLDAMTPGQPECRPPSRRSSTMAFASPEIGTP
FT                   PRQNSYPASITQATLSPPHINTNPSLMAAPSITFEPDEYFEDSGTPATPSAYGGTQAHP
FT                   PRGINDIISESTVGAGPSVQLVERMSATVRRLESERAGSKDELARVTTQRDEARQQVVD
FT                   LMRELEEKQLSDSRVQELEAELEDLDQRYQTTLEMLGEKSEQVDELNADIADLKKIYRE
FT                   LVDSTMK"
FT   CDS_pept        join(1016199..1016493,1016552..1017077,1017139..1017751)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207607" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948775"
FT                   /orf_name="Pc16g04460"
FT                   /product="Pc16g04460 protein"
FT                   /EC_number="3.6.3.6"
FT                   /function="binding"
FT                   /function="hydrogen-exporting ATPase activity,
FT                   phosphorylative mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="vacuolar proton-transporting V-type
FT                   ATPase, V1 domain"
FT                   /protein_id="CAP93116.1"
FT                   /db_xref="GO:0000221"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0008553"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="InterPro:IPR004908"
FT                   /db_xref="InterPro:IPR011987"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018316E3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R4"
FT                   /transl_table=1
FT                   /translation="MSLEPPTYLSSLQNNIRARPIPWEGAVRAGNITDDHLKKIKAVDK
FT                   VRKDQRRQTIEGDLAAYTGLLAGGAQGKSVLDSASRRTDIVQYILVLASDLIQDVPSLA
FT                   SSLVSHPEPYKPFLPFLQHSTNAEDPIPLLTSTFLTALVSHSLVASSKPAPRDNEALPQ
FT                   LYTYLSTLTKNQDSGLQDIGVQGFSELLRTSRAREIFWAQRQETLAPLIDTLRAAAGAK
FT                   DNVGNASTLGSSSRSVEPGLAGGVGLQLLYRVLLVLWQLAFEGALVGDELQENYEIIQL
FT                   YIHLLRLSPKEKTTRLLVATLYNLCSSNRTTLLPIAVFLRLPALLTNLSGRHLTDPDLL
FT                   EDLNALSSMLEEYTKTQTTFDEYAAEVQTGHLRWSPPHKNPTFWKDNARRIVEESNGAL
FT                   PKKLAEILSKSWDNDKQVLAIACSDVGHLVKEVPERRGQLERLGLKTRVMELMVDQDES
FT                   VRWESLHAVGEWLRYTFEG"
FT   CDS_pept        join(1018171..1018366,1018417..1019703,1019752..1019783)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207618" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948776"
FT                   /orf_name="Pc16g04470"
FT                   /product="Pc16g04470 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93117.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00018316E4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R5"
FT                   /transl_table=1
FT                   /translation="MSRSFTGCKRCKARRQKCDEQRPNCGRCQTAGEQCQYAMQLQWGG
FT                   RAFSRSRFGACVGTGGMQRLEYSPGEFIYTTKTAVQPASASTGSDLTLSQPVDPFSSLS
FT                   SSQKALLHHFINDASQITACHSGMQQDICRMLIPMALQTPSLLYATTALSAIHIQALHN
FT                   QSESVKSAPDIARLMALSLEHFRTELQNPSSKDPEALVATARTLCLAEIHSGAINPNSW
FT                   RAHIDGARALMRASDAAGEDSLRSTSGFRRYLDRWYWSIVSLTALTGNGPPIGDISDFA
FT                   SSDLMGLGGSTDYLDDYWGFSVDLAAVFRQIGAAAWRSHEVEKATQGFVAGEVDASVED
FT                   DAASLESAVRQLMDRDSTTQPSFYPSAAKSLSAESAQQLLLCNEAFQHSALIQIHRRLR
FT                   KTPSMSPEVQQSVQRILECTAQIGPSSGLSPWVMLTTPIFIAGCEARGQDRDTVRQLLS
FT                   SLHDTIRVPNVLQSLKFLEQYWANQLSEEEDWSHFLERMQFDFIPY"
FT   CDS_pept        join(1020598..1021414,1021480..1022405)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128954"
FT                   /orf_name="Pc16g04480"
FT                   /product="Pc16g04480 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP93118.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018316E5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R6"
FT                   /transl_table=1
FT                   /translation="MASIIRDAPFGQLVRLLTNNKYFQYPEEKPDFKLPDTWLQLLNSN
FT                   GDEDDEKKAIQQDSNRSPEDSEPLSRASTQASIEFTEARLEADEQHEIEKIKSIPIAPK
FT                   KTKDGSILVDWYYTDDLENPHNWSNGKRAFITILICLYTFVVYTTSAIYTSSTQGVMKE
FT                   FGVSTLVATLGLSLYVLGYGTGPLVFSPLSEIPVIGRNPVYIITMFLFVIISIPTAFVG
FT                   NFAGLMVLRFLQGFFGSPCLASGGASIGDMYSLMNLPFAMMAWVAAAYCGPALGPLLSG
FT                   FAVPVKGWRWSLFESIWASAPVFILMFMFLPETSSATILLRRAARLRKIHNTNRFMSQS
FT                   ELDQRNMRVSDIAVDALIKPMEITIKDPAVLFVQIYTAIIYGIYYSFFEVFPLVYPVDY
FT                   NMNLGQIGLVFLCVLVSCIIGIAVYASYIHFWMNRRIRRFGFPVNEKLLIPALPASFGP
FT                   LIGLFLFAWTARASIHWIAPTIGITIYGATVFIVMQCIFMYIPLTYPKYAASLFAANDF
FT                   FRSALACGSVLFAHPLFGNLGVARGVSLLGGLSVIGIIGIWLLYFYGGRLRALSKFAIS
FT                   DPVE"
FT   CDS_pept        join(complement(1024131..1024460),
FT                   complement(1023181..1024079),complement(1022961..1023126))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000199710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948777"
FT                   /orf_name="Pc16g04490"
FT                   /product="Pc16g04490 protein"
FT                   /function="acid phosphatase activity"
FT                   /protein_id="CAP93119.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="UniParc:UPI00018316E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R7"
FT                   /transl_table=1
FT                   /translation="MRSLVLLSAASALAQTPGDSFYPPKLNDTSYISNSSIETYGGIYE
FT                   APTNGPTGGNPYGTYDYCSMPHPRSEEYELPEALANGSTEGKLVYLEYLQRHQRRTPYN
FT                   ILPGGENQEYHCDDVRPYLYAGPNSASGIQPMPMYAQTYQDPSNPFTPGVNGTCQYPQM
FT                   TIGGVQDGYQHGKDLWGVYGEKLGLIPAKPNSRVWFRSSESALTQASAGAVLRGMWPGH
FT                   KEALPLHQMVTSVNTVNSGYSCPAVSSTLSSMKTTTQWKEHLAVTEELRSELGAMLGAT
FT                   ESSWQSTFDHFADNFQGRLCNGYDLPCSLTNSSSCVTMQMAQEVFRAGDWEWNYYWRTN
FT                   PDVVKYIQVVEGLFIGEIISRLQAVLDGNSSLDYSHIFVHDGDIGPILGALGIETLRWP
FT                   GMASNIAFEVWETKDSKDEASFYARVLYSSHPIRSIHGVLDWVPLSKLIDIMSPYVPED
FT                   ITSLCG"
FT   mat_peptide     join(complement(1024131..1024418),
FT                   complement(1023181..1024079),complement(1022964..1023126))
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R7 "
FT   sig_peptide     complement(1024419..1024460)
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R7 "
FT   CDS_pept        join(complement(1025681..1025912),
FT                   complement(1025300..1025637),complement(1024928..1025239))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201342" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948778"
FT                   /orf_name="Pc16g04500"
FT                   /product="Putative uncharacterized protein Pc16g04500 "
FT                   /protein_id="CAP93120.1"
FT                   /db_xref="UniParc:UPI00018316E7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R8"
FT                   /transl_table=1
FT                   /translation="MSRPRRNVNFYDGLTGAHLGGVRQNGSITNANFFHMLMDVLLEAD
FT                   GIISIDHRGTGQRMPMNTDRLAEGDYDIFCPRGGIRLTEENFVRRVYSRSRSSRENSFR
FT                   DSVRARDGKCVLTGVVNNGASEGMWTGFEAAHIFPLERRELWRQCNFDRLITRPGRNPI
FT                   NSVQNGMLVSSSVHRLFDSFLISVNPDDCYKITDFAQNNWQADGRVLDIVCLNPNNPDR
FT                   VADDLLRWHFRQSVLANMKEAGEPIFEHDFPPGTDMVKEILQGPFPAERMELELFSRLQ
FT                   STPQENDDESAY"
FT   CDS_pept        join(complement(1027830..1028033),
FT                   complement(1026210..1027751))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824611"
FT                   /orf_name="Pc16g04510"
FT                   /product="Pc16g04510 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93121.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI00018316E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R9"
FT                   /transl_table=1
FT                   /translation="MQPGAERGPKHSVYTLPEIPLVNRHADDPRKLRVAVIGAGLSGII
FT                   AGVLLPAKVPGIDLTIFEKNADVGGAWFENIYPGVRCDIPAHVYQSSFEPNTQWSEVYA
FT                   QGAEIRDYWSEAARKYDVYTYLKLSQRVEHLAWDNEQSIWLVKVENLLTGEVYVHEADF
FT                   VLTAIGRFNAWKLPSYQGIEDFKGVIRHASNWDPTFDVSGKRVAVIGNGSTGIQLTTNL
FT                   QSQVARLDHYVRSKTWIATDFIGDSTALQSFPIPKETRDSFNDIDVYLKYRKSIEQSFW
FT                   RGFDGWLKGSESNEHARGEYIRHMKKRLAKKPELAESIIPEFSPSCRRLTPGPGYLEAI
FT                   TAENVDYIQTPIRRFTETGIETVDGKHREVDAVFAATGANIDAVPPFSITAHGKDLTEL
FT                   WSEGGEYGFPYNYIGIATPGFPNLLFILGPNGAGRSGTVPHNVEVQVTLFARILRKVGR
FT                   EGIKTIQPSKKAADDFVQYSDAFWKTTVLSEDCQSWYNGGKPGSRIHGLWPGSSSLVSI
FT                   IYNDPRWEDWEYEYLNDTGNRLAWYFGNGGTKMEADPEHDITSYLIDPAEIDLKKLHEG
FT                   WWSVP"
FT   CDS_pept        join(complement(1030869..1030872),
FT                   complement(1028913..1030810))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948779"
FT                   /orf_name="Pc16g04520"
FT                   /product="Pc16g04520 protein"
FT                   /function="ATP binding"
FT                   /function="D-alanine-D-alanine ligase activity "
FT                   /biological_process="peptidoglycan biosynthetic process "
FT                   /protein_id="CAP93122.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008716"
FT                   /db_xref="GO:0009252"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniParc:UPI00018316E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8S0"
FT                   /transl_table=1
FT                   /translation="MDSNDATWAWKLDTLPEETTTIVLNIYPKNISDTSTKSSTEGSAH
FT                   AATQFLLEHLPKGNGLVKLLLPLQSGYIVQSDFLERRMVDCLNVTKLQGFVTPGKHIRG
FT                   YTAEVYHGMSISSLLSYSYGAIVVQNDSSLSIETMSTAINDQLVNRLSFPWLSSTPIPR
FT                   KRLALVGASSLTKAQGYLLAAASLNIAIVVFDEPSHWLSDNSYSHLREDFVPLDMAIDM
FT                   DMAHRIAAALKRYQNSMEEKPIDGVMSFDERFHTIIAHVATQLDFKTSPPESVGLVQNK
FT                   FKARQLDTNDFCRLVRSPEDLENMLSKDGPQLAYPLIIKPAKGWCSEGVWKVANEQELL
FT                   EKVHLLWRESFTAWHGNEVVIETYVEGPEIDANIVLVDGEIVVFEANDDFPCTGDYNDK
FT                   SGGRVQNFVETSNMLPSALPPYELRSVQQRLHELALAAGFRNAILHIEAKLRNSSCHYV
FT                   KTDSDGLVDLELKTPATTTTQPKDVFLIEINPRAPGWQEVEATARTYGVCYYSISLLNA
FT                   LADKERIVSLSKPFLGGPQYHMQLLYVSVQKGGIYKFGDICKRVLQAPGQEHQLSAHVV
FT                   KSTNLLEDGEEVLDPSTGQVYGTFIAIFLVISRTSRKEAMRIGNEIERLVREYTDGF"
FT   CDS_pept        1031399..1033051
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161421" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128955"
FT                   /orf_name="Pc16g04530"
FT                   /product="Pc16g04530 protein"
FT                   /function="transporter activity"
FT                   /biological_process="oligopeptide transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP93123.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006857"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="UniParc:UPI00018317BA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8S1"
FT                   /transl_table=1
FT                   /translation="MTGLSGETDDPEPAIGSEKVEECGIESTAIKDNLLHESRKNEKDE
FT                   EILRKVAGPIPGSVWLVMLLTMAERFSFYGMTAPFMNFMQNSRDDPLHPGMLGWGQSRA
FT                   SAVSNVFFILGLLTPMGASLAADTSLGRYKVLCITFAFYLVGSVLLLVSSFPSSTRFAA
FT                   PVFLVSLVLIAVGISGVNGLMAAFVGDQYPIQDRPIILVKKGERVIVDRDRTLESIYNT
FT                   YYWSINMGGLSGLATTELELHIGFWAAYLLPTCALAFSAVILYVGRGRFTVVAAQSTAI
FT                   PNAARVMCLGARGGFSLDKSKASHLQRIHNRQVPWTDEFVEEVKRALAACRIMFAAWPI
FT                   LWICRGQASNNLVSQAAQMQSSGIPNDIMYNTNPIVIIICMPIVDRFLFPWLRRSGFAL
FT                   TAVTRLVWGFALEALTMAMAAIVQHLIYRSGPCYEYPLDCMASEGGTIPNSASIFLQLP
FT                   IFALEAFSEILSAPAGYELAFTMAPGSIKSVLQALFSTTGALGSSLSIALSPLYKDPNM
FT                   VIVYASLSIAMGVVTAMFYSIWGRKIKRTVVEK"
FT   CDS_pept        join(complement(1034070..1034196),
FT                   complement(1033271..1033998))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948780"
FT                   /orf_name="Pc16g04540"
FT                   /product="Pc16g04540 protein"
FT                   /protein_id="CAP93124.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00018317BB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8S2"
FT                   /transl_table=1
FT                   /translation="MLHQASAPTQNGPGLLPPNQQSNIQAAREKRRLQNRNAQRKHRLQ
FT                   KAAQNSLNLQRQDLQPKSTPSCQCEPDVTWPSQIAPLSALSTPSLSPHKAFPRHNINAG
FT                   FHDRTNFDSISLEDFFLQIDGSDQTDVDFLGVHTSGFTTEGTVGSRVGSTDGSRTSSLS
FT                   LGLPSPRLPSSNPPREKHTSNGLLPLHIASKFGFTSIIEVLLENGADLNLADSQGLTAL
FT                   HYAVEGSHIDSIKVLLYWGAEPLMTDLSGLNVLQLAVINGDCNVVALLMDHGVDPNIAS
FT                   LCV"
FT   CDS_pept        complement(1039470..1040324)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824612"
FT                   /orf_name="Pc16g04550"
FT                   /product="Putative uncharacterized protein Pc16g04550 "
FT                   /protein_id="CAP93125.1"
FT                   /db_xref="UniParc:UPI00018317BC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8S3"
FT                   /transl_table=1
FT                   /translation="MASSTPLVKRSLSGQELPGDELLSSPAKRRRVNSANSAEKMPIET
FT                   TVASGGLRELMPRTTAETEVLVERTFSLRSVLEDDDLPIVCNCPPLRGRSDYRIWRRKM
FT                   RLILSRNLLLDLVDGKIGQLPQSHYLESQLDSLNEAARKIINTNLSATTRLIVRNIRNP
FT                   QKMWEKLEKHCKPSDWSLVRSGWLELQNIKYSQCCDIWEYVYKVDDAWRCICLDQEDTL
FT                   EKHEVARCTSLMCSLDTPKWETWKMGFLSSRDTNIPSWASLVESLTSAEDKGIVSDLIG
FT                   IAI"
FT   CDS_pept        join(complement(1043912..1043999),
FT                   complement(1043740..1043862),complement(1043613..1043692),
FT                   complement(1043214..1043532),complement(1042516..1043151),
FT                   complement(1041997..1042457))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948781"
FT                   /orf_name="Pc16g04560"
FT                   /product="Pc16g04560 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93126.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI00018317BD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8S4"
FT                   /transl_table=1
FT                   /translation="MSATINTRLPVGNKDFTNATVVIIGAGISGMCMAIDLIKRNKTQN
FT                   FVVLERSSSVGGTWNDNKYPGCCCDVFSSLYSYSFEQNPNWSREYPGQEEIHAYLVGVA
FT                   EKYGLYKHIRFNSTVEEARWDDTESKWRTSVVISGQKDSEFSSSYVLNSDFLVSAVGQL
FT                   NLPRAPDISGLADFQGKMMHSARWDWSYDMTGKRIAIIGNGATAAQIAPEVARVASHLT
FT                   IYQRTPNWVIPRLDQPVSTLQKTLFKWVPPLHWRKRALQMKFREDLFGAITDGDSELSH
FT                   MLRTLCTNAIKSQLPDRPDLWDSLTPSYAPGCKRIIITDDYYPTLARDNVHLETRGITC
FT                   VTDSGIKVDEEEQEHDLIVLATGFKTVEFMHPIRIYGTNGRPLEDIWRNGATALNGVTV
FT                   EDLPNFGMFYGPNTNLGHNSIILMIEAQSRYLNVLVGEVMQARQQGKTLALKPEPGALK
FT                   SYNDRIQAILRRTSFADPNCNSWYKRDDGVITNNWCGTVIDYQRELSKVQWQDYIAEGT
FT                   GKDRVMDKAATKVSHAQEEILLSNSSLLVGAIGILSATGYFVARSRRLKAH"
FT   CDS_pept        join(complement(1045434..1045485),
FT                   complement(1045355..1045380),complement(1045129..1045257),
FT                   complement(1044917..1045039),complement(1044528..1044857),
FT                   complement(1044409..1044462))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158359" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948782"
FT                   /orf_name="Pc16g04570"
FT                   /product="Pc16g04570 protein"
FT                   /protein_id="CAP93127.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00018317BE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H904"
FT                   /transl_table=1
FT                   /translation="MDSDQKFALHEAAREGRNEVVESLLNANPKSAFVKDDDERLPIHW
FT                   AAAYNRVPVVELLVAMKDFDPDVEDGSGWTPLMIAASLKDAAGDATIDLLLRKGAGVSI
FT                   KSNSGQNALHFASSKANISTVRTLLANKCSARVKDRRGQLPLHRAAAVGSVPILKTLLE
FT                   EGKSPVNATDGDGFTALHHAISEGHGPAAILLLKSGAEAEKRDSEGRLAIELVPDDKVK
FT                   QYILQTAEREGIELP"
FT   CDS_pept        1046246..1047604
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207595" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128956"
FT                   /orf_name="Pc16g04580"
FT                   /product="Pc16g04580 protein"
FT                   /protein_id="CAP93128.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00018317BF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y8"
FT                   /transl_table=1
FT                   /translation="MEYNSPQSADDAVRMSAKRTAELFGTEYLMVTPTTLTDSSIGVSY
FT                   RRKAEYADITELPRALAEKQAKATAGRTKRPKIQAQAPADGSGSSMSLVRRPSGAGAGA
FT                   GVAGGDQPKSLIQRPSATKQQRPEWHAPWKLMRVISGHLGWVRSLAVEPNNQWFASGAG
FT                   DRTIKIWNLATGALRLTLTGHISTVRGLAVSPRHPYLFSCGEDKMVKCWDLETNKVIRH
FT                   YHGHLSGVYTLALHPRLDLLVTGGRDGVCRVWDMRTRSNIHVLSGHKGTVADIKCQDAD
FT                   PQIISGSLDSTVRLWDLAAGKSMGVLTHHKKGVRNLAIHPTEFTFASASTGSIKQWMCP
FT                   KGDFMQNFEGQNSVINSLAVNDENVLFSGGDDGSMSFWDWKTGHRFQSMETTAQPGSLE
FT                   AEAGVMASTFDRTGLRLITGEADKTIKIWKQDEQATPETHPLTWAPTLGRQRY"
FT   CDS_pept        join(complement(1049721..1050494),
FT                   complement(1049544..1049665),complement(1048977..1049489),
FT                   complement(1048022..1048802))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824613"
FT                   /orf_name="Pc16g04590"
FT                   /product="Pc16g04590 protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="origin recognition complex "
FT                   /protein_id="CAP93129.1"
FT                   /db_xref="GO:0000808"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR020793"
FT                   /db_xref="UniParc:UPI00018317C0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y9"
FT                   /transl_table=1
FT                   /translation="MSDSDSESSPQRRSARERAQWMTKGALVRDDSDDELGVEDLPWNW
FT                   IYDTNEETTQETENNDDTPAKRSRRRSSRPARKKRKIVGAQMGQFQCKVGDVILLKSPE
FT                   AGKDWVGIVTEFLEEDDEDEEDEIVKSANIMWFASPDEFMGTRNKRRTDALPNEQYITL
FT                   DFNSNPLTSISGKGTVMSQSAFNAKYPNGPPKNKTELAEYHKCIVCRRGVNQVQGRYTE
FT                   EFIWEQVYDEDNIHNLINWVRDGLKASRKRKVADDEYVDTKETTVPTTPRKRQRLAATN
FT                   ATPQSQRKKSLMTPTHKRIVVKKPLEFTPLGTRVLSPTHFDSPYRQARNLLHVSTVPDS
FT                   LPCRKTEFNTVYNHLSAAIMEGTGACIYISGTPGTGKTATVREVVAQLNAAVHEEEMDD
FT                   FIFVEINGMKVTDPHQSYSLLWEALKGDRVSPSHALDLLEREFSNPSPRRVSCVVLMDE
FT                   LDQLVTKNQSVITRLANVPGNIVDPDAVQFASRKVAAVSGDARRALDICRRAVEIAEQA
FT                   ADEAAAADEAKDETESLPPTPSKTPARRNNAIAAKEAGTSAVAKPPAKGQPGRVTIATI
FT                   KQAIHEATSTPLQQSLRCLPLSGKLFLAALLARVHRTGISESTFGDVLDEARRIADAAV
FT                   AVAGAAGAGVKDFLLGGGPSARVRSLGHAAMSLMNSGVLALEQGSGSKSVLGGTTIPTR
FT                   GDRSSKVRLRVAAEDVRSAFREDAEAKGFGLGIER"
FT   CDS_pept        join(1051730..1051761,1051818..1051840,1051892..1052470,
FT                   1052519..1052561,1052617..1052719,1052746..1053006,
FT                   1053080..1053666,1053723..1054013,1054069..1054672)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948783"
FT                   /orf_name="Pc16g04600"
FT                   /product="Pc16g04600 protein"
FT                   /protein_id="CAP93130.1"
FT                   /db_xref="UniParc:UPI00018317C1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z0"
FT                   /transl_table=1
FT                   /translation="MAALPESYETDWERINAKSWELPNYGPGPDFSGGTIYRQDDNEHA
FT                   YKTSPDHDDEGGFEDANYGSPPVNYPPRPPTSTVPVTGRSLPSVPPPPTRRPIPNQSVL
FT                   PTQAVITGARTSQAQAPEGPILNERGPNTSNSNTLAPQPHHASRNPRSGQRTPRRGAHT
FT                   DTPRARFQSKKGSSASAQSQHRAKNPPNAPGQNDSYSKAKWRKGLSPDASYRLPYECQV
FT                   FQEKIRQVTSGEASNIDFRQRIIEETDAYVRISAGNAKIREAQYTDNAKLLHIWGRQNQ
FT                   VLAAQNLLQDMLNQLMQQGTSAKAPSRWTKIHAHSNTKVAHARTRESHQERLSEMRKPP
FT                   KIATDYTLGFLWPPDGPSLNYFVTARRELLDFIRLKYDVNIYIKPGIPDYLFMSGNNER
FT                   DMCIIASRFRELWERLMVQHETEIKLFLVAAPRAEVMRTHVLLQKSGGLSTPVICGPEL
FT                   APEVAANWKTTADEIKLSNKNMVTTRLRKALHVIPQFRGFLQMRAKFGSFALQQWRKPK
FT                   DGTSYEFSEFREMLTHMNTEGRLLPGIRLQQDEIFNRIIESTFLKPWGKAKIKSLLSLM
FT                   PRYSANFEYQVNNESVIRVEAKFSLPVGSQEFEVNGIRCFKSKQIGAPVDRQMPMQISM
FT                   IDFERSDWQLEVKALELCPENEIPPDLDKFMRSIGFQWNANAKSIGSAPKRKARFSYGS
FT                   PIKRFVEKATIQLQVKDSPHVFELARFDEYTYAAGQWSMNPKVSWGASLFNPDWDDILG
FT                   EQADIKVLDTSKDACLSVFFPPPGDGEERTEKQKTDDELRKEAEIRKVEEEKQLGLFMS
FT                   TVQQVARMLGNPGAEMPDVLETDLGSLF"
FT   CDS_pept        join(complement(1055770..1055806),
FT                   complement(1055382..1055668),complement(1055199..1055316),
FT                   complement(1055050..1055102))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207562" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128957"
FT                   /orf_name="Pc16g04610"
FT                   /product="Pc16g04610 protein"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="CAP93131.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR011599"
FT                   /db_xref="UniParc:UPI00018317C2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z1"
FT                   /transl_table=1
FT                   /translation="MSQNTDGAPQGSINLASLSVPQLRALQTRLTSELEHLTTSHTKLR
FT                   AAQAKFRDCVRSINDGVTGNAKKGTDGRDEILVPLTSSLYVKGRLTDREKVLVDVGTGF
FT                   YVEKTAPKAVAFYDEKVKGLDANLQELEKIVQTKSSQLRIVEETLRQKMLSEGAPQAAA
FT                   G"
FT   CDS_pept        join(1056266..1056441,1056544..1057229,1057284..1057692,
FT                   1057751..1058039,1058089..1058481)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234999" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671907"
FT                   /orf_name="Pc16g04620"
FT                   /product="Pc16g04620 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93132.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018317C3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z2"
FT                   /transl_table=1
FT                   /translation="MASRLAACEACRKAKVACDHKRPACTRCASNDRAGICIYRTTPFK
FT                   RRRVSSSTPVQSPRSNPYPNPGFLGSSSHVAIFNEISPQDYHASDTYHASEDMTMLMQS
FT                   QSTGENILLIQGADVLRQLLNTFPLAAMKDFVTFWLATGANLALAEPFTEKCTENMTRL
FT                   FTSFSQEDNWHLAYAQRLTQNSREPLQFNSTSDMESFSAQFLDQKFRWESLGIFLSAVT
FT                   RAAIDISFFPPLFKTEKDQFMLRKLSTKLSDLALDIALSLDCLNDLQLVLQYENCIVHT
FT                   HVDGDQSYHSWSRLGDVVSSMFALGYHENVDKTKPPIPIFLAELRKTAWATTYSADKNI
FT                   AIFLGRPPRMSKRFCHFQVPLSPTSSDQVSNTSHVEDEVVRWKTDTPICYRSGIRWATL
FT                   CSALKEDVLELLRSKQRDNFSQKASIIRQKAETQWAHLPPHFHLSGSLKECSGDAFERD
FT                   LLASIRLDQLHVLFLLQLSFLDTLTEPDSSILDISDQMLSLVVDAILLRDQLVNSGTGL
FT                   VWKIAHFGLPAAGIILLSMLKQHRTLTEARSSWSKTILNLGIFVAQVQVGSIVRRGDPN
FT                   YALVSKATQTIERFLDSIHREGIQSPTQPPPHLGENGDWASFFSQDLCDFETDFWENLA
FT                   YHPSLLASDPTLPAI"
FT   CDS_pept        complement(1059392..1061068)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948784"
FT                   /orf_name="Pc16g04630"
FT                   /product="Pc16g04630 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on CH-OH group
FT                   of donors"
FT                   /biological_process="alcohol metabolic process "
FT                   /protein_id="CAP93133.1"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="GO:0016614"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniParc:UPI00018317C4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z3"
FT                   /transl_table=1
FT                   /translation="MNSLILSLFFISAAASQSYLPSEQIDVQSSLLSDPNQVAGKTVDY
FT                   IIAGGGLTGLTVAAKLTENPNITVLVIENGFYESADGAIIEDLNAYGDIFRTTVDHAYE
FT                   TVPHAINNRTENIRSGNGLGGSTLINGGSWTRPHKAQIDSWERVFGNKGWNWDYLFPYM
FT                   QKVETSRPPNDVEIAAGHYYDSACHGTNGTVHSGFRNTGEVYSPIIKAFMNSSEERGVP
FT                   TKLDFHCGVPRGVSMIPNSLHKDQTRSDAAREWLLPNYKRPNLQVLTGQFVGKVLINQT
FT                   TISGHKTGHKAVGVNFGTNKHVNFNVYAKHEVLLAAGSAVSPRILEYSGIGLKPVLDAA
FT                   GVQQIVDLPVGLNMQDQTTTTVASRTKPSGNGQGQAIYYATFNETFGDFAPQAHHLLNT
FT                   KLHQWASETVARGGFHNVTALEIQYQNYRDWLNDEVVMTDLMEAPSPPGTGIDVSAPTI
FT                   ERESRKRSRDDDGEQDDPSSPPQKKQSEWANFTTLSDSSSGGDQPEPDADGDIPMDDET
FT                   YKPYKIANTSGETDSSVWSTMRGYLGLTGRGSTPPEQPEEL"
FT   mat_peptide     complement(1059395..1061020)
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z3 "
FT   sig_peptide     complement(1061021..1061068)
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z3 "
FT   CDS_pept        1062598..1064040
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948785"
FT                   /orf_name="Pc16g04640"
FT                   /product="Pc16g04640 protein"
FT                   /function="D-arabinono-1,4-lactone oxidase activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP93134.1"
FT                   /db_xref="GO:0003885"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI00018317C5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z4"
FT                   /transl_table=1
FT                   /translation="MLSPKPAFLLLLLHAVFGSAYRWFNWQLEVTCQSDAYIAPHNEHA
FT                   AAEFLKEQYPKGSHIKVVGNGHGFGNLTTCVDNALTEKPTYIVSLTNLKKLHIDKKNLT
FT                   VTFGAGWDVDDLIQELKANDLSFSNLGVERVQNFVGAASTGTHGSGSDLGNIATQIIGL
FT                   RVLDSQGGLRVINEKHNAEELKAFRISLGALGLITELTIKVQPTQLLKKTTKVLNATSD
FT                   YSKMYNELAQLYKEHDRMTVWGPHFDWNAKSQSWDLEPTYFLSYWEPTNYTGVRNCTLN
FT                   HCANGCGDCKKEYICYDEVTDAASCSPQGVCSRGFYAEIEHFLPIEYFAEAATNYTIFQ
FT                   QGQTSRMKAPYNKQMVMQHRSLKGDDTYLSPVNTYNLGPDLSGVFGVIEIDWIQEYNNF
FT                   TTLWQNQELAHEFLPQFGETYNARSHWNKMSAPNATYTLEKFPKLPEFLAIQKRQDPKC
FT                   QFVNEFLVEQLGITRCANYISV"
FT   sig_peptide     1062598..1062657
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z4 "
FT   mat_peptide     1062658..1064037
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z4 "
FT   CDS_pept        join(1064928..1065002,1065074..1065153,1065267..1065334,
FT                   1065407..1066218)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000227426" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128958"
FT                   /orf_name="Pc16g04650"
FT                   /product="Pc16g04650 protein"
FT                   /function="ATP binding"
FT                   /function="DNA-dependent ATPase activity"
FT                   /function="damaged DNA binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="CAP93135.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008094"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR011941"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="UniParc:UPI00018317C6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z5"
FT                   /transl_table=1
FT                   /translation="MEGEEQFDENGLPGPGAPTPLSALDGVSGLTARDIKLFVDAGYHT
FT                   VESVAYTPKRLLEQIKGISEQKATKILVEASKLVPMGFTTATEMHARRSELISITTGSK
FT                   RLDTLLGGGVETGSITEIFGEFRTGKSQICHTLAVTCQLPFDMGGGEGKCLYIDTEGTF
FT                   RPVRLLAVAQRYGLVGEEVLDNVAYARAYNSDHQLQLLNQASQMMCETRFSLLVVDSAT
FT                   SLYRTDFNGRGELASRQTHLAKFMRTLQRLADEFGIAVVITNQVVAQVDGGPSAMFNPD
FT                   PKKPIGGNIIAHASTTRLSLKKGRGETRICKIYDSPCLPEGDCLFAINEDGIGDPSEKD
FT                   LEDK"
FT   CDS_pept        join(1066599..1067235,1067294..1069435,1069492..1070690)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207840" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128959"
FT                   /orf_name="Pc16g04660"
FT                   /product="Pc16g04660 protein"
FT                   /protein_id="CAP93136.1"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR021717"
FT                   /db_xref="UniParc:UPI0001831897"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z6"
FT                   /transl_table=1
FT                   /translation="MAKIYKDSRVDLRPYSSTTVANIQIPTQETATRRPRFSISSSDQE
FT                   LPIAKDEDEFARRYLATQGEVYFRKRRAYPRTFLWRVINDNKVLEIQCADLTKGGTEVY
FT                   EYNVTLRLDFQERILPFGVELSDSEDHEIISVFVITASKHLHTLSLRPEFFRRTSSIDE
FT                   NVRDWCKTCLPAPLAFSNPHRLHASSPLELFISLDNGALLRLTRRAGDDGSHWSPLTFD
FT                   ERTWGSSIRGLVKWSAPSSIKHDGRNLDLNVANAIATTSDETYVFATCLNHTLKIWNLA
FT                   TNKLAATKDLLGRSLQDPDLVPYTLNPAQTSFMRVFNAERAMDGGHRFYVVTYSPFEDG
FT                   KFKFWAVKGGLTSELIIEELFADDVFRPVDPDATGNMFWNIADFQVKSREEGKGMELWV
FT                   LWRNHGLYQLYTLHFSLQTLVSDWASNWVSTTFETHRQESPPPLVVDDVMDPTEKWLQY
FT                   LLRPNRYMPEVLETALAIYQEAIKPLSSSSSGGLKKSLPLAERLCSTIASAVSLRKFAD
FT                   EEMDYSRYASDTDAKWRQFWQVAEDLNKRRFEPISLAYDSYADMPWLLLSDSCAVVREC
FT                   SITELFLHNSSSELSDGVPKMVDRWRHRNVSRELGPNFETASGLLKVASDFRKRFSPEL
FT                   DGACRAALQAEIFSEPSSSILDRMENFRERSDFANQISNKSFDALDAALSEYMRTDCLS
FT                   MDAFLAIIQTASSHFCGEDSELASTCFGARVLVSGAQETISISRQIFFDLLILVTFVDG
FT                   EWEQTSKSDFDASDLFSMLVDLLREYEMMAWLSSNVRKCPDSASKYRVDSMQRYTLKDS
FT                   SKTNSQRTASILEDLFVTDIKPQQAIDSPQSYTLTLGIRDVVAWITREGEVNYQNAVAH
FT                   IQCDLIAKNNIDLAWDFLRFQASSAWSTYVKGRLHVAMSEFDTAAIYFRKAAYLLSCGK
FT                   PMGNLSDMSAELLDLLDVDCFHNGLAKYYQHILSIFEKVRSYSHVADFASLALQALDSE
FT                   IWAEQDSEYPTVRDDLLSRLFTGALKTCQFDQAYSALARLQDLKLQRTELSELISTILA
FT                   VSGPGTAGLKQILRFPTSLVPNIASFIDEILVHLTRKQTTNVSWLDADNKIFPATPDYT
FT                   RILQAYRIARSDYRGAAEIAYRNVQRLRKARDAPSTALTLKGREADDAARLPVEEDDAE
FT                   SKEIRHELLSLINLLACVDKSEAYILVENGPPISAAPMPPHERRPSTQADEDGNVSMED
FT                   VDATSPTPLGGKRSSNGVAFAPTHRRGSSKSSAIERRNSIVSFEVPATNHLLKRRIIVT
FT                   LDHLRREFQSELDRVSRIERGDWEFGLDEEKDVDNDETMVL"
FT   CDS_pept        join(complement(1076658..1076885),
FT                   complement(1075992..1076529),complement(1072894..1075933),
FT                   complement(1072466..1072840),complement(1072077..1072311))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185453" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824614"
FT                   /orf_name="Pc16g04670"
FT                   /product="Pc16g04670 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93137.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI0001831898"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z7"
FT                   /transl_table=1
FT                   /translation="MTSSHYSGPSCRDLDHTLRIDAGSCRGGFDFSLLFEETILQILPI
FT                   LLMLIIIPVRLWNLSQKRNKVVGSWLVLIKLVAWLALLGLQIAQTALWALPAADSTKAS
FT                   VPANVVLTVGVLALALLSYAEHTRSVRPSFILNTYLFCSLLFDIARSRTLWLRSVDAFN
FT                   NILAIIATVAVGVKLLLFVLEAVEKRRILKSEYAGYPPEATAGFYNRAVFWWLNPLFKI
FT                   GFTGVLRVEDLFLLDKELSSERLLARFDEKWSKVTTKSPNTLQWESLKAVKWPLLAAVP
FT                   ARACVVAFNFCQPLLLERSLSFFNSPVNQGTQNIGYGLIGAYLMVYAGLGVSMGQYQHL
FT                   TYRGITMVRGVLVTMLYKKASCLNLGETDPANSLTLMSADIERITNGWQTMHEIWANSI
FT                   EIALAIYLLQIQLGISCVVPVCVALFALVGSLVGMSFVVARQANWLEAIEKRISSTSGM
FT                   LGSIKGVKMLGLQDSFMKFVHGLRISELDISKKFRTLLVYNMAFAWLTRIFAPIFTFGV
FT                   YVGISSDPLTVSRAFTSLSLFSLLADPLLTLVMALMSFAGAVGSFQRIQQFLDKQDHAD
FT                   RRNSSSQTLFLDDLAEKRALSKDKDLDLSSINSDSVESLKRCSAQPSANAAVVQSGSFG
FT                   WEANKDPILKEITMSIPRGSFTVLIGPSGCGKSTLLKALLGEIPCSEGKVALASPSVAY
FT                   CDQTPWHMNGTIKDSIVAMSDYDPLWYASVIQACALEEDLAQFPRGDAAVIGSKGVALS
FT                   GGQSQRIALARAVYARRKIVILDDALSGLDATTENHIFHSLLGARGLLKEIESTVIVAS
FT                   SSVKRLPYFDHIVVLEAGGRISEQGSFSALNKTGGYVSSFGLGLPDWEYKTKRFSDSPS
FT                   YSSMDTVQKEKELLVEEPEHHDRGGDLGIYTYYINAIGWLPAIIFMVAMAGFVFCISFP
FT                   SIWVKWWAQSDTAHPRQEIGHYLGIYAMLGCLAMLALIVGCWQMIITMVPKSGENFHRK
FT                   LLTTVLGAPMLFFSTTDSGSILNRFSQDLQLIDMELPIAAINTVATFFLCLAQMALIGV
FT                   SSKYAAISFPIVLGILFLIQKMYLRTSRQLRYLDIEAKAPLYSHFTDCLQGLVTLRAFG
FT                   WQHAMEKKNIALLDHSQRPFYFMFAIQRWLTLSLDMVVAGIAVLLIVLVVVLRGSTLSA
FT                   GYVGVALLNVIQFSQSIKLLVTFWTNLETHIGSIQRIKDFTSTVESEDKPGEDQDVPPN
FT                   WPSKGTVAFNSVSAAYRPSEPVLKDVSLTVQAGEKVGICGRTGSGKTSMIMSIFRMMEL
FT                   SGGTITVDGVDISRLRRREIRSLINGVSQDSLLFQGSVRLNADPTGDHTDRDILAALKS
FT                   VQLLPAIEEKGNLDTDVDEIHLSHGQKQLFCLARALLRPGNILILDEATSNIDTKTDEI
FT                   MQRVIREKFCNHTIIAVAHKLDTILDYDRIVVLDAGRIVENGEPYALLTEPKSHFSQLY
FT                   ASAMATEESD"
FT   CDS_pept        join(complement(1080026..1080293),
FT                   complement(1079837..1079946))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824615"
FT                   /orf_name="Pc16g04680"
FT                   /product="Putative uncharacterized protein Pc16g04680 "
FT                   /protein_id="CAP93138.1"
FT                   /db_xref="UniParc:UPI0001831899"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z8"
FT                   /transl_table=1
FT                   /translation="MQGKGLSLCLSVLGTPEYYSSNWEQFPRSGTLAVWNVGIVVQSLQ
FT                   GHEAFDPESCSYWVALPSTVSLSPEAYEVAMLTLLSASLSHVELGFGSMHGIATDDIRA
FT                   SCGGYRLRCTPPDAHMALTPD"
FT   mat_peptide     join(complement(1080026..1080245),
FT                   complement(1079840..1079946))
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z8 "
FT   sig_peptide     complement(1080246..1080293)
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z8 "
FT   CDS_pept        join(1080827..1081309,1081382..1081798,1081865..1082167,
FT                   1082222..1093826,1093878..1094969,1095018..1096633,
FT                   1096684..1099362)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948786"
FT                   /orf_name="Pc16g04690"
FT                   /product="Pc16g04690 protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="ligase activity"
FT                   /function="phosphopantetheine binding"
FT                   /protein_id="CAP93139.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0001834909"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z9"
FT                   /transl_table=1
FT                   /translation="MAQSTKCYLPRFASTVDGPKRPVSMKTRPTAAQHAQLLTAWNEGR
FT                   LDPILRATWALLLHYYIRSEDICFGYQHLEGDSRSPKSSVQRSTVNISTIRISINDNDS
FT                   LKAIVDKVRANSAIRQNNGSPEASEAYLPFNTIFMLRTYDPPASPSKPILATAIPDECQ
FT                   VRLHVKVLRGDISIFLEWRKGDMSGEQMKSIANIFEQLLAKVLSAENTAISQLNLFSEN
FT                   DWQRIRKWNSTTPQLHDRCIHEAIHDQMLSGPDREAVCAWDGSLTFAELDHQASKLACY
FT                   LRMQGVGPEIRVALCFDKSKWNIVAMLGVMKAGGAFVPLDPSHPTSRLQGLIQSVEAPV
FT                   VLCSQHLADKLRPIVKTLIPLCADTLDPLSDPTDSVNLASGVTSQNAAYVLFTSGSTGE
FT                   PKGTLLEHRAFLSGAMVHGPGLRIYRDSRCLQFAAHTFDASLAETLTPLIHGACVCIPS
FT                   EEARLNDIVSTINEMRVTQACFTPSFIGFIEIESVPGLESLVLAGEAMSQSQLTTWSKI
FT                   KLVNGYGPTEASVASVLNSNVTPDTDCKDIGLPIGVRAWLVNPDNHDELVPVGCPGELL
FT                   LEGPPLARCYVNNPQKTNESFIYDPAWTTLDPETGSNRRFYKTGDLARYNSDTGALNYV
FT                   GRKDTQVKVHGQRIELGEIENQLSKDSNVTHCSVFFPKTGFSKGRLAAVVSSTGLLAEQ
FT                   SDSDLEPLRLVPASKKAELVPGIRERLSARLPTYMVPAVWLCVEALPLLPSGKLDRKGI
FT                   STWVAGMESDPDLQNGTSAAIVDAEASQPANDREEALAAVYSRVLNIPQNQLNLNESFL
FT                   ALGGDSIAAMTCIGLCKKRGFALSVQELLRSKSIRDLATRAKTIDHLTTYEEAVDEPFS
FT                   LSPIQSLHFGVRKEGQGHFNQGILTRLNKPVDERTLRKAVETLVSRHSMLRARFTDTGF
FT                   ATASSQHITRDIKGSYRWRMHTLANMNEVETHVADSQSSINCFSGPLLAVDYFLVKGRP
FT                   NVLSMTAHHLVVDIVSWRIILEDLEDIILNPEKTGTSDGSLPFQTWCRLQNEHCNTLRA
FT                   EHKVATDALAVPDFGYWGLKDTQTTYGDVDCASFEIDPAHTNAILLECHKALGTEPIDL
FT                   FLAAMLHSFGRAFPDRSLPTIYNEGHGREVWDPSIDISHTVGWFTILHPIFVSAYKSDS
FT                   PIDTLIQVKDLRRRVTDNGRADFTSRVLPAQGNQGSKHPHPFEMSFNYVGQHRDLQRKD
FT                   GLFQLVDQMAGEAGQGGGAADFGSDTPRFGLFEISAMVVAGKVRFNFSFNKFMQHQNRI
FT                   HRWVSECQELLVTLSEQLPTLEPRLTLSSFPMLSLTYPTLDKLLNEKLPAMGIESPDFV
FT                   EDIYPCSRMQQGILLGRKRDSSYYAVHDTFEIRATGSGKPNLDRLVNAWQKVVSHHAMF
FT                   RTIFVENLTPRDPFCQVVLKSYDATPVFLQSSGEKDVLATFDKEDPKDYSEPEPAYRFS
FT                   ICQTPTGRLFARIEISHAAMDGNSISIILRDLQLAYAGRLEESPQPLFKDYIQYMQDAP
FT                   NEASISYWRSYLDQAKPCHFPALTDGQQSAKALRSIPVNFGALDELQTVCEKRGITLAN
FT                   VFNAAWGLTLRAFCGSDDVSFSYMASLRDVSADGVQWVVGPVINLLICRMKVADDAKLS
FT                   DVLHQIQNDYMESLPYRHTSLIEIQHALKLSDTNLFNSGVSYRRLPSSKDAVSSEIECA
FT                   EVGSIHDPAEFPVFINIEAMDTTARIDLNYWTTNLSDSQAANVANTYLRCLENVVSNID
FT                   CEIRQLNNLSEDNRAQIMAWNSKTHKPFEKCAHHVVQEMAKKRSDALAVTAWDGNLTYS
FT                   KLDQFSSRLAGYLVTFGVGPGTLIPICFEKSIWNIVSTLAIMKAGGGCIPVDTPESLAA
FT                   VENWIVDNAVQVALASPEKAHVLEDAVPYVIPVSESLLEYLADEDLNPVAQSSDVAYVA
FT                   MTAGTSGPAKSVVLDHSTVMTRAEAFATTMAIADVSRTLQFAPHTSDAFIVEAFATFMW
FT                   GGCICIPADIDPLNLAACINALHVNVASITPTAASFFSPKDVPGLRSIALGGEVVPQSV
FT                   LDHWKTDDLQLQVLYGTCESSAASFHVFCSQEEHEAALIGKSTSCVSWVVDPSNHENLV
FT                   PIGSVGELALEGPVIASGYLDDQSVETSDFFENAPWLSGQRGGRKHRLFKTGDLVRYKS
FT                   DGSLVFVGRKNDKSQSALASELIQTQTRIDTFLEKKKCVVESVQLQRGDMKTNALVAFV
FT                   VFSDTIPVTYGDRVLQSATPGMKDAMSSLHASLSTSLPGSKVPSFYIPISSLPLTVSGK
FT                   LNRQALKFETQALSSSALEAFDIKHWNGSKTGNRAARQASLSGPNIAFWKEYLADVEPC
FT                   IFPALSHEASANARSIRTLNKQSANIHAFSRLSGLPVETLFQFAWAVVLRWYTGSDDVC
FT                   FGYSAAASETKSEADGVSTCRFLVQNEQKLQETLQKAKRDCETSALNVAPLDAVKHQLG
FT                   LDNTTLFNTSLIYRTASNLPKGSTREPSTSSAYKILVEAEVSHSYAEIHFTYSSDTLSS
FT                   FQVSHVMDMFDQVLDDLIAHNLRDRTIGDVNVLPERSVRRIRDWNAASPPRVEKCADEL
FT                   IQQQALLHPRAEAVCSWDKNFTYGQLEIVSSRLARHLSSLGVKPEAFVVLCFEKSAWAV
FT                   VAQLAVLKAGGAFVSIDPSHPDSRLKMLIDEIGTNLVLCSSSVHTKVSKLCTKSFAVCQ
FT                   TSISQLPDSPLALPGARPTPNNAAYAIFTSGTTGKPKATVVEHTALSTTAIAMIDGLHM
FT                   NSTTRALQFSNYTFDVSILEIMMILMTGGCVCIPSEDERMNNLGGAIRRMEATYISAPP
FT                   AIVNTLEPKNVPSLKVIITGGEKMPANHIDRWADRCVINAYGPSEATVVATVGVKVDWD
FT                   GNRVNDDPTSIGTSPNCRVWIVDPNNSNRLLPVGAVGELILEGSNIARGYLANEEKTKA
FT                   SFFENPVWNRHSGLQGVFKRNDRMYRTGDLVRYNSDGSLAFISRKDTQIKFNGQRIELE
FT                   EIEQQCIRCLPEDSQVAVDVVVPEERTIAKGLAAFFTVHDPDSNGGSNDQFAPTVPGAD
FT                   PLLLPISMSNMDAIQKLKGSLPELLPQSMMPRLFFPIRNLPFTSSGKIDRRRLRAMVQT
FT                   LSKDTLKSYITLTTSDRREISSATGLEIKLVALVEKTLELEAGSVTVDDSFFGLGGDSL
FT                   SAMNLVGAAQAEGIALTVSGIFNSPILVDMAKSCVVSDGPAEVKKEDIKAFSLLPSGVY
FT                   LENLMDEVTDSCEVSKDLISDIYPCSAVQEGLLTLSIKHNGAYVAQPSFRLAAGIDVGK
FT                   FKQAWQQTVSDLEILRTRIVHTEAMNFAQVVLKDGPISWVEAESFDSLPNDFLHLPKQN
FT                   GAALTGYAMVHPRGSSDSYFVWSVHHALYDGWSIPLVFRKVEENYFSSQPKRAGTPYSL
FT                   FIDYLAKKDMEESDAFWKSYLTDLSSTPFPHNKNAVPDAMRAGNTQYHNMKLSRTRNSV
FT                   DFTIPVLMRAAWAIVIATHTASGDVCFGETLSGRNIDLPGVADIAGPVLTTVPTRVQVD
FT                   NAMSTMQYLQKIHQSTTEMIPHLHSGLQRIRQLNKDTSEGCNFQNLLVIQPGDGELDNK
FT                   IWIDEKRETSEDFFTHPLVVECGITKTSISFTVHHDELVISGWHTKRLTEQFAHVLQQL
FT                   IALPKNSTSKLEDLEVVSPEDKAEIGTWNERIPLTVERTVQDFIREKSEETPNAQAVCA
FT                   WDGDITYREFWNLASGFANYLVSRGVGPEVFVPVCLDKSAWAMVTLISILIAGGGYVPL
FT                   DPSHPTSRHEEILADVGANMILCTPNYTNRYSRVVKTVIPISKETIKAYGALKSSSRRR
FT                   TDVKPTNMAYALFTSGSTGRAKGIIVEHRNVVSSIMAFAPWVRMDETSRVFQFASLTFD
FT                   AAVMETLAILMLGGTICVPSEDDRLNDVAGAIRRLNVTWTFLTPSIASIIEPSSVPSLK
FT                   HLVCGGEKMSNEVITKWANSVHLMNGYGPTETCVFAVIDNAVATNRDPGRIGYGIPSTL
FT                   TWIVDPDNHDRLTPLGAVGELALEGAPLAREYLKNPEKNAEAFTSDPAWIKDFTPAIPG
FT                   PRRIYKTGDLCYYNPDGSIQYISRKDHQVKLHGQRMELGEIEHRLSEDALTRHAVVVLP
FT                   KNGPLKQRLVTVMSLNSVAADTKLISDKPCELVDENELERHAYNELVEVQKNLENQLPI
FT                   YMVPQTWALIKKLPMLVSGKLDRKKITAWVEDIDDASYERIMADYDRIKRGKIEEKPQE
FT                   KEEKHGSLSIIREIFAQVLNISLQKVNVDRSFVSLGGDSITGMAVISRARKQGLVVTLH
FT                   DILQSRSLKELAQTASSKAPVSQREEKSGDGFALSPVQRLYFQSSDSFKGAARFNQSMT
FT                   VRIARRCEGEVLKRAVKAVIGQHAMFRARFSTSSDGTWQQKTAAVGSLQIPDRTFSNST
FT                   SQEVDESFQFRVHSVADIRGMVPKIAESQNCLDPLNGPILAADLFNLRTGGQVLFLVAH
FT                   HLCIDMVSWRIVLQDLEELVVSGSLSLDKALSFQSWCAMQTERAKIQDATISLPFTPEK
FT                   PSLLYWGMQGSPNVYGDIKMESFMLSEDTTKFILDGCHSVFRTDTVDILLSAIIYSFGR
FT                   TFTDRRVPTIYNEGHGREAWEADIDLSRTVGWFTTMAPLLVDSEARALNDIIKRVKDTR
FT                   RKIADNGRPYFAKNLLQDQGSDFPVPLEILFNYLGKMQQLERADSLFHHHGSVFDSSDF
FT                   AVAGDMGPQTARFALFEVSAIVIKERLNVAFTYNNKMQHQGSIRRWILQCKQTLDKDIL
FT                   TLKTATPEPTLSDYPLLPINYHGLQMLTASTFRKAGIRNKDDVEDIYPCSPMQEGLLLS
FT                   QLRDPNAYMFHTVFEIKDGKSGKVDAEGVARAWQALVDRHPVLRTIFVDSNYTGGSFDQ
FT                   LVLKNLSDNILRVQCQDSQVEEKLAAISLRDRNAMRQAKLSHQLTVCKTNTGRVILKLE
FT                   MNHAIIDGGSVDVLLRDLTLAYERKIAEGSGPLFSDYIKLIRTQSHSDALSHWKEYLGG
FT                   VHPCHLAPSAVFEAKRELKGVKMNFQRFPELLKFCERSSVTLANLTLSAWAIVLRQFVG
FT                   SDDVCFGYLSAGRDAPVDGIQDMVGIFINMLCCRVQFSDQQTLTDVSKSVQDDYIRCIP
FT                   HQSCSLASIQHELGWQGQSLFNTTLSIQNHSVAGGPKDKGLSFDLQHAHDPSEYAVTVN
FT                   VEIARGQEGILLRYWNDIVSDEEAQSLADTIAKVFTGFIESPAATLSQSTFASEAEPES
FT                   VDWDRSQTTLADKAKSTGEAIDSSAMQKIIDDRVHEIIGQMLREGKLTVPPIRTEGLSS
FT                   YGGHTDTIADSPYQLGIQGADDSGVCSATSRSSEDGMSVDVERKLWNLWSTALGLSPNV
FT                   VRHQDSFFKLGGDSITAMKMVSAAREEGLVLTVADVFNNPVFEDMLTTVRAANVTQQML
FT                   NADLKSGGHKEVDSDLLNITPTTLGPSPSTESLEVLKPSCVDDAAVQRGICPKVGVFKG
FT                   GIADVLPVTDFQAMSLTATLFKSRWMLNYFYLEGNGPLDLRRLRESCLKVVAAFDILRT
FT                   VFVCFHDQFFQVVLRKIRPSIFVYETDRALDEFTMTLQQRDREYGPREGEQYVQFYVVK
FT                   KKNSDQHRIMIRLSHTQYDGVCLPKIMAAIKHGYEGTPLPPVTPFAGYLRQLPGTITPD
FT                   HYRHWTDLLKGSHMTQVVRRRGTSMFQNVGAFTEIHRKIEISPTALGNVTIATVMQAAW
FT                   ALALAKLSAQSDVIFGLTISGRNATVPGIESTVGPCVNVIPVRVKFDEKWTGVDLFRYL
FT                   QDQQVSNMPFESLGFREIIKQCTDWPDWTYFTTSVFHQNVDYEGNMQLDNNKYRMGGVG
FT                   VNDNLADLTMVSRPSGERGLDVTLGYSEKGPVMPSFASKVLDMACEIAQSLVANPTASL
FT                   PSASMLRSLPPQTIDDQPRPTDEHFLSAHLKSRSIAELLVHSDILSRSWHQVLPSRTTT
FT                   GPVDPEADKPTHQSAFQLDSSFFDLGGDVFNLAQLTWLLEQEGLKVRLEDLIEHPSFLG
FT                   QMAVLALHNAKHQEDMPTELLATGAAPPDPVARIEKKKTWSKAMTIARKLTGRNTVTSR
FT                   A"
FT   CDS_pept        join(complement(1101416..1101744),
FT                   complement(1100854..1101277),complement(1099963..1100808))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824616"
FT                   /orf_name="Pc16g04700"
FT                   /product="Pc16g04700 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP93140.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183189A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H900"
FT                   /transl_table=1
FT                   /translation="MVERTEHDYRNSGEIEPHRNGDEIAALEKQSTAASGYSAFEQRTQ
FT                   SIVSRIRSREPGQTAKFHHPLTHTKTSPDVIVDFDGPDDPYRPLNWGFKKKAVTTVLYG
FT                   LTTMGIYSTGQIQISQEFGISNEVATLGTSLLLFGLGLGPLIWAPLSELYGRKTAVLPP
FT                   YFLAAIFSFATATAKDVQTIMITRFFTGFFGSAPVTNTGGVLSDIWSPEERGAAIVGYA
FT                   MAVVGGPVIGPIAGGAIVQSNLGWRWTEYITGIMMMFFLIMDLLFVDESYPPVLLVYKA
FT                   RRLRFESGNWALHARHEEWDVTLKEIGNKYLVRPFQLLATPICFLVALYASFVYGILYL
FT                   SLAAFPIVFQELRGWNQVVGALPFLAYLVGILIGGGINLANQKFYIKRFKANNNRPVPE
FT                   ARLPPMMIGSVLFASGMFVFGWTSPKHIHWICPNIGAVMMGLGFFTIFQAALNYLIDTF
FT                   QKYSASAIAANTFLRSMFAGCFPLFTAAMFHNLGVPWAASVLGFISVALIPIPYLFYKF
FT                   GKRIRARGTWSRDSV"
FT   CDS_pept        join(complement(1104725..1104800),
FT                   complement(1104632..1104649),complement(1104489..1104565),
FT                   complement(1104350..1104416),complement(1103272..1104299),
FT                   complement(1102388..1103221))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076674" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671908"
FT                   /orf_name="Pc16g04710"
FT                   /product="Pc16g04710 protein"
FT                   /protein_id="CAP93141.1"
FT                   /db_xref="InterPro:IPR019412"
FT                   /db_xref="UniParc:UPI000183189B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H901"
FT                   /transl_table=1
FT                   /translation="MLRVGSWLYGKKPAQSVDSQVELKDLHDAMTAATLILNDDVDGAE
FT                   NGLSTGTSSFHNLGKGVVAFVRATLGFEQEIMRQASERLYEAETSAASDQTRSQQNAQA
FT                   PNAFHSDIYAAGTEYALCQAIAQLMNAVVGVLNESLTESIKAFYRLRKAYIALDAIMKM
FT                   EEKFMEQRDIHKGILPTTSDLSCSESSSLSSKKGTKGATVDQTELSSSMNGLAISSRGA
FT                   SPDASTGTSTPAKHIHHDPDSDIFKNEIDVFVHSGANFCFGILLLLISMVPPAFSKLLS
FT                   IIGFHGDKQRGLKMLWQASKFHNLIGAMAALALLGYYNGFVRYCDIMPDPTPGEADVEG
FT                   YPQERLAALLAEMRSRFPNSQLWLLEESRMLGANKDLDSALDLLSTGKRSPLKQVEGLC
FT                   VFEKGLNALFLHRYDVCAEVFIECVDLNSWSRSLYYYIAGACHVVQYRQSLNDPKLAEE
FT                   HAKKATLYLRKAPEFAGKKKFMARQLPFDIFVTRKLAKWEARAKEWNVSLVDAIGVDPV
FT                   EEMIFFWNGHSRMTNEQLQESLTRLEWCESENNKTWSREGIEEKAILELLRAAVLRSLY
FT                   RHDEAKKILQTRVLNHDKSVFKGHLKDDWVHPAAHFEMAANFWMERPAYQVLHGIASPK
FT                   VSNEASAESGETNTESERKQVSECKEYLEHAARWESYELDARIGLKVTAAMEAVHKWEN
FT                   MHPTV"
FT   CDS_pept        join(1105448..1105556,1105617..1105741)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948787"
FT                   /orf_name="Pc16g04720"
FT                   /product="Pc16g04720 protein"
FT                   /protein_id="CAP93142.1"
FT                   /db_xref="InterPro:IPR007834"
FT                   /db_xref="UniParc:UPI000183189C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H902"
FT                   /transl_table=1
FT                   /translation="MSNPTTQKADAPEQAPPQAKPQVLEEDDEFEDFPVEDWPQEEAEQ
FT                   TNGSKANDGSEHLWEESWDDDDAAEDFSKQLK"
FT   CDS_pept        join(complement(1107942..1108007),
FT                   complement(1107466..1107886),complement(1106637..1107403))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000227107" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128960"
FT                   /gene_name="pgkA"
FT                   /orf_name="Pc16g04730"
FT                   /product="Phosphoglycerate kinase pgkA-Penicillium
FT                   chrysogenum"
FT                   /function="phosphoglycerate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP93143.1"
FT                   /db_xref="GO:0004618"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="UniParc:UPI000183189D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H903"
FT                   /transl_table=1
FT                   /translation="MSLSNKLPVTDVDLKGKRVLIRVDFNVPLDENKNVTNPQRIVGAL
FT                   PTIKYAIDNGAKAVVLMSHLGRPDGKVNPKYSLKPVVPVLEELLGKSVTFTEDCVGPQT
FT                   EETVNKASDGQVILLENLRFHAEEEGSSKDAEGKKVKADKADVDAFRKGLTALGDVYVN
FT                   DAFGTAHRAHSSMVGVDLPQKAAGFLVKKELEYFAKALESPARPFLAILGGAKVSDKIQ
FT                   LIDNLLPKVNSLIITGGMAFTFKKTLENVKIGNSLFDEAGSKIVGEIVEKAKKHNVEIV
FT                   LPVDYVTADKFSADATVGAATDASGIPDGYMGLDVGPESVKLYQKTIAEAKTILWNGPP
FT                   GVFELKPFAKATEATLDAAVKAAESGSIVIIGGGDTATVAAKYKAEDKISHVSTGGGAS
FT                   LELLEGKELPGVAALSSK"
FT   CDS_pept        join(complement(1109614..1109671),
FT                   complement(1109529..1109554),complement(1109127..1109463),
FT                   complement(1108903..1109069),complement(1108778..1108849))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207873" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948788"
FT                   /orf_name="Pc16g04740"
FT                   /product="Pc16g04740 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93144.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniParc:UPI000183189E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H950"
FT                   /transl_table=1
FT                   /translation="MAVAARLAAKFNTYYAERPVLTTMVTNAVLGGVADTVAQLITAFR
FT                   TRRPPTSGDDFLSIEIPDLDKQKPPAVGELGYVRSSSPPFDFERLTRFMAYGFFMAPVQ
FT                   FQWFGFLSRAFPLTKKNPTAPAFKRVAFDQFIFAPFGLACFFTYMTIAEGGGRRALTHK
FT                   FRDVYLPTLKANFVLWPAVQILNFRVIPIQFQIPFVSTVGIAWTAYLSLTNSAEEV"
FT   CDS_pept        join(1110839..1110923,1111159..1111273,1111340..1111613)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948789"
FT                   /orf_name="Pc16g04750"
FT                   /product="Putative uncharacterized protein Pc16g04750 "
FT                   /protein_id="CAP93145.1"
FT                   /db_xref="UniParc:UPI000183189F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H951"
FT                   /transl_table=1
FT                   /translation="MDEWNAPPLLTTAALQGWSERKTMFRTSGSQKRNEAQIVAKLKMC
FT                   LADLYDGHDVIPAKPSCGRTLAMSLGEKYSGGTPEETADYLPEDQTKCKYSLAARRNEV
FT                   SNVLSSLLADSQLKQKHILDTQVQGYRQCHRGGHAGPLTVGRWLTSAHRLLQL"
FT   CDS_pept        join(complement(1113905..1114079),
FT                   complement(1113576..1113848),complement(1112404..1113514),
FT                   complement(1112176..1112344))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207885" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948790"
FT                   /orf_name="Pc16g04760"
FT                   /product="Pc16g04760 protein"
FT                   /protein_id="CAP93146.1"
FT                   /db_xref="UniParc:UPI00018318A0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H952"
FT                   /transl_table=1
FT                   /translation="MPGLEIPGEFLRHAILDTFVPHSPALDIEGALSSSLENGADDLPS
FT                   VLSSIPQRSLLFFDEFLPVRIVLRLSDCSETILKHYLPRLEVKLDVFAVDPAESVGENL
FT                   TPTRDIIFSGIVSGDEDPLVVFNEFEGDEGSGNHVYLVWNIETILRRPRIRIQHPSLLF
FT                   IASTSLNPADARRQEDSEDDYLPSLVPASTNMLQSLSIDKSFNHKEPFLPASRLLRVVP
FT                   TTYNEDPIYNIQQHHGHPFRVVPAASARIRYSRLNSYTGTPMTVASLDFEVTPYLTCEV
FT                   AFDKANLHLSEGTIESLSETPGLALPITCRPRDDVTLMYKLTPEYGPETNPSSTALVSM
FT                   LDIALEAIILVDDECKPRISMQWRTNVDFSVALNPTFGGPSPALQRTNRPTSLSVSTQG
FT                   GVTPSNRSSLRERAYSVTDVGITISFSGPVRVQVGSVFSWDVFIVNRSNVPRKFALIAI
FT                   PKRKRVDPRGHVARPSSSSITSRKEDQVAEAVTDDNIVHARQKSVAGQEVELISLSTDI
FT                   RVGPLLPGTCHSTELKLLPLATGPLHLEAVRLVDVNTNETTDIRDLPDILADDQPRSS"
FT   CDS_pept        join(1114252..1114386,1114436..1114587,1114636..1114709,
FT                   1114782..1115752,1115812..1116798)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207896" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128961"
FT                   /orf_name="Pc16g04770"
FT                   /product="Pc16g04770 protein"
FT                   /protein_id="CAP93147.1"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="UniParc:UPI00018318A1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H953"
FT                   /transl_table=1
FT                   /translation="MDLSINPGAALWQQAQNAEGRVYYYNVQTKATQWTKPQELMTPVE
FT                   LALANQPWREHTTDAGRKYWYHTETKQSTWEMPEVYKNALAQAPAPLAPPATPSFVAGG
FT                   TSFPQPQQRDREDFDRGYGDRRGGYAPYEANGLVAAPEFKTMDPDYHSLEEAESAFMKL
FT                   LKRHNVQPDWTWEETMRATIKDPQYRALKDPRDRKAAFEKYVVEVRAQEKDRAKERFAK
FT                   LRADFNTMLKRHPEIKYYSRWKTIRPIIEGETTFRSTNEESERRQLFDEYILELKKAHL
FT                   EQESVTHKAAMDELMNILGSLNLEPYTRWSEAHAIIQSDSKFQGDDKFKTLSKSDILIA
FT                   FENHIKSLERAFNDARQQHKAARARKERKNREQFVALLKELRSQGKIKAGAKWMNICPI
FT                   IKDDPRYHGILGQSGSTPLDLFWDMVEEEERALRGPRNDVLDVLDDKRYEVTPETTFDE
FT                   FNSIMSADRRTSKIDPDILNLIFQRIQEKAIRRTEDEKHAADRQQRRAVDALRSRIKRL
FT                   EPPIRVTDTWAEVQPRLEKYDEYKALESDELRESAFEKAIRRLKERDEDAEREREALSQ
FT                   SRGGRRDFDRGDRDYRSGRGERRGHRTPEMDAYEADRRKAQADRERTYRKVSGISPSRD
FT                   RRDERGDRDRYRSRDRDFDRPRVRDPDRREDERERLYRTRGDPRGGRDELDYGGGTVGD
FT                   TRSVASGDRRRRRDSDTESVASRSAKRYRRDSRERERSKGPRAPRRERSAIPEEENEDA
FT                   KKDEKAIHSGSEEGEIEEE"
FT   CDS_pept        join(complement(1118677..1119224),
FT                   complement(1117553..1118618))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000237402" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128962"
FT                   /orf_name="Pc16g04780"
FT                   /product="Pc16g04780 protein"
FT                   /protein_id="CAP93148.1"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="UniParc:UPI000183196C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H954"
FT                   /transl_table=1
FT                   /translation="MSQPQFADRGTTQDTEAWIFGSGSEALASAVYLIKDAKVHPPKIH
FT                   IIDKHLFSERISHRPGSWSDGYDQFAACLPVPAGLPMERLLATLPSTQSQGPSLLEEIQ
FT                   TAEANRVPKKRDVRTCFLAMTKGSVNHIPTDSLNLSIKHRIALIQILFKRETYLSQRQV
FT                   QELLPENFFQSPFWTIWSAQFGFQPWHSAAEFRRSIRQYMPQFHSLSILSCLDITGYYQ
FT                   YESLYSPIYRFLESCGVDFRFGVEVKDIQVSKDDAKPKVTGFNLVKGKQQLRKQLGEND
FT                   IVIMNIGSTISGSAVGTNNSSPVWQSLDADDLFDQNWSVWLDLGNKHNGLGNPYNFCTR
FT                   QSETMVESFTITTQDLVLYDDLRSLIKCRSEAGAFIFLGDSNWKINLCIPAQPVFSSQP
FT                   EDVRVLWGFAHAPRVEGNYVNRILLHCSGADILSEILGHLNLHYNPPLSRTVTIPRAMP
FT                   RMSSLFITRALNDRPSITPLSNVGLVGPFTESSGYTCSDVSYGIRTAKTAVYKLMGLKG
FT                   ELDGPLYSNTSIIRKILFWR"
FT   CDS_pept        join(1121334..1121381,1121445..1121723)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671909"
FT                   /orf_name="Pc16g04790"
FT                   /product="Putative uncharacterized protein Pc16g04790 "
FT                   /protein_id="CAP93149.1"
FT                   /db_xref="UniParc:UPI000183196D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H955"
FT                   /transl_table=1
FT                   /translation="MHDSNHSFDAVRWLCETEDSVHYWYGRCPQLQKECNSDWPKTPQR
FT                   FTGPLVQRRTPPAAFPVVDLARLPAKAASPKSDTDSEGDDDESEASESSEDMGWMKPAV
FT                   EDWT"
FT   CDS_pept        join(complement(1124740..1124759),
FT                   complement(1124654..1124678),complement(1124557..1124568),
FT                   complement(1124100..1124502),complement(1123882..1124043),
FT                   complement(1123733..1123829),complement(1122242..1123670))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000222803" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128963"
FT                   /orf_name="Pc16g04800"
FT                   /product="Pc16g04800 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="CAP93150.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniParc:UPI000183196E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H956"
FT                   /transl_table=1
FT                   /translation="MSDKLTRIAIINSDKCKPKKCRQECKKSCPVVRTGKLCIEVDPSS
FT                   KIAFISERLCIGCGICPKKCPFGAIHIINLPTNLETQVTHRYSANSFKLHRLPMPRPGQ
FT                   VLGLVGTNGIGKSTALKILSGKLKPNLGRYDNPPDWEEILKYFRGSDLQNYFTKILEDD
FT                   LKAVVKPQYVDQIPRAVKGPVQQVQQLISARAALGNEQEIMDVLELNQVAQRDIGHLSG
FT                   GELQRFAIGLVCVQKADVYMFDEPSSYLDVKQRLAAARTIRSLLRPDDYVIVVEHDLSV
FT                   LDYLSDFICVLYGRPAVYGVVTLPSSVREGINIFLDGHIPTENLRFREESLTFRLAEAG
FT                   EEFVADKDRAFAYPTMEKTLGDFHLKVEAGKFTDSEIVVMMGENGTGKTTFCKMLAGAL
FT                   KPDGLISVPKMNISMKPQKITPKFTGTVRQLFFKRIKTAFLSPQFQTDVYKPLKMDDFI
FT                   DQEVQNLSGGELQRVAIVLALGMPADIYLIDEPSAYLDSEQRIVAARVIKRFIMHTKKT
FT                   AFIVEHDFIMATYLADRVIVFDGQPSVSARAQTPESLVGGCNRFLKSLDVTFRRDPTSY
FT                   RPRINKYNSQMDQEQKLAGNFVSFLPYPWMLRIPLINPVLTIFNSTSWKKRTEKGVHNE
FT                   HRRRRHKRDGRDYEQRRNRHRGDWKIVWLMGFLGVYRASGVQGEGFRHRAGSSSGADDG
FT                   LSDDDGDDDDDDDLNGNSDPD"
FT   CDS_pept        join(1125832..1130174,1130231..1130354)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207917" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948791"
FT                   /orf_name="Pc16g04810"
FT                   /product="Pc16g04810 protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="chromatin binding"
FT                   /function="helicase activity"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93151.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniParc:UPI000183196F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H992"
FT                   /transl_table=1
FT                   /translation="MSNGYPISPVADDTHTDGDVVTQRERSPSEPVESHPVSESSPEPD
FT                   VADESYDGASADSDAEDEDAADDNSDYDANTYSRENSSSPHPVRGAKRKSSPVSETDLI
FT                   RQNPDLYGLRRSGRARTTRPVADSSDSDSDDVAPRTKRRRKDPSQQPSKASRSATVSSL
FT                   SESDSDEYGGKSARASKARRRRLQQTASYEPSLNEVRFSTRTAKKVSNYNEDDEEDEAM
FT                   FEDDPEDLAPNYWVESYVEDTRPAVDVVLNHRLKEGIDPKANDLGRNDFEFCIKWQDKS
FT                   HYHATWESNESIANFRSTRRVDNYVRKVLNEDIRLQYSVDAPPEDREKWNLDRERDVEA
FT                   IEDYKKVERVIGVRDGEDGTTEYLVKWKRLFYDSCTWEPEDLVSEIAQREIDRFLDRTA
FT                   RQPISDKNEMNVATRKSFEPIHGTPSFLQNGELKDFQVKGLNFLAFNWVRGRNVVLADE
FT                   MGLGKTVQTVSFINWMRHVRRQQGPFIVIVPLSTMPAWADTFDHWTPDLNYVVYNGSEK
FT                   ARSVLRDYELMVDGNPKRPKFHVLLTTYEYAMNDSPFLGQFKWQFMAVDEAHRLKNRDS
FT                   QLYIKLFEWKCQARLLITGTPIQNNLAELSALMDFLNPGLVEVDVDMDLNSEVASQKLA
FT                   ELTTAIQPYMLRRTKSKVESDLPPKTEKIIRVELSDVQLEYYKNILTKNYAALNDGNKG
FT                   MKQSLLNIMMELKKASNHPFMFPNAEAKILEGSARREDILRAMITSSGKMMLLDQLLRK
FT                   LSVDGHRVLIFCQMVGMLNILSEYMEYRGYKYQRLDGTIPSAARRLAIEHYNAPGSTDF
FT                   AFLLSTRAGGLGINLMTADTVVLFDSDWNPQADLQAMARAHRIGQTRPVSVYRLVSKDT
FT                   IEEEVIERARNKLLLEFITIQRGVTDKEASEMQNKMARVVAEPNSTDDISRILKRRGQK
FT                   MFEQTDNQKKLEQLDIDSVLANAELHQTEEAEQIQADGGEEFLKAFDFVDIKVDDLTWD
FT                   DIIPKEQLEVIKAEEKRKDDDRYLAEVVEQNRPRKRHAPTDTTDSREERKAKRLARAQV
FT                   NIDDGEEESASLDPKRPLGEKEYRALSRAFLRYGDMDDSEDLILEDARLQNRDRGTVRD
FT                   ALHEITDKANALVQESLDQLEAMKQSGRNPTKKEQKAVLFDHHGVKRLNAWTIVERPPD
FT                   MRLIRSIIKALTDFKTFRLPEATKLADYSCQWGAREDGMLLVGIARHGFGAWTQIRDDT
FT                   ELGLGDKFFLEEHRVERKTQRLQTEEKATKSPGAVHLVRRAEYLMSVLRNKYNNNATAR
FT                   RAVDNHHRNNKRGSRVSGSGSVSASPAPSSSRRPENPRKGHRESDRSRPRPRDVDRHNT
FT                   PSHDSRSRSSLDDRPRHRLSDASNDELRRRKGHENGSSNKEDMAFMFFKPIVANLKQVS
FT                   MITAKNYPSKNERAQKLRLTLVKIGEFIRNNLEGSQSMPSLEVRLWDYVSLNYWPNKDA
FT                   SGAKLQQMFNKVMEASKASKASNGSSA"
FT   CDS_pept        join(complement(1132513..1133059),
FT                   complement(1131796..1132427))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207918" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977838"
FT                   /orf_name="Pc16g04820"
FT                   /product="Pc16g04820 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP93152.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831970"
FT                   /db_xref="UniProtKB/TrEMBL:B6H993"
FT                   /transl_table=1
FT                   /translation="MASRDSPGSPLSSVGSLETSDHESMKHESRAHSPSMPNMPPSKRR
FT                   RTGVPSWDRQTPLSSAQDEIHPPPSPTASISSDSSGDIPNSPGILSLLGTNQEEDYSGQ
FT                   STDQVTICRWDGCTAGDLGNMDGLVQHLHNEHIGSRQKRYSCEWSDCTRKGQTHASAYA
FT                   LRAHMRSHTREKPFYCTLPECDRNFTRSDALTKHMRSVHETDTMRPNDSISKVHGTAGS
FT                   TTGTPASKLQRIRLKLTQPREPGTEAEPHTEAITIVPTPVTTDAHDPDETTMPEFGPEL
FT                   DFDESELALPPRDLYRLLRRQIAWAGKEAAQLQAEWEEIRPRRERAWREKEAIFDDLIH
FT                   AEIGLFSAMVGSVPPAHLTTSLEKLQQQQQQFQDQQDQLTKSAEAPTIEGST"
FT   CDS_pept        join(complement(1134691..1134742),
FT                   complement(1134206..1134638),complement(1133651..1134131))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250284" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948792"
FT                   /orf_name="Pc16g04830"
FT                   /product="Pc16g04830 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93153.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI0001831971"
FT                   /db_xref="UniProtKB/TrEMBL:B6H994"
FT                   /transl_table=1
FT                   /translation="MPSLIGKEIGPIGYGTMRMTWNAQPPSEEVCFETLNTTLELGANF
FT                   WNGGELYGTPEYNSLHLLNKYFTKYPGNADKVVLSVKGGLKKGELTPDGSEENIRRSVD
FT                   ECLRLLDGKKKLDIFECARQDPAFPVEQTIKVLAEYVKEGKIGGIGLSEVDAETIRRAH
FT                   KVHPIAAVEIEMSLWSTDILHNDIAKTCAELQIPVIAYSPLGRGVLTGAVTSLADIPAG
FT                   DIRHHLSRFQEENFKHNMKLINEVNDLATRKGVASAQIALAWILTQSKKPGMPTIIPIP
FT                   GGTTKDKVVQNMGGAQALTDSEMAEIEAILEEHTVSGARY"
FT   CDS_pept        join(complement(1135984..1136127),
FT                   complement(1135480..1135923))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671910"
FT                   /orf_name="Pc16g04840"
FT                   /product="Putative uncharacterized protein Pc16g04840 "
FT                   /protein_id="CAP93154.1"
FT                   /db_xref="UniParc:UPI0001831972"
FT                   /db_xref="UniProtKB/TrEMBL:B6H995"
FT                   /transl_table=1
FT                   /translation="MSHVTSRASWLSLLLVSLLVVSTVNALPIYQTDQQIEGQVGKLES
FT                   RSPRLIPDTAEYVHDILQGLGLTKPSPSSTATSSATPTSTPTSTPTASIKDEQDVEYMK
FT                   PTHTTHIIYSSSTSYTPTHGSNGAGYTHTVKQEHSNNRPVENIQIGQGWNGGKKITAEN
FT                   FPAVFDAVYKELEHRLSDAINSSDEIGLENFL"
FT   mat_peptide     join(complement(1135984..1136049),
FT                   complement(1135483..1135923))
FT                   /db_xref="UniProtKB/TrEMBL:B6H995 "
FT   sig_peptide     complement(1136050..1136127)
FT                   /db_xref="UniProtKB/TrEMBL:B6H995 "
FT   CDS_pept        join(complement(1137411..1138038),
FT                   complement(1137123..1137337),complement(1136980..1137072),
FT                   complement(1136868..1136906))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217063" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948793"
FT                   /orf_name="Pc16g04850"
FT                   /product="Pc16g04850 protein"
FT                   /protein_id="CAP93155.1"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI0001831973"
FT                   /db_xref="UniProtKB/TrEMBL:B6H996"
FT                   /transl_table=1
FT                   /translation="MVGVQVDNLAVNDGPLTSENATLLRPSDPTLPLEELRKRYDEDGY
FT                   LLLKGVLPREDVLAARDAYFSSLESTGVLKPGTTPVEGVFDPAKDHLDYPGIGAGHIGG
FT                   NGKPGGERAAAFVDLALDAHYQDWYANKFCNHPALYDFIARFSDWGKNTLSMRRTLLRN
FT                   NLPKSKPIGVHYDQIFLRYGDPTSITAWVPMGDIKLNGGGLIYLENGDKVGIEMEEAFF
FT                   TKAKQAGLTDEEAKSAFNSNMMSTGLLSEFPTDFAREHGQRWMVSAYEAGDVVLHKPHM
FT                   IHASTVNNDPDNVIRLATDLRFCDSSKPYDKRWMNHYTFNDGV"
FT   CDS_pept        1140224..1140760
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(1142250..1143278),
FT                   complement(1141465..1142154))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000235013" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824617"
FT                   /orf_name="Pc16g04870"
FT                   /product="Pc16g04870 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="CAP93157.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="UniParc:UPI0001831974"
FT                   /db_xref="UniProtKB/TrEMBL:B6H997"
FT                   /transl_table=1
FT                   /translation="MSRLEIALSSTPEHLLKHLLLGTVLLTSLYALYRRLLPKPLPGIP
FT                   FNQKSAQSIWGDVLELRDDPSGLAKWCSKQLENHGSPICQALMGPLSKPVVLVADVGNA
FT                   REMLMGRSDFDRSAYIIDRFPLFGEFHLNMKTGDNWRQSRNWLKDLLAPQYLHNVAGPA
FT                   IHSSVLKLIELWQHKFHVGDGRVFSMVSDLKTLALDVIVAFHFGSDFQDSALDRQIDHV
FT                   GKLDGSKLPSGEYNEVEFSKAPLHEFQQGLTDVGDKMAAIYTTKWPPLLVAWWVRYVSP
FT                   YYRPFFEAKDRFIRKHINLAVRRCRSDEDPSTGIDYMVHREEKAARKARREPVFDKQIM
FT                   VDEAYGNLIAGQHTTSAALVWILKLLADYPSVQEKLREELQGIFDSAMQENRLPTAAEI
FT                   IKSKLPYLDAVLEETLRLRAAMLVPRDAAKDTELLGHRIPKGTVVLLVCQGPDYKPSPP
FT                   SKYWSDVKASRMYPGKGNPDLEIFDPERWLVRNEKGDLEFDGSSYPQLAFGLGIRSCWG
FT                   RRLAMVEMRIMTTLMILKFELKDVPKGLRGHEASYDISYRAKKGFLHLKSRGEFP"
FT   CDS_pept        join(complement(1146249..1146329),
FT                   complement(1145944..1146216),complement(1145743..1145885),
FT                   complement(1145168..1145653),complement(1144081..1145113))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235014" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948794"
FT                   /orf_name="Pc16g04880"
FT                   /product="Pc16g04880 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93158.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831975"
FT                   /db_xref="UniProtKB/TrEMBL:B6H998"
FT                   /transl_table=1
FT                   /translation="MQGQKRRVRTCHSCYTRKQKASESDSICDRQYPCNHCTRRRRPEE
FT                   CVYGPPPVKVPSCPPVPADQSETQPRPVESARPTRETPVDDSEAHWSREHSALARSFGY
FT                   FEDSNSNTMALLRRLELPDQSDTELKNAWPSTWETIHHELDLMPERQIIDFLVQYFVYE
FT                   LNWMKQVIHVPSFLANYQLWWAKDKIVEIADVEFAALIARICSYATQFLPSPSHTVDQI
FT                   RGRSLADIRDTCSNIGNKLATACETLDWKGTLVRVQHIIFAALKVSCEGRTSQFWEGIG
FT                   SACRAAQKAGIHTDTTGLESQLAKDSAQELERDVQRRTFCSLYVLDSHLSRQLDRIPFL
FT                   SNHLIEETLPRLRLIPDIGNIPTETATRAPDIFTERLMQVQLGLFWRGLGLQRTCEFDP
FT                   TESERIYEKFNSEYLNNLHPAFAIAHPDTTLDKALPKLPMQRQLLYIAIFDSICWNFRP
FT                   LLLLKPDQVASLAPYKKVLLRSQKRRLGMAALKVLEAVAALHTMFGGSYTRFSAIIFNS
FT                   FEPAILLLNLCSHADFPFDQDDNSTSLVGTKVRMTYRIAMQAVEQAIHRLQMLADLSDM
FT                   AASGARVATLLFARSVQPKQSSSPPALTLSVSGSLGPSQFPTPIERYGEQENWPSLEAG
FT                   DPYSMPDNFPSMAQDSFPSPQLSSLKFPVVWGEAFF"
FT   CDS_pept        join(1147269..1147320,1147372..1148218,1148278..1148839,
FT                   1148960..1154893)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235015" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948795"
FT                   /orf_name="Pc16g04890"
FT                   /product="Pc16g04890 protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="oxidoreductase activity"
FT                   /function="transferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93159.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="UniParc:UPI0001831A4E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H999"
FT                   /transl_table=1
FT                   /translation="MTAPWPVKHDPIALVGIGCHMPGGVRDIPALWEFLRKQKDVHREF
FT                   DEPRFSAKGFSHSNPDRPGTAVARSGFLLDEDPRLFDAAFFGITDNEVETMDASQRKLL
FT                   EVTYEAFENAGETWEGVSGSRVGVFVGDISFDNYVSQTRDWDYGGKYSATGAFPNMLAN
FT                   RIHYVFNLKGPSLLVNSACTSAMYALHLAMNSIRNGDCESAIVAGSNWIMDPNCHIAMG
FT                   KLGALSATSRSHTFDASADGYARGEGFAALYLKKTSLAIEDGSPIRALIMGSAINANGR
FT                   TNGITNPSGPAQEIVIREAYKNAGNLDPSQTTFLECHGTGTRVGDPTEIKAAGNVFGPS
FT                   RAFEQNDQLVVGSVKTNLGHLEGACALPGILKVVAALEQGEIPPTLGFQTPNPRIDFKQ
FT                   AKARVSTQVEPWPKDKLKRASVTSAGFGGTNGHCIIDHVHNLLPSYVKPGIVGQRVEQL
FT                   NGQNGINGTNGTNGTNGTNGTNGTNGTNGHHNPKTEAPKLVRKADAGTRKLVVFPFSAH
FT                   NQTSLVANVDSLNEVIHQHSLADVAYTLSARRSRFMHRTYCIADKDQVPETGLKQENKL
FT                   EIVSSPQRVSAGFIFTGQGAQWHAMGAGLLQYSVFQNVILYLDSVLSILPEPPSWRIAD
FT                   FIVGNCDTDSIQIPAVSQTVCTAVQIGLVDLLASWSVRPAGVAGHSSGEIAAAYASGRI
FT                   TAAEAIVAAYYRGYMVSFNNQRGAMLAVGFGPEKAMEYIREAGLEERLKVAAINSFDSV
FT                   TISGDADSVEDLSARLSKESVFNRLLRTGGLAYHSHHMLPFGSAYEEKVNDGLRHIKSL
FT                   GVDTTSAKYPFIPWTSSVIPDKSTTEVTASYWRANLESPVRFTDAVSNLLSLPGLNIGA
FT                   LIEIGPHPALKGPLGQTMKSLGKVIPHIASLKRNEDAQRLMLDCAGTLFALNVPVNLVA
FT                   VNAIDGQGPKGEHHLEYGCTAIDLPRYKYTYGPIKYHESRLSKEYRLRPTPRHDLLGSK
FT                   VPGTTKLRPQWRNMLRLKDLGWLNDHRVPPHVLHPGAAHIVMAMVAAEHKYNEFPDALP
FT                   IIGLTMRNVSIKKTLVVPEDDHGVEIVLSMELEDGATAKSPGWASFSIASVVRDSDQWT
FT                   EHCSGQIKIEVSTFEQATPISTTMDGRLVDAQTWYTRFADMGLQFGPSFQGYSDIRADP
FT                   AKNIASARLALNTTAGMFPGGESTYPIHPASLDLVIRLGLMACNGGQAETASVQLPIHF
FT                   NQMKFNYGHLEGRDWATGVSRGELRGLRGAYAQLQMLDEEGKVMLDIDNMRFTSLNNEQ
FT                   ESTSTGDRACKAYSSPFARLVWRPDIRTLSKDQFNEALKCCQENVGEFPQLCKIFDLAG
FT                   HANPDLRVLELGASSNAGAGKAVLKTLVGSNNIKRYREYVATDTTEERLESVRESTAEF
FT                   RDVKYSVLDINEVPSEQGFQSGLYDIIICSDGPQTLQAMQHLRKLVTPAGRLVQVSRTG
FT                   REITSESLRNVDFELVGEVTEPAHHSTITVHALRVTERHQIHSNRLVHLLHGDQGAPEL
FT                   LHRLAQVLGDLGIAIKVSSLDDTQSVVAPNSHVVAFLDGDNLLFAASQHRIGLFQHLAA
FT                   NTASMMWLTSCGLVKGRNPDGSFVSGLLRTLAAENPAGQFLSVDIDAKDFRVQDTEMDT
FT                   LVRSLVDVVLSLQQTSEDSHDIVVNHDLAWQDGNMWVSRLVPDAELQGYDQTTMDDQNM
FT                   KAVPLSTLGPVRAAFRTPGILTSLYFKPYTELWETLPHDWIEIKLEAVGLNWKDLGLCS
FT                   GRFDQNNLSNEYVGVVSDMGSSVHDLSIGDRVYGMGKGHFGNYTRVPAVLAQKLEAGVD
FT                   SLEAATMPLVYMTAVYAFEHITRVRKGSKVLIQSASGGLGLAATQLALSKGADVYVTVG
FT                   TADKAQFLSDVMGISSDHIFSSRRLTDVPRMISATKNGGFDVILSTSQGDMLYESIKAL
FT                   APLGHLIDVGRMDVTSAKTVALELFHKSASFTSFDLGLVIERDVELGGDLMFAVNQHFR
FT                   AGRIGPIRPYHVSDISQLDQALLKLSKGTHIGKMVISYQNPSSLLSVHQSVTHARFLQE
FT                   ANYILVGGMSPLGRCIIRWMVSRGAQHLSVWSRRGGNNLSPEAAALIDEMTSQGVRIQL
FT                   VTCDVSNREQVLRSMQEANSERAVRGVFNYAVSYQDISFDKMTADMFCQGMAAKVFGTK
FT                   NLHEATANLPLDFFTMTSSLGTVYAFPTQSTYLAANNFLDYFARYRRQSGLPATTVSLG
FT                   FINDLGALTQDEVTVNLFARTKGQTVTGSQVLRALEPAFVKHLNTKDQWLGRWEDPLSA
FT                   ANIFTGIDPAVLANMKRAEGKGSASGTVPRWYHDPRVSLMLRAMDDAWRHGNGEDSDKA
FT                   TFGFDDADQSPAVQLRRHFEASIKKTRNGQDKEEVAETVTFVTDAIRTTVAGMLFIDPS
FT                   VVKENHTVVDHGIDSLLAAEFRTWLNSSFGKNISMLKLMDARSSIGSIAQVIVEEAIGA
FT                   "
FT   CDS_pept        1156930..1157784
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217158" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948796"
FT                   /orf_name="Pc16g04900"
FT                   /product="Pc16g04900 protein"
FT                   /protein_id="CAP93160.1"
FT                   /db_xref="UniParc:UPI0001831A4F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A0"
FT                   /transl_table=1
FT                   /translation="MSSNIKSELDTEASSSSFLGDLGPPIRRYPYKGTKQFLETVKMEL
FT                   SRQEEEFEASEWVLFTKVNEQAFSRDFLNSDDNILQRCWNSYDSSQHLLLVKMTVSRAH
FT                   EIAARVFERLFFDCLKPMDLDDCLQTFGSATCKAENGSAKQPDCQFLPRRLPRARTKKW
FT                   PSVVVETGFSESPSKLTSDARFWLSESNGDVQMVITVKIGRSSPNIVLESWELVNNRVQ
FT                   RQQVITISKGDNNHVYLRGQPLIISFNKLFLRPPSIPKEINISLDDDILKKIARNVWEE
FT                   QGF"
FT   CDS_pept        1158871..1160532
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169919" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948797"
FT                   /orf_name="Pc16g04910"
FT                   /product="Pc16g04910 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP93161.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831A50"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A1"
FT                   /transl_table=1
FT                   /translation="MTAISSTPASDSENQNVSQASEDYLHQPNEKDHSSDPGASDDVRK
FT                   ITGYRWFLICAALYLSALMYGLDTTIAADVQGAVIQRFGQVDQLAWIGAGFPLGSVAVI
FT                   LPYGFLFTTFNMKWLYIAGIVLFQGGSALCGGAPNMGALIVGRVIAGAGGTGIYLGGLN
FT                   HFSAMTTRNERGAYLAGTGFVWGLGAILGPVVGGGFSDSSATWRWGFYINLIIGAITAP
FT                   VYLFYLPAIHPAPGRPLKDRLLSLDYVGFVLSAAMWATFAMGFIFAGGIWQWNDGRTIA
FT                   MLVVWGVMLALYALQQTFCIFTTPEHRSFPGHLLRSRTQILFYVTTTCANTCMFFTTFY
FT                   IPIYFQFTRNDSSLMAAVRLLPYLLFTIAFNLASGAALPKIKYYMPMCLVSGIFMTIAG
FT                   ALFVGYLSPSTPTGQIYGFSILMGVGTGITMQLGYSVGSLKVKPTDALSAINLQNVAQI
FT                   GATVICLVIASQAFQSNAIRNLDHVLAGQGFSQSEIQSAVAGSQSTLFEQLSGDLRTAA
FT                   IEAITSAMARAFIIPLVAGALGLVCSLLMSRERLFG"
FT   CDS_pept        join(complement(1161392..1161989),
FT                   complement(1161161..1161333))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207984" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948798"
FT                   /orf_name="Pc16g04920"
FT                   /product="Pc16g04920 protein"
FT                   /protein_id="CAP93162.1"
FT                   /db_xref="UniParc:UPI0001831A51"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A2"
FT                   /transl_table=1
FT                   /translation="MTFTIANPVLSNPVPTTKSLPNKGKDQEVPSLTRLLHHSHVTTEF
FT                   DPLIFAAAASLQLQLQPEKQYPDTETDTRLIASPYNSVPHLLDIAALERQDRLFALALA
FT                   YLKPIRDDYATAEYTESFNWTEVFDLLRAFSQAEDHTWRSQSYYVVIFRSTLLPGIDSD
FT                   RLYELDAHSHQEAIASGGLLKYWFGAKNDRLQNMATCIWRNRNDARLGGRGPWHAQARA
FT                   AATTMYEQIRFTTLRLVIEDGVQSWKLSDWKEDV"
FT   CDS_pept        complement(1162730..1164289)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207983" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948799"
FT                   /orf_name="Pc16g04930"
FT                   /product="Pc16g04930 protein"
FT                   /protein_id="CAP93163.1"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="InterPro:IPR019175"
FT                   /db_xref="UniParc:UPI0001831A52"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A3"
FT                   /transl_table=1
FT                   /translation="MSTAEELLRDFEDDEEDFDVGEGEEVEEEPEQQEDLKEGPDVSND
FT                   FDRSISTADELTRLHKVLRDHYSIRFPELERLVTTPIKYAKTVAVIQNGPFSDIKALST
FT                   SSENMVGVPLKSVLDGPSLMAVAMEATITKGREMTESELKVVLDTCERILKLDNERAAL
FT                   TASIQSRMNQIAPNLAALIGAETAAQFLNQTGGLLELAKIPACNLGAQGSRRSEGLGFA
FT                   TNHGVRAQGFLYDSPLLQEVPMDLRKQGIRIVAAKMVLATRADVSNFAKDGSLGEELKQ
FT                   QCYTRLEKLTETAPNAGTKALPAPDDKPSRKRGGWRARKAKEAVAMTELRKAQNRLAFG
FT                   KEESEVGYGTGSGTVGLGMLGQQDDGRIRATQIDQRTRARLSKNNKGWGTNTPASGTAS
FT                   SLRGFGQGGTSGTASVLQARGIRASGVGSSLPGAAGTSSTIAFTPVQGLELVDPKVQAE
FT                   LKRKRAAEENRWFKSGTFTQAPHQTPVNPQGGENGGFKVPAIPLKRKADTGEGKMGPPP
FT                   KR"
FT   CDS_pept        join(1164736..1166517,1166568..1166801)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948800"
FT                   /orf_name="Pc16g04940"
FT                   /product="Pc16g04940 protein"
FT                   /function="binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP93164.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001831A53"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A4"
FT                   /transl_table=1
FT                   /translation="MEASRGPPRVKNKAAAPVQISAEQLLREAVDRQEPGLEAPTQRFA
FT                   DLEELHEYQGRKRKDFEDYVRRNRINMNNWMRYAAWELEQKEFRRARSIFERALDVDPT
FT                   SVVLWIRYIEAEMKTRNINHARNLLDRAVTILPRIDKLWYKYVYMEETLGNIPGTRQVF
FT                   ERWMSWEPEEGAWGAYIKMEKRYSEFERARAIFQRFTVVHPEPRNWIKWARFEEEYGTS
FT                   DLVREVYGAAIETLGEDFMDERLFSAYAKFEAKLKEYERARAIYKYALDRLPRSKAMAL
FT                   HKAYTTFEKQFGDREGLEDVILSKRRVQYEEQLKENPRNYDVWFDFARLEELSGDPERV
FT                   RDIYERAIAQIPPSQEKRHWRRYIYLWIFYAVWEEMEAKEMERAGQIYQECLKIIPHKK
FT                   FTFAKVWLMKAQFEVRQMQLQAARKTLGQAIGMCPKDKLFRGYIEIEQRLFEFARCRTL
FT                   FEKQIEWNPSNSQSWLQFAALEQSLLDTERTRAIYELAIEQPTLDMPELVWKAYIDFEE
FT                   EEYEHERVRQLYERLLQKTDHIKVWLNYARFESLVPPEEEEEEEEEAKQFTEEAATRAR
FT                   AVFSRADKALKDKDLKEDRYALLNSWKTFEYTVGSPEHIDKIEKQMPRRVKKRRKLQDD
FT                   QYEEYTDYVFPADDQSAANLSRLLAKAHQWKQQNQS"
FT   CDS_pept        join(complement(1167905..1167975),
FT                   complement(1166830..1167496))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948801"
FT                   /orf_name="Pc16g04950"
FT                   /product="Putative uncharacterized protein Pc16g04950 "
FT                   /protein_id="CAP93165.1"
FT                   /db_xref="UniParc:UPI0001831A54"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A5"
FT                   /transl_table=1
FT                   /translation="MGRYPETRVSMHDLINKGKPTLEAKKIDLGCEGLGHAAWGCGAVD
FT                   MFLRRGNCLSPPCFEVIRGLIDMFKSCRHIYSHVMIYSVSCSSRNAYKWMCGYHFLFSS
FT                   RKALAQSLIQPTHYTTTDMYYKASPAPLKDYRRGCSDCTTGLGEYVIVTGVWPACTTSI
FT                   VHTCRGQSHSEGTTYQFVPLSRRDRFNCMRVHGLVSLSHADIEMVFWSDYYCMKSPRPR
FT                   VCMDVFMMGTIQGVKAVANMGIT"
FT   CDS_pept        1170386..1172512
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671911"
FT                   /orf_name="Pc16g04960"
FT                   /product="Pc16g04960 protein"
FT                   /protein_id="CAP93166.1"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI0001831A55"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A6"
FT                   /transl_table=1
FT                   /translation="MTGPKPRTKIEGDCSTIHSNTFYVYSPTGFASIPLKENADWNSLP
FT                   SPEHMVTGPACVQGGAGEDEAFYLVGGTGSDGNSGLQRFSFSTQKWETLLMRSADMKDR
FT                   TGHGAGYIPSTSQILVYAGNTDGSTQISQSTLLISTKAPFDIESGVPQGEPALYEPIIL
FT                   PWSSSEVALIGGSATNTAIFIYQTANKQGWTISEATLPSAIQSNSLCALASDSGTKVLE
FT                   EFNMVASPNSVTSYLLSSKGKVQNPVTAIPSLEKRGLTDSYNDTFAPTASWSDYTLAQG
FT                   DGLVVLASGRSNDSLAIFNQTTNAWVNSTELFLGKGDQHVLKPSTTSLTSSTSTSTSSS
FT                   TSTSTSTAASTTPTSSSPVAAVAGGLTDHGKMILGATLGSILGFGLILLIILFLLRRAK
FT                   KKQQQTAQPGRGGDAKDRLSFQDQGIEPLTEGAYPMARSPVPLAAASTDSLAIMSGTYR
FT                   EKSLKPPANTGYGLSQPKASSPLSTIPSSGAMGASSVYTDDTSRAGDDTGHGNQAADRL
FT                   TDEGWGKYFEDGGATNFQSDRSTASSAYTKSDYRGSGWPMTTLTPLNFGFLDQPKPLGH
FT                   VLSGSPTTENGPSETGSRSLIIPESQSARISSADSISIASDDDRDDSKWQGAGQSSWLG
FT                   RPPSSNYTTSFYQASTQDMPWESSNGSLADKGRQSNARRSSVIIPHDIDELPVQGQQNN
FT                   TNSDMSWLNLKADR"
FT   CDS_pept        join(complement(1174959..1175733),
FT                   complement(1173175..1174901))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185420" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948802"
FT                   /orf_name="Pc16g04970"
FT                   /product="Pc16g04970 protein"
FT                   /protein_id="CAP93167.1"
FT                   /db_xref="UniParc:UPI0001831A56"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A7"
FT                   /transl_table=1
FT                   /translation="MASSRESQHSLLSEDSIDTRPQRSWNPLNNRLTDSDYRYHSPSDS
FT                   TWSEEVLRDVGLGISNTSGDGIPAEIPTDKRHSTDSTATTTPNTYKIPHSPQTPQTPHT
FT                   HAHVRCPNRATVLQKRLSWVPLTVLILAVYATIFSGIYLGIALRKPRWQTVSSDGPLVP
FT                   STAALLSAFFAKTIELAYVTICVAFLGQVLSRRALMRDSRGISISDMNMRAWIMQPGSM
FT                   IVHWEALRYSALTFLGSIALVSTFVAMLYTTAAQALVAPKLSPGPVEPTILQGKVLSSF
FT                   ANTHYTAANCETPVTNEIDPDYRNTTCIQIEHVGHAYHNYQQWISQWSQLITHNNETSS
FT                   QLQKRPKPTGSLWDNTTVTGSWIDMQDMSTLSKEHGRMINNITMAMPHGGIPGAAMNSK
FT                   NKLKQPTDSSGEGKYTIEASVPSPAVNVLCTGMTKDELSPLVYSSWPGGDKFNMTTWTT
FT                   SPPDDIPDPASWLNRTVVDTLFQFGPKSDQIPPIFGKYPLPYNTILNTTGPWPANAIYL
FT                   LGATPPSNNTNTPEYVMCSLRAKQTGACSTKYSADMSGAFLSTDCENASNGLQYNRRHD
FT                   TPEGQWDADWKNIASEWANALSLNAGISDGAASNARLLMQMMPRYDKGEGAFALDPSLP
FT                   SIAEALAVMAGSTLILSSQNAPFVPFWNYSTENRNVLSEPVYQGFNASIQAFGYASGGT
FT                   EQWQGVFYVILVFAFLTSAVCLGFMIVEARGRQVTDFTEPQNLFALAVNSPQTTQLEGA
FT                   CGCGPWGEQLKERWYIGMEEEDEHYYIRSKTEEKIPLLKTMDSRQLEPMEIDDGGGRML
FT                   SPMVDEFRKVSKRHSFLAKLY"
FT   CDS_pept        join(complement(1179721..1180057),
FT                   complement(1178127..1179670))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207940" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128964"
FT                   /orf_name="Pc16g04980"
FT                   /product="Pc16g04980 protein"
FT                   /protein_id="CAP93168.1"
FT                   /db_xref="UniParc:UPI0001831B1E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A8"
FT                   /transl_table=1
FT                   /translation="MAYYEDRRYREPRDRYARASYADPYDDPRGRYRRHERDSYVPRAS
FT                   TDSIEEVQRDYPPGSEYAYERPYSSRRPRRPVYENMRRASSVSGYDPYNDASYRSSGPR
FT                   RSRHHEDKRSRRPKYESDSSPSRSPPRHRRRKSFSEQALGALGLGGAASSASRGERGRG
FT                   RSPSRHRHRHRSYSRSPSDSRSPSRHRGGSKRDKSEQRIAQAARAALTAGAVEAFKQRK
FT                   EPGDWAGSKGKRVLTAAVTAGGTDGLVDKDPNKHEKRHVIESTLAGLAASHFVNGSRSQ
FT                   SRGRDGGRSSSGGLKNLAATGALAAAGKEIYDRYSKSRSRPRGRNDSRDSNEERGSHKR
FT                   SKSVSEYISKGMAALGLGEEEGRRDSRDRKEHHREHRPEHRDDRERRHRRGHRRDYSDS
FT                   DSDTDSDYYNRGSRRGKSSRDVGRHHSLDGTNPPPYAPTSASRGESGAHGHGSSSESDS
FT                   DLGDSSDEKKQRKKLKRDMLVTGGLASVATIHAAHSIYGSMEKRKERQKQLKEGEITPE
FT                   EARKHRMKANTKDAVSIGLAALGIKGAYSEWKEVMEKNKENTHFREECAQRAVKRERRR
FT                   ARSQGVPSRHHRWPDEIEYAPSTNDSRSDHGTFYRDGNPYGAHEAPQISY"
FT   CDS_pept        complement(1181140..1181949)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948803"
FT                   /orf_name="Pc16g04990"
FT                   /product="Pc16g04990 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP93169.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831B1F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A9"
FT                   /transl_table=1
FT                   /translation="MSSCRASIVSILNNDDNPSFAVRSAPRLSRNHTSPSYYPHHSETL
FT                   PPPVSDPQFTRPQASSESPATSPRGTRHPSDAMTEVVQPVSPGSSDGSAYDYITSQPSS
FT                   YHPYTRQDPRREPYRFSARGPAAPRTPPETRSSTSERPSSQTGATRGTGRKNKYPCPYA
FT                   VSHGCSSTFTTSGHAARHGKKHTGEKSVLCPICNKAFTRKDNMKQHIRTHRTHSDEMRS
FT                   TSEPESDARWAMGRLGSAYASASHQLNASQPMEAGVPPVPGAGPQAP"
FT   CDS_pept        join(1184305..1184381,1184533..1184583,1184722..1184911)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948804"
FT                   /orf_name="Pc16g05000"
FT                   /product="Putative uncharacterized protein Pc16g05000 "
FT                   /protein_id="CAP93170.1"
FT                   /db_xref="UniParc:UPI0001831B20"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B0"
FT                   /transl_table=1
FT                   /translation="MRGTADQAKLQSSDPLEPIWERCSTSSDEYASLLVSTKDLVFGAS
FT                   WPAYYDETSEALTTCIASLSPPFLLSGMDTLIYYCTRHIFLAHAAFYMLTCFNPSAEYE
FT                   V"
FT   CDS_pept        join(1185347..1185482,1185526..1185652,1186115..1186208,
FT                   1186341..1186534,1186664..1186739,1186828..1187061)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128965"
FT                   /orf_name="Pc16g05010"
FT                   /product="Putative uncharacterized protein Pc16g05010 "
FT                   /protein_id="CAP93171.1"
FT                   /db_xref="UniParc:UPI0001831B21"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B1"
FT                   /transl_table=1
FT                   /translation="MGPVPKLLRLSLSGDAQYSVNLRRFAKVETPAYKAEGNDPEWTHY
FT                   DQIIPDNSPRSKNQVPYGLSATPGITLGYRQTLASLVRLDIDRHMWLRQGAVHTWMFER
FT                   GQSITMTPVLLYAVKACCCVHARMPSKREITSNIRRLAPAYSGGEADEIWRLPKDVGSP
FT                   GDFSREIHRAERTSEYVEGGVFWITSTMVGLHIVAKCVDMTIADASNANKMGDLGASRK
FT                   SFGAQSEKYHAPATSTLVSSCPLSLLLSYSLVNEQNPYNGANFFHQGTWYGPQICRGNT
FT                   LVSPC"
FT   CDS_pept        1187363..1187683
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(1190086..1190330),
FT                   complement(1189452..1190023),complement(1188868..1189394))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160947" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948805"
FT                   /orf_name="Pc16g05030"
FT                   /product="Pc16g05030 protein"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93173.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="UniParc:UPI0001831B22"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B2"
FT                   /transl_table=1
FT                   /translation="MDREGKEETEGERLSGTIYLWWHHVMSRDPPNIMPPAAPVKGFRR
FT                   VGIVFARLIVSGEDRGIRPFITWLSDGEHMCDGVTAKLLPRRAASKPVDHAITTFTHVR
FT                   LPKSALLGSLDKPKDMRKEFLSSIWRIRVGSVALPLQMIAGMKRGVFVAGKYSQRRHIF
FT                   GPDQKPKPIISFRTQHGPILHALAQLSVFDAYAQHSIQYFKHPNVAAPVQHAIGAMLKA
FT                   VLYKTSQACLFTLSERCGAQGLFENNHIIEAMLETRAMSIAEGDTLVLSIRLTSEILLN
FT                   RYNMPPAKDPTSLLAKHEQGLLDELRGMTRTISGGHRGEGFDRLVLPRSQEFVEAMGHR
FT                   IAYEAAIEAGVHSDLVALYEIWVILQNQGWFVQHTSLTRERMFQVEADRLSVVLPQLDT
FT                   LLDATGAEPYCSAPIASQASWDHFVDQLETKTGSRTTNIDLLRGGAML"
FT   CDS_pept        1190638..1196001
FT                   /pseudo
FT                   /gene_family="HOG000213032" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(1196730..1196853),
FT                   complement(1196471..1196669),complement(1196291..1196414))
FT                   /pseudo
FT                   /gene_family="HOG000076802" [ FAMILY / ALN / TREE ]
FT   CDS_pept        1198057..1199211
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000050844" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671912"
FT                   /orf_name="Pc16g05060"
FT                   /product="Pc16g05060 protein"
FT                   /function="coenzyme binding"
FT                   /function="hydroxymethylglutaryl-CoA reductase (NADPH)
FT                   activity"
FT                   /biological_process="coenzyme A metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93176.1"
FT                   /db_xref="GO:0004420"
FT                   /db_xref="GO:0015936"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniParc:UPI0001831B23"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B4"
FT                   /transl_table=1
FT                   /translation="MASKTMAKFAHVLQDAKHITERVHDAPEISIENFIGYISVPVGLA
FT                   GPLLIKSPDGTSTRTYAPIATTESAIIASCSRGCKALNESGGGQFHVLSEAMSRSPVFQ
FT                   FNCTEHAIDFARRVPDLWDYIAKTAKSTSRHARLVKLTPNIVGSNVHVRFDYTCGDAAG
FT                   QNTVTIATQRVCDWLLASSQEMELHITGVFIEGNMAPDKKPSWGTVSSPRGVEVVTWAS
FT                   LSDEVCRAVLKCTAENLYHAFRTTQEGGIRNGQFGSNINVANVITGIFIATGQDAASVA
FT                   EGPFGHLTPEYDHKSRQVKLTLYFPSLPVGTVGGGTAYKTQREALGILGCSGSGMKPRL
FT                   AGLIAAFSLALEISTAAAAATNTFTQSHERLARAKQGNNPASKI"
FT   CDS_pept        join(1199924..1200552,1200606..1200762,1200936..1200962)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948806"
FT                   /orf_name="Pc16g05070"
FT                   /product="Putative uncharacterized protein Pc16g05070 "
FT                   /protein_id="CAP93177.1"
FT                   /db_xref="UniParc:UPI0001831B24"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B5"
FT                   /transl_table=1
FT                   /translation="MSREVDIVPLIGHCVPYVAIILYHTRRQVRIYSTTFSKHKAFLFI
FT                   HIGTGIMELARYHISKARLGNENVLPEVIDVLSCLIWSWASFVLVKTLRRGDPLTTRPP
FT                   YQVAAALRPVICIASYMLQLPSLHRISISALDSFVYARMAIFFFTYTPYLRGYSYSTIY
FT                   SLSIPLAAVVSIHESHVRGATLVFMLATAYVAKLNEWVTHRSRIVQRSETKSAMDMLEK
FT                   HVLAGLLLLGFAELDRLREVSKNDALTKPLNDDYVPKLEHVFIYKVRS"
FT   CDS_pept        join(1201755..1201793,1201848..1201980,1202031..1202157,
FT                   1202219..1202820,1202878..1203323)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000227987" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948807"
FT                   /orf_name="Pc16g05080"
FT                   /product="Pc16g05080 protein"
FT                   /function="adenosylhomocysteinase activity"
FT                   /function="binding"
FT                   /biological_process="one-carbon metabolic process "
FT                   /protein_id="CAP93178.1"
FT                   /db_xref="GO:0004013"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="UniParc:UPI0001831B25"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B6"
FT                   /transl_table=1
FT                   /translation="MAAPAQKFKVADLSLAAFGRREIELSEVEMPGLMAIREKYGADQP
FT                   LKGARIAGCLHMTIQTAVLIETLTHLGAEVTWTSCNIFSTQDHAAAAIAAAGVPVFAWK
FT                   GESEEEYQWCLDQQLQAFKDGKKLNLILDDGGDLTSLVHTKYPEMLDDCFGVSEETTTG
FT                   VHHLYKMMKENTLKVPAINVNDCVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVA
FT                   GYGDVGKGCAQALHSMGARVIVTEVDPINALQAAVQGYEVNTMEAAAPIGQIFVTTTGC
FT                   RDILVGRHFEAMRNDAIVCNIGHFDIEIDVAWLKANSQSVQNIKPQVDRYSLNGKNIIL
FT                   LAEGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKAEDEAFGKKYIEFGAGGRKPVGV
FT                   YVLPKQLDEQVARCHLDHVNAKLTELTPVQAEYLSLPVNGPFKPEIYRY"
FT   CDS_pept        complement(1203709..1204989)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000017578" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948808"
FT                   /orf_name="Pc16g05090"
FT                   /product="Pc16g05090 protein"
FT                   /protein_id="CAP93179.1"
FT                   /db_xref="InterPro:IPR008322"
FT                   /db_xref="UniParc:UPI0001831B26"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B7"
FT                   /transl_table=1
FT                   /translation="MPPNIPTILLLGTCDTKLSELLYTKSQIESTNATVLLMDTGRNPI
FT                   THEEIAIPQSALLTTTTASIPTPDLTTLTRAEYITTLIPYATKKVTHLHEHHQIHGILA
FT                   IGGSCGTTLAATVMRDALPVGFPKLLVSTMASGDVGPFIGETDISMMYSVVDIAGRNRI
FT                   VEGVLDNAAGGIVGMAGAFLKRERGSTAEIEVSSRVRIGISMFGVTTPGVTRARERLEE
FT                   VLGGCEVYVFHATGSGGRALERLVREGQIDAVLDLTTTEVVDEVVGGVLSAGPGRLTAA
FT                   SVRDIPRVVSVGACDMVNFGEVGTVPATFREGKRLLHEHNATVTLMRTTKKECVEIGRF
FT                   IAGNLLDSRDRGQLRRTKVILPVGGVSMLDVAGQPFHDPEADEALFSTLERELEGSGIC
FT                   VMRDPRDINDPSFAVAVADELVKLIRQ"
FT   CDS_pept        join(complement(1206674..1207477),
FT                   complement(1205736..1206626))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824618"
FT                   /orf_name="Pc16g05100"
FT                   /product="Pc16g05100 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP93180.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831B27"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B8"
FT                   /transl_table=1
FT                   /translation="MSLYPNRHRLALFSLKPLNEQAKKVANHPYNQHLTSSLPDGTRVL
FT                   DIGFQVRSRSNRTLATLGRGDADIFVDGPTIAKVQCSFEIEPATNVVMLYDRSHGQTTQ
FT                   VFGDDATPFEPGRLRQVVVQKGLNSFLGMGGRAQNTVQFEFLWYQDFPEMVGLIKDRES
FT                   IMNDCEENPRLARTADDVETVLPSQMQTRIHTAGPRQLTMRYLKFGKLGSGQFAVVYKA
FT                   LDVDTGKFLAVKIIQRPEQASAQAAWEVSKYYALKREVEHLSRISHPHIVDFITSQGWE
FT                   GPTAEIFMGLKDGTLESLVKGGVPDVESIAKRAFYQMLQALDCLAANGIVHRDVKPENI
FT                   LYTVLPGMQYHFQLGDFGLSNRAIVAKSSVGTPLYMAPEVYEHGVQTHKMDVWSLFVTF
FT                   AWVSDFDGFRQNLHHFTSLPQAREAILAMASRIGAMQEMARVNPDERASAAQILVKVYN
FT                   GEGLTTQLNRIPPLTPTVVETRPEPQLQPEPMHQVRHRPTQGMPKFPKPHTSQFRVRKS
FT                   SNPRGRIWEPNTTAARPGGNLPPTRRRRHPSNVEFLQGFRMRPPLNY"
FT   CDS_pept        1207907..1209064
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824619"
FT                   /orf_name="Pc16g05110"
FT                   /product="Pc16g05110 protein"
FT                   /protein_id="CAP93181.1"
FT                   /db_xref="UniParc:UPI0001831B28"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B9"
FT                   /transl_table=1
FT                   /translation="MADSIRSGLSNIHTALDNLVKNPRRLDIDRSRFDREASYISHQSH
FT                   NSTASMSPSGPSDTQNRRDLRKWQLSKDHEASRPYQQFEAQVNEMEASIIEGIERRTLN
FT                   VPDGTIMRVLARDTVKENWMKQGIWNEEWGKTPQMRWMHEPSPEITPEPETYPGARPLL
FT                   GLFAPLGGALPTDTGKNVRQGGERQPKQKTGDEPSRPFHQFIYQISKESERVRNLDARL
FT                   PTIFHDPEPPAANINTNAYERVKSIWVKRGIWNEEWGILPGMAWKHESPLQIPDDDCDS
FT                   MPSPVKPKAKVTFNIFQDLMPAQPDGPAPMGGQGTNKRKRAAAPVETKRTKRKVSKPAK
FT                   PEASSSRRAVGIPTNQNQVDVPDQGTRDTGRRRSKRIQNRTKSSK"
FT   CDS_pept        join(complement(1211048..1211391),
FT                   complement(1210841..1210981),complement(1210188..1210773))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948809"
FT                   /orf_name="Pc16g05120"
FT                   /product="Pc16g05120 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP93182.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniParc:UPI0001831B29"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9C0"
FT                   /transl_table=1
FT                   /translation="MSRFTVPPGDQTVQVRIIDSTTRIDNFQLGFLMEPPMDGMEYMSP
FT                   LPSWSFLIEHPSGQKILYDLGTRKDLNSFAPTVCEHLKAQGWKVDVKEEVIDTLDKNGI
FT                   AATGISAIIWSHWHWDHIGDLSRFPSSTELIVGPGFKAEFLPGYPARPDAHILESDFAG
FT                   RNLREIDFSNSVQVGQFRAIDFFGDGSFYILDSPGHAVGHLGALARTTTNPDTFIFMGG
FT                   DLCHHSGEIRPSKHLPISRDIQPRLATPIPLQCPGDWVYEQLLVRRTGSADKPFFLPAM
FT                   GLDIEKAIETIEKAQVADADNNIWFIYAHDRSLLGCVDLFPLPANAWKEKNWREKTLWT
FT                   FLGEFETAIKQIEYHS"
FT   CDS_pept        join(complement(1213093..1213630),
FT                   complement(1212990..1213043),complement(1212659..1212932),
FT                   complement(1211752..1212568))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671913"
FT                   /orf_name="Pc16g05130"
FT                   /product="Pc16g05130 protein"
FT                   /protein_id="CAP93183.1"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniParc:UPI0001831B2A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9C1"
FT                   /transl_table=1
FT                   /translation="MLLSKTLLGSILGFAVSSTARIIATDEVPLLGPSFLSNFDPSNST
FT                   AISHAKSEFPGLIDNLFSTGALNRTDLAFHIDVFSASTNKSIYSYSHVGENSKKSVTSG
FT                   ELNDKTISRLGSVTKLFTVYAIIAKAGIEVFSDPVTKYLPELAGNPAYDPLESIRWEDI
FT                   TVGALASQQAGSGGAADFLKHYLDPERPLQYSAEDLLKFFRDEKKPVISPFRNAVYSDG
FT                   GFAILGQVLARLSGKTYSEAVQEILFDPLELESMSTKVPTGPDLNVIDRRIIDKNTSWG
FT                   VDVEVIASTGSYYSNAADLRTAGLAILNSELLSPATTSQWMKPSSGTGSLVELVGAPWE
FT                   ISRLEIPVTPGSNRTRISDLYTKAGGNIDYTAIFALSPDHGIGYSILVAGFTATPARWP
FT                   LRDVVGETFIPAAEHAAAENAKRNLAGTFADQTSPDTNLTLSVDRGRPGLGLKSFWVKG
FT                   TNARDHAHWRLYPTGLNSFSKSLSSLYKAKGSVRVAHRMVQPQTPVKPRAAVEGGKGGL
FT                   FDNSFVWMNLDFAGPSDEFIFNLVDGRLVSVEYPTTGSVLRRV"
FT   mat_peptide     join(complement(1213093..1213558),
FT                   complement(1212990..1213043),complement(1212659..1212932),
FT                   complement(1211755..1212568))
FT                   /db_xref="UniProtKB/TrEMBL:B6H9C1 "
FT   sig_peptide     complement(1213559..1213630)
FT                   /db_xref="UniProtKB/TrEMBL:B6H9C1 "
FT   CDS_pept        1214309..1214452
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(1215338..1215389,1215447..1216282)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20671914"
FT                   /orf_name="Pc16g05150"
FT                   /product="Pc16g05150 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93185.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0001831B2B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9C2"
FT                   /transl_table=1
FT                   /translation="MARVLEGKFGIVTGGSRGIGEAIARNLAEKGCSLLLNFTSESSRA
FT                   PTEALCSSLATTHNIKCESVQADLSKPAEAVTAIITAAKERFSTSGKFQIDILINNAGV
FT                   SQDRNLNDANKGPIEAEHFNWQYSINVLAPLLLTQACAPFLPTDRSGRIVSISSVSSSL
FT                   GFVGQSIYGGTKAAIEAMTRTWARELSDRATVNAVNPGPVVGDMYFATGEQFWKDIQGY
FT                   QDNTPLSKLDVNNEDTMSRLTDEQKRLIQEKMGGRRPAFTSEIAGVVGMLCTPDGLWCT
FT                   GSVVCANGGMKMGQ"
FT   CDS_pept        1216549..1217145
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179180" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948810"
FT                   /orf_name="Pc16g05160"
FT                   /product="Pc16g05160 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP93186.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001831B2C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9C3"
FT                   /transl_table=1
FT                   /translation="MPGFSFPPDFTIPTPRLQISPFNPNNPAHCAFLVQLWNTDGFISS
FT                   CGKTGITTPEKAHSFLKGRVSEYYAYHGYGTFLVSRQTEDGVKPIGTVSLTRGIPPGPH
FT                   YLAPDIGFAMLPEECRKGHATEAAKALLEYAGKNLGVEAVFGFCSPANRWSRGALENIG
FT                   MEFRGVKPLKVFGGEDSAVYVLPGMSGDLSVYNLD"
FT   CDS_pept        complement(1217279..1217629)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        1218791..1219894
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128966"
FT                   /orf_name="Pc16g05180"
FT                   /product="Pc16g05180 protein"
FT                   /protein_id="CAP93188.1"
FT                   /db_xref="UniParc:UPI0001831B2D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H2"
FT                   /transl_table=1
FT                   /translation="MRYSMINGLLLLTVSPMSVLALPVDPNALPGQWNPSGQHPNNHWQ
FT                   NGQGGWTDANGQWHNNGAVGPRHWPDDHKNQDGWTDGSGKWHPNNPNNQNGQWHANQNG
FT                   QQYNNGWTDANGQWHNDGDVRPRDWPNDHHNNQNGWTDASGKWHANNPNNQNGQWHANN
FT                   QNGWTDASGKWHANNQNGWTDSNGQWHVDHKRDVIPGLNGAVNSNGANLLNGAVRHRRS
FT                   WRDGDNDQNNGNYGEGNNGNGIGNYGNNGNNGNDWNNGNNGNGNWKRGNGNGNGNGNGH
FT                   GNGNNGNNGNNGNNDWKRNDGFNRDIDSVANPSVIPRDSNSDIKSVANPSLVNSVTKPL
FT                   NSRDSNSDIDSVVNPSTIPHDQPTNNA"
FT   sig_peptide     1218791..1218853
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H2 "
FT   mat_peptide     1218854..1219891
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H2 "
FT   CDS_pept        join(1221277..1221658,1221718..1221910,1221960..1222059)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128967"
FT                   /orf_name="Pc16g05190"
FT                   /product="Putative uncharacterized protein Pc16g05190 "
FT                   /protein_id="CAP93189.1"
FT                   /db_xref="UniParc:UPI0001831B2E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H3"
FT                   /transl_table=1
FT                   /translation="MHANVDSGKLLIGSLCGAEDPYVQYSAYFWGIIGICSHFKASTDL
FT                   FWKIPRYSTTMGGLNYGWPNLEIHSTFKAYKYTKTSLIRLVLQPIHLLQTFKNLIKLAN
FT                   MKVFTPIFVLIAFATSQAIAVPAAEAVDLETRADYCVDIKVCHGYNYEGGCYKECKRPG
FT                   KAYDIKKEYQKNAGSFKIGTKGYKCHIGSPDHGTLPVDYPGTKRLRNDFINNITGYQCN
FT                   KV"
FT   CDS_pept        join(complement(1223525..1223815),
FT                   complement(1223153..1223460),complement(1222269..1223079))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000201861" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977839"
FT                   /orf_name="Pc16g05200"
FT                   /product="Pc16g05200 protein"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP93190.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001831BFF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H4"
FT                   /transl_table=1
FT                   /translation="MLFSFGTALCALGTASALVISERGVETRDVSGTAHVYLKESNGPS
FT                   QHYASGYIYGIPDTPNQIPDHFYSDIAFQYTRAGGAQTPESKGWIGGQDDYTFRWESTL
FT                   SNYRTARQQGGQFILLVHDLWGADSLQSEDAPFPGDNDDWSFYDEFLSALISDIKDNDL
FT                   IDGVTIDIWNEPDGRNFWDREQDQYLLMWGRATARFKSELPNLALSGPSVSYPPTPDDE
FT                   WWNNWASYVVSNQSLPEEHHWHSLSKTFTSTEMLKNYDALLAKYSATREGLVNINEYGH
FT                   PDEQNPSGSAWWIAQLERANIFGCRANWASAYALHDFMAQLLGKPGAGTDDYDPKATGY
FT                   YPNGEYQVYKYYASSMVGDRIKTETTMDTNGDVYATVDAEGGVLRLLAGARTTTGTWSI
FT                   QLEELSALGLPKSGEVGIHTYEFPGSDDPYARLDEPVDLGTVTHKYSEDSLTFPIYSEN
FT                   VYDAWAFEIKF"
FT   mat_peptide     join(complement(1223525..1223764),
FT                   complement(1223153..1223460),complement(1222272..1223079))
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H4 "
FT   sig_peptide     complement(1223765..1223815)
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H4 "
FT   CDS_pept        join(1224584..1225130,1225191..1225353)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(1226159..1228165)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212187" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948811"
FT                   /orf_name="Pc16g05220"
FT                   /product="Pc16g05220 protein"
FT                   /function="carbohydrate binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP93192.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001831C00"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H5"
FT                   /transl_table=1
FT                   /translation="MLQHSDGKLVYTFDAETLWIEPWGPNAVRIRSTRARQMPDQNWAL
FT                   LDPGSASSTLHEDPKGGSSLRNGNIQASISETGKIQVHNSKGELLLQEYTRNRKHVADP
FT                   KCSAIKVEGREFKPIPNSESYHLTARFESVDPDEMLFGMGQYQQPFLDLKGHELELAHR
FT                   NSQASVPFLVSSLGYGLLWNNPSIGKSFLGRNIMSFEARSTTTLDYWVVAGDTPADIVE
FT                   TYSAAVGKVPMMPEFGLGFWQCKLRYQTQEELLQVAREYKRRELPIDLIVIDFFHWPLQ
FT                   GDWRFDPTYWPDPTAMVQELKSMNIELMISVWPTVDKRSENYREMVEKGFLIRTDRGVR
FT                   TAMDFQGDTIHFDATHPGARAYIWEKCKANYYDHGIRSFWLDETEPEYKAYDFDNYRYY
FT                   EGPNTAIGNLYPVGYTQAFYEGMEQAGQKNIVNLVRCAWAGSQRYGALVWSGDIASSWD
FT                   SFRNQLSAGLHMGMSGIPWWTTDIGGFHGGDPTDSKFRELFVRWFQWGAFCPVMRLHGD
FT                   REPRQPIQGTTGGALCASGADNEVWSYGPAVYEICKKYMLLREALRDYIRELMKQAHVK
FT                   GSPVMRTLFYQFPEDPQCWKIGTQYMYGDKFLCCPVLQEGQRKVKAYLPVSSSDEKWFP
FT                   FHSDEVGHEGYEGGQWIEVDAPLHWMPVFVRDH"
FT   CDS_pept        join(1228995..1230779,1230842..1230986,1231066..1231698,
FT                   1231795..1232108)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076680" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948812"
FT                   /orf_name="Pc16g05230"
FT                   /product="Pc16g05230 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93193.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831C01"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H6"
FT                   /transl_table=1
FT                   /translation="MNSDHSPTHRGGLIQCDVCQATFTRQEHLNRHIRSHTTEKPFQCL
FT                   QCGKSFTRLDVLHRHNQSHVSKPLGDRSGKKFRACKECAVSRVRCSRGDPCERCSQREI
FT                   QCIYPVAEKRKTQSSLDRRHSSPRPTTSISSSAPGSPANSSQLEPSRPPVDSAGVSAPS
FT                   TAPHTLGLDPGMQPLNPLSSTSDSTNHWGWLPLQSSGTLPGASTEVINGNMPVFDSQIL
FT                   EKDLNEWVGNMASVNWLSPQGPDFFPDAQLDDLLLLGISAGVAGQGETVNGLENYGLEK
FT                   TNDAPPLLENSNVASVPALPHQFSGDQQTPVMEPVHSASGETTADTPVSRPPEGTYYVE
FT                   GSAGRAPFQGKSSWRASRYSPWGSNLGSTGRRTPVSERAESSCGLFVSEMVYKDCVRSF
FT                   AAEANRLEIGPDMASIPSLGEMQDLVQLYFVGFHPTYPFLLKHPSIFIPSSHWILLLAV
FT                   AATGSRYSSKARYHLLGESLIYVVDQILCNRLNNPVVGDGNQLWNPVPEVEEKRALDFV
FT                   TLQAALLNYLSLLHCGQNGAVQRALNRRYHLIEAYRSLNLLSVAGKPSSEIRGEADPED
FT                   VFRHWLDSESLIRTGWMIWLLDSITSYQFHCTPLVHLGEVKARLPCREDIWDISSSPEP
FT                   GCNLNCQSVTLLEALEMLYMEKKLPPNLGDLSSSVLIFAICRRNQEASAQHQTELTFWS
FT                   PNAEKQPRQIPRPTEETWPPAIPSLSKWRNSACDCFDILHWNANSIAARVGGWEHPTIL
FT                   HLHIARLMLLAPVQHIQKLAVYPLAPLTSPNSIPAAHMTARYHTLRWAIRDQYKARLCI
FT                   VHAGALLWHVRRYSSNSFLEPFGVYAATLIIWAYSISMQTMRKSEDSDCETEPTVIQLD
FT                   RPCDDEIVQAYVRFGHNMSARMHRVGDICEASAPRRILKQGIRLLTSDVTDPDGVRPGW
FT                   GVEKSYIDSLNTFITSPVVSQKNDHLSP"
FT   CDS_pept        1232405..1234024
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000159003" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948813"
FT                   /orf_name="Pc16g05240"
FT                   /product="Pc16g05240 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93194.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831C02"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H7"
FT                   /transl_table=1
FT                   /translation="MTSKSDNDIDPASTEVEYASPEAGPKDASSLARLAAQQEHHLSFL
FT                   EAVRRYPKAVLWSVLLSSSIIMEGYDIVLIQSFFAQPSFRDKYGEYDPGTDSHQITAPW
FT                   QNGLSNAVSIGTIIGAFANGYFVHKFGYRKVLLTSLVFISAFIFISFFSPSLPVLLVGQ
FT                   FLCGIPWGMFATMAPAYASEVCPLALRGYLTVYVNLCWAFGQLISAGVQSGFSGRSGQW
FT                   SYRIPFAIQWAWPVLLFPILWFAPESPWHYVRAGKYEKAEASVDRLGSAMQRAHTKETV
FT                   AMMIRTNEIEKSIDDGTSYLDCFRGIDLRRTEIACMAFAAQPFCGSAMGGTPTYFFLQA
FT                   GLPESISFRMSVGGLGIASVGTILAWFLMRLYGRRTLYLWGLGLLAAILCTVGFCSVGS
FT                   DSTGSNYAQAGLMIAWLGVYYTTVGPICYAVITEVSSTRLRNKSVCLSRIAYYIAQIVC
FT                   NSINPEMLNPTAGNWRGKTGFFWGGSSAVFFLWTFFRLPETRGKTFEELDILFANGVGA
FT                   RRFADCEVDAYVEGADAVRNHE"
FT   CDS_pept        join(complement(1236273..1236728),
FT                   complement(1236087..1236139),complement(1235560..1235947))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977840"
FT                   /orf_name="Pc16g05250"
FT                   /product="Pc16g05250 protein"
FT                   /protein_id="CAP93195.1"
FT                   /db_xref="UniParc:UPI0001831C03"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H8"
FT                   /transl_table=1
FT                   /translation="MLQSALYRILRIFLVTLDFWFNTDIPTSQVDRSGKPSQSIPVNNM
FT                   DPSSSAQQTETSTSDLIELQTWEEIYIEECLSFKASLETQARILRNTSEGVNRIKDVRK
FT                   ELISLSHQAERIKEAAFEMVDETPDSVYVRNATPEWLSSRLGDPQLEQCECINFPATSY
FT                   RTFKCTKLGMLYYPNILARYSQSDLTPYVWLGIEVVKRFNLALYRVYQACSRIGKEDSN
FT                   THEQDITATPNSGFNVKDLQFPLPRMWRSRSKGEWEATSTVGVFCRLLDDTMDEELISK
FT                   AEKDLGADWEQNDALHG"
FT   CDS_pept        join(1237674..1238531,1238593..1239183)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000212705" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128968"
FT                   /orf_name="Pc16g05260"
FT                   /product="Pc16g05260 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93196.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831C04"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H9"
FT                   /transl_table=1
FT                   /translation="MGLIPLQFKNPPKYMLACILCSANGILFGMDTGIIGPVTDMKDFK
FT                   KSFGSQNSTIHGLIVSCILIPAALSSFFAGYVADRLGRPKGICIGVFIFGAGAAIEAGA
FT                   VALSMFIVGRIVEGVGEGLFLGNLVVLICEISPTSTRGALTTGPQLATTLGLVMGYFIS
FT                   YGTSSLRSSLSWRMPFILLAAFSMVLCGLSLLYLPESPQWLGLHGRYAMAEEAWDRLGV
FT                   SRAEREKVVLQVRTQEVNSETEKVKDGTIDKLLAIFSKDVIGRTILAVFLMGMQQMSGI
FT                   DGVLYYAPQLFQKAGLASSEASFLASGVSALVIFAVTIPGLIYADKWGRRSSIVYGGVV
FT                   MGILMFLMGGLYAGNAVHKTTGAGRWVVIVCIYIFSAIYSVSWGISVKVYSAEIQPQRT
FT                   RASATTLAHSSNWVCNFLVALTTPVLLAKSSFGAYFLFGGCCVITVVVGIVFMHETKGR
FT                   TFGEIEEAFKGKSRGGKNKFGRGV"
FT   sig_peptide     1237674..1237760
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H9 "
FT   mat_peptide     join(1237761..1238531,1238593..1239180)
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H9 "
FT   CDS_pept        join(1240612..1240648,1240775..1241349,1241404..1241433)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948814"
FT                   /orf_name="Pc16g05270"
FT                   /product="Pc16g05270 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93197.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831C05"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I0"
FT                   /transl_table=1
FT                   /translation="MSAAFVGEALPGACQTCRRRKTKCDSNYPCSTCVDGGESCVREPS
FT                   SRQAFTPVTRSSREGSHRKQKTPINAEELDPTSAWNLTMPSAEDTSPIQVSHMRLDWNP
FT                   PMNRSASNSIANTRSALRDVCAEDPLQPLIDPLVAVMSGINTTTSTPSENPLYYGRPSD
FT                   IMSFPFEAPFWQPSELRDYVGTDQSEVYMSNVPTYNPADFQQTQLPQYLG"
FT   CDS_pept        join(1242415..1242578,1242640..1243657)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948815"
FT                   /orf_name="Pc16g05280"
FT                   /product="Putative uncharacterized protein Pc16g05280 "
FT                   /protein_id="CAP93198.1"
FT                   /db_xref="UniParc:UPI0001831C06"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I1"
FT                   /transl_table=1
FT                   /translation="MRMRTLWWTSSLAYFVSFVNVGYGYSCVSQWCDTCLPAEVHDAPG
FT                   VGFDLTPSYGTAVVHYHNGTVVEVAKIPGSPEYLELMARLATTSKPSPNSTLDSISEIS
FT                   SQLMENLLPDVSSPWRDWWRWLNTKLGRPVKPDEVEIISDLLQQLKVSTERRISQPLDR
FT                   VAVTDPGFQSLESATLNAALRMLDLRTWVGDSIYYAHRIVEGDAVYAANGYGLCTDYLD
FT                   PSLCSDEFAESPDSTVLFVSYNRNLLYTSIVEGVTSEAFSRITRVEAQLVDYELGLDRL
FT                   LEKDEAALWDRLRSQLQILPREFEHPITHLLLAGESVTHPRFLATLRDSISELSPDVVN
FT                   IKLAIDPTFAAARGAALYARRRQEVQSNCTERSECEETRLHERLHTPTQVELH"
FT   sig_peptide     1242415..1242486
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I1 "
FT   mat_peptide     join(1242487..1242578,1242640..1243654)
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I1 "
FT   rRNA            1244078..1244196
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="Pc16e00150"
FT   tRNA            1245166..1245247
FT                   /gene_name="tRNA-Ser (AGA)"
FT   CDS_pept        join(complement(1246271..1246444),
FT                   complement(1245818..1246237))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948816"
FT                   /orf_name="Pc16g05290"
FT                   /product="Putative uncharacterized protein Pc16g05290 "
FT                   /protein_id="CAP93199.1"
FT                   /db_xref="UniParc:UPI0001831C07"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I2"
FT                   /transl_table=1
FT                   /translation="MSDMEVQVAAQTRAALKADLTLRCVLRGKYRHKSRRSADVIPWAQ
FT                   SRVERLSNAVLRELNVIQMLRLRNVVYIFYDLFLDECDKQVRTEITESFHTKRPIHAIT
FT                   RKGKVYIMRRDERADKDVAQQYAQMSSIDKGPRPFFSDLADPPFYNEHGRRIERGEEGY
FT                   VPLAEMLREDDRRLQEEADEKRRQDEPDGNMEQD"
FT   CDS_pept        join(complement(1247206..1247405),
FT                   complement(1247014..1247149))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824620"
FT                   /orf_name="Pc16g05300"
FT                   /product="Putative uncharacterized protein Pc16g05300 "
FT                   /protein_id="CAP93200.1"
FT                   /db_xref="UniParc:UPI0001831C08"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I3"
FT                   /transl_table=1
FT                   /translation="MSHVHAAPVGGSPPPTEDIPHPGSVESLVAALGASGVRSLLWDVF
FT                   FFFCAVVAILRLDHFFKRVIDRGFPPPTPPPELPVRRRPPMTAEDHDRILAEYRVNRPP
FT                   ATPQGDE"
FT   CDS_pept        complement(1247864..1248694)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076657" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977841"
FT                   /orf_name="Pc16g05310"
FT                   /product="Pc16g05310 protein"
FT                   /protein_id="CAP93201.1"
FT                   /db_xref="UniParc:UPI0001831C09"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I4"
FT                   /transl_table=1
FT                   /translation="MRPADELNQPKFVLTLPREKTQDEIEIERSGDIDALQRYRWNVVH
FT                   QNKYHYANRAVELLRVEQELRSTVQEEQILAEKPETTRIWSIYNDTQAKLQALDKRYWL
FT                   LERQWWKVRNSFVEGPLIRAFDLWRSHPLWYMHRALVEDCERRGGCCSRSCGCCVNREI
FT                   GKTRQLGAGHCMVACGCCHRARGFELTEKEKMGFLTDFHIVDDNSVYRQRINRVSIWGL
FT                   SLDSHVSPFDMIIMPRGCKKVLSKEQMTKGKVEQVEEASALIDDEEKKEAASGY"
FT   CDS_pept        1249463..1250245
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824621"
FT                   /orf_name="Pc16g05320"
FT                   /product="Pc16g05320 protein"
FT                   /protein_id="CAP93202.1"
FT                   /db_xref="InterPro:IPR021369"
FT                   /db_xref="UniParc:UPI0001831C0A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I5"
FT                   /transl_table=1
FT                   /translation="MGSQDSLLSTIRHQNHTWEDGKQTENNRLLELRRKVQDFVYTPFG
FT                   CLITVYVLNVIAWGGMDFLLICNFVPAMCHPTCEDPHSPRLEWIEIDSQILVALLCVPA
FT                   FALAPLRYRDLYHLLRYRLCRNRGCLRKLAGYNKDWFRVYGDFEAKLDLEDAGVTREIT
FT                   EDYCSGPVAAAPLHLSTSPWKLDFVVWCKALNTAFQATLAGFMWGYKRLDRPPWSSTIS
FT                   MLFAFSCIAMAKITVFLEDRRVRDLEAPETILLWTIQR"
FT   CDS_pept        join(1250786..1250933,1251016..1251179,1251245..1251348,
FT                   1251409..1251853)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205324" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948817"
FT                   /orf_name="Pc16g05330"
FT                   /product="Pc16g05330 protein"
FT                   /protein_id="CAP93203.1"
FT                   /db_xref="UniParc:UPI0001831C0B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I6"
FT                   /transl_table=1
FT                   /translation="MLTQLQQESMQSGRAIAGILPSPRVDQEKSCRTVPMRVLVLGLSR
FT                   TGTESLIQLGYDGTYHGYTAAVESPRDCKTWLRAMRAKFDGVGAPFVREDWDQLLGHYQ
FT                   AVCDVPAACFADELMTAYPNAKVILTNRDTDEWFYSVSKTLVANAFTRKASLISLFATI
FT                   TRSPNRWTRPTMMYALSDFFDGDFERNGKQTYREHYRRVREMARERKMELLDYEIKDGW
FT                   EPLCKFLGHDVPVGPFPCGNDKQEVNARIKAIINREIQRLLLIFAFLFSCFAFTGLATI
FT                   TLVGI"
FT   CDS_pept        join(1252945..1252985,1253035..1253422,1253484..1254002)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217882" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948818"
FT                   /orf_name="Pc16g05340"
FT                   /product="Pc16g05340 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="carotenoid biosynthetic process "
FT                   /biological_process="chlorophyll biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="photosynthesis"
FT                   /protein_id="CAP93204.1"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0015995"
FT                   /db_xref="GO:0016117"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR010791"
FT                   /db_xref="UniParc:UPI0001831C0C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I7"
FT                   /transl_table=1
FT                   /translation="MVWLDEENPNNLNSYFFLFWFTTMDGRKYHVTLAPNFFRGRTTGI
FT                   FRVEDLQDLSSTGATVFAPGTGSNEFLDFRSEIQNLTSPRVSDNYTDLNVSTNYAGVQL
FT                   NVHITPTGKNLYIGGGGGITLSSDDNDFRRIIPGYSWYWGNPTLRLNGTITIDGEEIAV
FT                   DHDQSRGYFERQWGEFGISGGHYGYWLYLSNGLMIHGWVVSPTTEQPFGVPAWATVWHP
FT                   NGVHEVVEVGKNTTAFDVWKSEYSGRNYFNQVELDIPSRQARFDIHQLIRESEVRPLSG
FT                   TDGYNISEAYAQGQGVWEGEPVTFFGHLEQLSFW"
FT   CDS_pept        1254641..1254835
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(1254876..1255037)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(1255214..1256431)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076666" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948819"
FT                   /orf_name="Pc16g05370"
FT                   /product="Pc16g05370 protein"
FT                   /function="ATP binding"
FT                   /function="protein tyrosine kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP93207.1"
FT                   /db_xref="GO:0004713"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831C0D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H877"
FT                   /transl_table=1
FT                   /translation="MIEPHERFFSEGQGYFGRRENPATETHCNVWDWDQLRWVKVKGTA
FT                   KLFPPGEDVETSVLAQFADYLSPEVRSITVNDDGLLTGVSTDPEEDDTLFIGYIPLSLC
FT                   QSLADCPTIYFSQLQELDRLGPGVDLSSYDGHRVAFKFNPLGMPRRLQMSWKEMNLLSK
FT                   LPPHPNIIPFDRIVLEDVESRVIGFTTKYIPGGTLAEAEPKRPFRFEWLRQLTQLVDFL
FT                   NLDMGIIHQDIAPRNLLVDPETDKIILFDFDWAANGQDGLMDGRDDVSGVVFTLYEIIT
FT                   NDTHFTSIPHWERNKDMVQTTEWTCHRELDSDMSKFREFLNEWVASRADRATEHPNPPK
FT                   RLTWPDLPTPPDYNVPFELGMTEEGEPLWRTGVRTRRIALKKGQYSFRWERPPQSRLLK
FT                   KADNSM"
FT   CDS_pept        join(complement(1259270..1259343),
FT                   complement(1257957..1259220),complement(1256973..1257785))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824622"
FT                   /orf_name="Pc16g05380"
FT                   /product="Pc16g05380 protein"
FT                   /function="ATP binding"
FT                   /function="protein tyrosine kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP93208.1"
FT                   /db_xref="GO:0004713"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831CE0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H878"
FT                   /transl_table=1
FT                   /translation="MACRIPDLVLHGRPSQLPLPQPAAHLQSVAGSTRVFGEFHQGSGS
FT                   VLADDDDDILRFCERAQQVFKAQSARCFVHGFLVRGTTLELWAFDRSGAYSGKRLDLTQ
FT                   RPDLLVRTLAGYALMSDEEVGFNTFVKNAPGSDSYVAFDHRDKLHLRPELIATADYTVG
FT                   PGTTCYVASTSTVGEPDTVIKFSWREDEEPTEVRLLKRAHERNACGVIQVLGYQDLVNI
FT                   ADLRQGLHFPQTFANRTFSCVATTPLGRPIRQFTSIPELLEVLRDLVKALQSLCVNARI
FT                   LHRDVAIKNLIITPQHSANSPRGVLLDFDFALDLDNVRPIEPMVGSDGFMAIGILSGQR
FT                   HTYRHDLESLFYVFLWIAIANDRAHDEANDILEGLPKTSRLWKWCTMDFGAVGRDKAAD
FT                   MSPEGFEEILDEFSSDFAPLRGLAKELHALLFPMCDGKIFTGTETDQNIAHNDNWYPCF
FT                   TGLLSSGGLSQMTWKPGEQNVAETYAGDLKHLRDLLDMHDMPASVCIKLIHIHIHLNKG
FT                   EILVVHELDAPPHGKTPFLEPMAPDVAGKVYGCNYIVDDSGDLQGFEYTTIEGGPDLAA
FT                   YPSFVAEFRAAVVQRGVQHNFALAVNLGAAQRGSWMELDFPEKRATFLLPSHVPLPQSD
FT                   RLVLRTTITKFPSPKNEKNGTKDLPTHGHIEHTWGSSKRIGVDDEEPVDGVTTKNGLHL
FT                   MGVPLEPGTAFYMAVSAISAAV"
FT   CDS_pept        join(complement(1260769..1260991),
FT                   complement(1260614..1260675),complement(1259750..1260459),
FT                   complement(1259546..1259581))
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(1261525..1261619,1261833..1262706)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977842"
FT                   /orf_name="Pc16g05400"
FT                   /product="Pc16g05400 protein"
FT                   /protein_id="CAP93210.1"
FT                   /db_xref="UniParc:UPI0001831CE1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H879"
FT                   /transl_table=1
FT                   /translation="MQVSALTRSEVATLPIISYSTCQEIIEISQQSQIVPVFGRSPFTA
FT                   MMASSLLPLLLYFTYLPSVSAWIFSWHEPDGKLLTVQNDVSQDCKLMNNPEGNVFDWTP
FT                   QEGYWCIFLYGNTHCEEPSEGYTCKTYPWPDHVSSADLLSFKVKNNTSAFESSTSSISA
FT                   SPSPTNSDSSTSASPSSTDTTSSPTPTITTTPTADATDAASSFSATSASSDKPTISSGA
FT                   IAGIVVGVLAAVAIAGLIFFLIRRRRQNAAQSSVVAGRNATVAMAELPSPHEEKSHALN
FT                   KPIYRAQGFRELHGSDVASEIGSGIERHELDASPIYADKKY"
FT   CDS_pept        1263304..1263933
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948820"
FT                   /orf_name="Pc16g05410"
FT                   /product="Pc16g05410 protein"
FT                   /protein_id="CAP93211.1"
FT                   /db_xref="UniParc:UPI0001831CE2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H880"
FT                   /transl_table=1
FT                   /translation="MSAIPCVRSARSSSLLRLGGLQSHHINRPSIQRLHPVSRSLHSMS
FT                   SSNKVRTSPISCQKPLSLRVSILKPTARTYAGQKGSTGKAEADLLVEELQELYEVAKDE
FT                   FEIATESTDSSTIYAASDRESARDALNQLSTVYGLYTARPGEVENETDELSSQVEDSGE
FT                   SDIVETQYNPAEIPQGVKDEVRRRVGHRIRELKNAVEALEERATED"
FT   CDS_pept        join(complement(1266238..1266507),
FT                   complement(1265157..1266150),complement(1264943..1265083),
FT                   complement(1264811..1264887),complement(1264728..1264755),
FT                   complement(1264615..1264677),complement(1264455..1264561))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208039" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977843"
FT                   /orf_name="Pc16g05420"
FT                   /product="Pc16g05420 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP93212.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831CE3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H881"
FT                   /transl_table=1
FT                   /translation="MVSQTQQGDFCLECNWEAFHIDGKTAVDPSGNALQHHLNCSSHET
FT                   QSALPHCEVDEACCDVDDCAIDCGSICGDFTGCDTPTVCSITHCEDNHCESIDPLCFEN
FT                   HCCEGTASQDCGFDALFGLNTPLSLDTGVFPSMAMGNHSVGQATKAIQHQVPGLVDPFQ
FT                   QENFLSSYQTHATHCEQDVSNHFECHDFQKDWQSMFAPPVPTQAEVNPAEVFHMLGMCS
FT                   DFSVCQDQHVPAPQNDLNTFEKPKIDTSNTFNCFHPEHHHVHSHFKNPNDFNLQATRKG
FT                   PHRNHHRCRAHTHAHTHPYSPYSRQSRSSISSHLLSSPGETPPPLEGDTSSVLTTPDFS
FT                   PDDSKLHICKWATEIHGIKAACGATFADCGSLQEHLVATHMNTVNGAKGNGYYCCWEGC
FT                   HRPDEPFSQKSKLQGHFLTHSNYKNFSCSVCGKAFARQATLDRHERSHRGDKPYTCKHC
FT                   GKSFTDSSELKTHSRTHTGEKPFKCTWPGCNFTTGDSSNMSSHRLTHGERRHKCHFPGC
FT                   TKSFTRPDQLKRHQRTTHKQEFSPSLPSPSSDHFTMTPFTLV"
FT   CDS_pept        join(1267752..1267973,1268039..1268197)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948821"
FT                   /orf_name="Pc16g05430"
FT                   /product="Putative uncharacterized protein Pc16g05430 "
FT                   /protein_id="CAP93213.1"
FT                   /db_xref="UniParc:UPI0001831CE4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H882"
FT                   /transl_table=1
FT                   /translation="MGNICSRSSNQGDPFNQPGRVVGTSSGGTAAPRAPLPAKTNWKAT
FT                   PGRTLGESTADGSTGGTDEARANAAIAAQKRAESASANKGKLGSKLAAQKAQTQAQTLD
FT                   QVSRTERAARDVDGVEAARRWE"
FT   CDS_pept        join(complement(1272095..1272238),
FT                   complement(1271719..1272027),complement(1268901..1271661),
FT                   complement(1268562..1268836))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000007229" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948822"
FT                   /orf_name="Pc16g05440"
FT                   /product="Pc16g05440 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP93214.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001831CE5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H883"
FT                   /transl_table=1
FT                   /translation="MARHGDTRSPSPVGSTYSSSRRPRREDDRYDRTRRDDGRSYRRSR
FT                   SPERRYRGRERPRDRDAYRRRDLPIDRRDEDTYRPARRDRSRERRRDDDHDFRRRSRDR
FT                   DYRSRRDDSRDRDRRRIDDSADLKLKSRRDDSRDRAASRRSRSRTREPSKPSTPVPTAQ
FT                   TDEEKKAERLAKLEAWKQKQAAEREKKQKEQASVDPKNILEAIDRKSSVSPAPAAFPGK
FT                   SKFDPKAIVKSSTSTAAAPAVLGTDVAVPTSAKAASVTKPTLASAPPATLSGPLKAKGN
FT                   VSGFGLGAKQVPETEKPSASKPLGFGDGDEGSTRKKLEKLPTTPLDVSAPVEDTGDDDD
FT                   VDMQVEGTEEHAAAEARAATERRDTRLQNHNDDVHMEESTNVQADSTPMEVDDAEEVDP
FT                   LDAFMAGLQDSTPPERTTGATFAKKKTNQQPEAMFGDDEDVDVTAVGDEKAEDVLALAA
FT                   IKKKKREMPDIDHTKIEYEPFRKEFYTEPSHLAEMTEEEVASLRLELDGIKVRGHDVPK
FT                   PVQKWSQCGLGVQTLDVVHKLGWESLTSIQAQAIPTIMSGRDVIGVAKTGSGKTGAFLV
FT                   PMFRHIKDQRPLASTDGPISMILAPTRELATQIHKDCKPFLRALGLRAVCAYGGAPIKD
FT                   QIAELKRGAEIIVCTAGRLIDLLAANQGRVLNLRRITYVVLDEGDRMFDMGFGPQVVKI
FT                   MASIRPDRQTVLFSATFPKSMEALARKTLNDPVEITVGGKSVVAREITQIVEVRNNDQK
FT                   FFRLLELLGNLYEDDANEDYRTLIFVDRQEAADDLLKQLMYKGYPCMSIHGGKDQIDRD
FT                   STIQEFKAGVFPILVATSVAARGLDVKQLKLVVNYDAPNHLEDYVHRAGRTGRAGNTGT
FT                   AVTFVTEEQDRYALDIAKALKQSGQEVPEPLQKLVDGFNEKVKAGKEKNFSRHGFGGKG
FT                   LDRLNMERETARLRERKAYKTGDEDEEEDKLETEQESDDRFNKALSAVRSAAAPAVAPA
FT                   APSASMPGVPKGVDLDGKIVVHRTERAPAGASKNPLDKVGSAVADIHARLSRAGVMRSG
FT                   VPIDNRGPDAGAFHATLEINDFPQKARWAVTNRTNVAKILEASGTSITTKGNFYAAGKE
FT                   PGPGELPKLYILVEGETEISVTTAIHELRRLLKDATLAASEGEARAPVGGRYNVL"
FT   CDS_pept        join(1272646..1273149,1273211..1273510,1273572..1273709)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128969"
FT                   /orf_name="Pc16g05450"
FT                   /product="Pc16g05450 protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93215.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI0001831CE6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H884"
FT                   /transl_table=1
FT                   /translation="MPWLSAARGGFLRTLHRGALSPRTGVSDLQHQLRRVSLTAGSDLA
FT                   RPQVQLLSSTQSMVHSNSFATASTPLKASETPKAKSSKKAGKPKKKPLSETQKEIERIR
FT                   KHRAHIRDLKATALVSGRPKRLPNNAFAIAMSEILPHVKGCSSHKEAFLVAIERAKAIS
FT                   PQDKERLQAQAKANYAANTAAYNSWVQSHTPLQIREANSARLTLSRLENKSYPPLKDDR
FT                   LVTVSRSAYTLYLKERMETEYQGKAGVESFPAIGREWLALPQAEKDRYRKLQIEDRRRY
FT                   ERECQEVYGIPAPESSHYQSPEDYLFQEEPET"
FT   CDS_pept        join(1275344..1276255,1276308..1276596,1276822..1277685,
FT                   1277803..1279257,1279315..1279458,1279560..1280848)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(1281434..1281485,1281650..1282215)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948823"
FT                   /orf_name="Pc16g05470"
FT                   /product="Putative uncharacterized protein Pc16g05470 "
FT                   /protein_id="CAP93217.1"
FT                   /db_xref="UniParc:UPI0001831CE7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H885"
FT                   /transl_table=1
FT                   /translation="MNKRSNPMLRSEECSLIHPTSQRHDHIPYMHSITSQLTNPVHQIN
FT                   LQVILREDHKPCQAQTSAPEVHLKTINYTPLTPSTMSVPAAVTDYQKERTNFLSWLEDQ
FT                   ARLIRLQPKSDTISEVKVNLRERSGEYLDRLTEASILMACETSDNIYVTVKPKWFYNDM
FT                   VPKICGLLQIRIPQIAMRLGINPKCDMCVHYIIMNIVAEPGF"
FT   CDS_pept        join(complement(1284625..1284965),
FT                   complement(1284048..1284467),complement(1283060..1283860),
FT                   complement(1282605..1282995))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234567" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128970"
FT                   /orf_name="Pc16g05480"
FT                   /product="Pc16g05480 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAP93218.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI0001831CE8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H886"
FT                   /transl_table=1
FT                   /translation="MPIETRTRSLELADPALLEKIDKLFACNMGEYVSLPQLVVVGDQS
FT                   CGKSSVLEALTKINFPRDSGLCTRFATHIIFRRDTNLVLREVSASIIPASDANPEEDQK
FT                   LRGWKASDLHVLQLEIRGPNESHLSVIDVPGIFNNTTSDRTTKNDIALVRNMVLSYMQN
FT                   QRSIMLAVVPANADIATQEIIEMASEIDPEEGRTLRILTKPDLVDKGAEHKVIQLIHDG
FT                   NANGQLGWILVRNLGQKQLQAGNVDRDTEERMLKDSKDLLQSLGAQRETPEQQRRILLD
FT                   IVSAFQEITRHALAANYGVNCVFDEDKDLRLATLVSLRNDVFSNDLAHWGHTYTFRSKP
FT                   ERPEDTDGSVDDREERRNNPSDTEKQQGTLQSRKNWDTTQNMSVADLEESLHVSEPVEP
FT                   PFERGILSWIEEVYSNSRGFEIGKFNPTLLSILMRKQSVKWPILARGYISDIISVVHAF
FT                   IRQALEVVSKNTQISTKIMSLLMDDLVEKYKQAISKVEFLLRIERDGTPLTLNHYFNDN
FT                   LEKCRQKRMYSTAAKNSIDNCKHGEVVRLSDLAHQHHMSNIEHTVRDIHDILDSYYKVA
FT                   RKRFLDTVCMQAADYCLVTGPEAPMKLFSPSWVNDLSNERLEEIVGEGRALKRRRRQLQ
FT                   KEIEDLEAGKAVLMK"
FT   CDS_pept        join(complement(1285554..1286157),
FT                   complement(1285469..1285494))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671915"
FT                   /orf_name="Pc16g05490"
FT                   /product="Putative uncharacterized protein Pc16g05490 "
FT                   /protein_id="CAP93219.1"
FT                   /db_xref="UniParc:UPI0001831CE9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H887"
FT                   /transl_table=1
FT                   /translation="MADRKKSNRAGQAPIVPTSNGFTTERAVGGERRSIRHYHDGRVSQ
FT                   REPPMPSAVRTLAKVVSRKSSSRTLSNTKSVPKPKGEEYRSPTLAEIEKLSGDVANLFQ
FT                   EEGSKPVEKLPENTETPETETPETETPATETPATETPETWSCGSSYGMISPPLPAVSPM
FT                   PEDSPELMSTEVFPLPVTSNPDSSDEDADTISRQWADLDRELPVTN"
FT   CDS_pept        <1287280..>1287531
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(1289733..1289869),
FT                   complement(1289221..1289628),complement(1288646..1288930),
FT                   complement(1288152..1288611))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671916"
FT                   /orf_name="Pc16g05510"
FT                   /product="Putative uncharacterized protein Pc16g05510 "
FT                   /protein_id="CAP93221.1"
FT                   /db_xref="UniParc:UPI0001831CEA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H888"
FT                   /transl_table=1
FT                   /translation="MKSYTAGFWLQSLNEGESESQGFTDHSSIRKVTGIERWFHLPPFQ
FT                   RDYSEAKGVNQTDSRSIHEKKTMYKRARLSFTRRLLVTSTAKKCELGAGGLHSTSIRVS
FT                   RAERWEYSKYQATLRPLTKSSLIAITFCFRHSQDHGVSEPHCEYQARGELDDSRVWLST
FT                   SHDAQSSQWKPNHDSATPSATLDDGCGNCVGHHDDRQEKRNTKVRSREIILIFDFVDSR
FT                   EVRRGEKRRTEEQTAFDLENSQLEEAAVVETTIVLEPSRKARGERQNEISLLQQSDLSQ
FT                   EPNISLVSQCLEDRYTSNSRVLSFHDSRLCESDLLLVQINVESPALTECTATQDASNRG
FT                   TTKVQKKYPSNIALKKKTRVHLNPLASAKQGKVEVNNDIDPWCRQRSHAEPLKSRRERW
FT                   RVTARQLRHFMTASLIIALGAIRVQTPFLD"
FT   CDS_pept        join(complement(1290712..1291545),
FT                   complement(1290526..1290648))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824623"
FT                   /orf_name="Pc16g05520"
FT                   /product="Pc16g05520 protein"
FT                   /protein_id="CAP93222.1"
FT                   /db_xref="UniParc:UPI0001831CEB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H889"
FT                   /transl_table=1
FT                   /translation="MSRSRNTLLRLLHSFGKKVPKYPAILCLDERILQKIYQHLSLVDQ
FT                   VCLSLSCKELYGLFGTIVKHKDLEFPRLLRIRNPILCVNSQDVPRNQLFLRLENRRWAY
FT                   CARCLKLHPRKEFTRHFPRKSPLERPCTYYSGIADLCPCISLTIRGREQLIKIIKQPAK
FT                   PAKTRYGPFVYDFDDRGQPGLGHVCEFSTRSGYVVRVALVLVITETGQLCAAARHTIRF
FT                   SFPGAHFTAEPTFACPHEELLHLVPGNQAVENPHMYQALMASKPHRDILPFVPGRLNLA
FT                   AFWVVRNLGSCKWPADCPWIDQCRLTGIFFKHYDTYW"
FT   CDS_pept        complement(1292318..1292734)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948824"
FT                   /orf_name="Pc16g05530"
FT                   /product="Putative uncharacterized protein Pc16g05530 "
FT                   /protein_id="CAP93223.1"
FT                   /db_xref="UniParc:UPI0001831CEC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H890"
FT                   /transl_table=1
FT                   /translation="MEVAWISLIVSIVSLVVAVANLLLPVKEWLRYCFHRRWPPPERND
FT                   ARRPAGIRLDDVVHTESTCSLAREHTSMTRRIEMLEAAIVLAGVNQTLGPPTPSGSVGD
FT                   RADQHSGELRKSRASKGAGHDGQVDSSSKARSLG"
FT   mat_peptide     complement(1292321..1292674)
FT                   /db_xref="UniProtKB/TrEMBL:B6H890 "
FT   sig_peptide     complement(1292675..1292734)
FT                   /db_xref="UniProtKB/TrEMBL:B6H890 "
FT   CDS_pept        join(complement(1293769..1293994),
FT                   complement(1293374..1293699))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824624"
FT                   /orf_name="Pc16g05540"
FT                   /product="Putative uncharacterized protein Pc16g05540 "
FT                   /protein_id="CAP93224.1"
FT                   /db_xref="UniParc:UPI0001831CED"
FT                   /db_xref="UniProtKB/TrEMBL:B6H891"
FT                   /transl_table=1
FT                   /translation="MPKPSRLQDLKIPINTDENWDADDEDCGSDTTLDSFDSVPLSLAL
FT                   GSKDDGKGPFDKSLFHFSVNREETNLLGAPGTDLEWTATFEQWRPQWNKIQVQAKRFGY
FT                   TQFSSEIAPAPVDLALVRFVGFGHDQEHREFEIEQEGQDSIADCQDIWTLWRYIIETPA
FT                   NQIREFHVCLRDTARLVGLQ"
FT   CDS_pept        join(complement(1295701..1295730),
FT                   complement(1295421..1295610),complement(1295307..1295349),
FT                   complement(1294729..1295231),complement(1294448..1294695))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000038810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948825"
FT                   /orf_name="Pc16g05550"
FT                   /product="Pc16g05550 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93225.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0001831CEE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H892"
FT                   /transl_table=1
FT                   /translation="MYNTPSDIWVAGAFAAVAVDFIVYPFDTLKTRVQSPDYEKVFKDA
FT                   RTGAVRRDLLFRGLYQGVWSVVFSTIPASGAFFTTYEAVKSIILRLPFTHSLPTPIMHG
FT                   IASSTGEMVSCLMITPAEVLKQNAQMIQGSQTNTSAMRQVLSRFRRHPWRLWSGYTALV
FT                   GRNLPTTALQFPLFEYVRSHLINRRRQRKANRSNTGRPPSEQSDQLVERAGLTGIAAAI
FT                   SGTVAATVTTPIDVIKTRVMLSAGEAGASSQDPISSGARTKTKSLISVGRNIVQYEGIR
FT                   GLFKGGLIRAGWTAIALGLYLSLYEGGRFYLENRRKERDLLNGKLRRPTDEGVEGL"
FT   CDS_pept        complement(1296079..1297401)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000249874" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948826"
FT                   /orf_name="Pc16g05560"
FT                   /product="Pc16g05560 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93226.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR015904"
FT                   /db_xref="UniParc:UPI0001831CEF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H893"
FT                   /transl_table=1
FT                   /translation="MFQRRTVVAAKRSVAQWRSLATASPVSSARNHKIVVVGGGTAGLS
FT                   ISHQLLHSGKFAQDDIAVVDPAAWHNYQPGWTLVGGGLKDKQELRKPLNTLIDPKFKFY
FT                   NEGVGAFAPTENALTLENGDKINYEHLVVVPGINLNFGAIKGLSEALADR