(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE1

PENCW_13.PE1         Location/Qualifiers
FT   CDS_pept        join(complement(1486..1629),complement(983..1384))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823842"
FT                   /orf_name="Pc16g00010"
FT                   /product="Putative uncharacterized protein Pc16g00010 "
FT                   /protein_id="CAP92671.1"
FT                   /db_xref="UniParc:UPI0001831CCB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R5"
FT                   /transl_table=1
FT                   /translation="MSLSFSKKWPTLYGDFAVHGPPPYKNCPPEQFLATSTAFCIFTPQ
FT                   MGSCWGGSPTAVVSSGTQQRLIPPMTSSPRSALGPLGGHSAPGLVVMGALAELLPGASA
FT                   VVTEARGPFGARHRWSLWIDGRWPYPKPRFLEGAAPWDPPFAGVVHGVWTLHPRATCRS
FT                   LPAPSRAPGPDPLRADWC"
     atgtcactca gcttttcgaa aaagtggccc actttgtatg gtgattttgc cgtgcacggt        60
     ccacccccat acaaaaattg tcccccggag caatttctag ccacttctac tgcattctgc       120
     atttttacac cccaaatggg gtcgtgctgg gggggttcac ccaccgcagt ggtgtcatcc       180
     gggacccagc aacgcctgat cccccccatg acctcctccc cgcgcagtgc cttgggtccc       240
     ctcgggggcc actcggcgcc cggcctggtt gttatggggg ctctcgccga gctcctccct       300
     ggtgcctccg ctgtggtgac tgaagcccgg gggccttttg gcgcccggca ccgttggagt       360
     ctgtggatcg atggccgctg gccatacccg aaacccagat tcctggaggg agccgccccg       420
     tgggatccgc cgttcgccgg cgttgtccac ggggtctgga cccttcatcc gagggccaca       480
     tgccgcagcc tgccagcgcc ttcacgggcg cctggtccgg atcccctgcg tgcggactgg       540
     tgctga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page