(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE10

PENCW_13.PE10        Location/Qualifiers
FT   CDS_pept        join(complement(25105..25931),complement(24640..25048))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217399" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671084"
FT                   /orf_name="Pc16g00100"
FT                   /product="Pc16g00100 protein"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92680.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI0001831CD0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R8"
FT                   /transl_table=1
FT                   /translation="MTSTISSLFGYKPDDYGAPKAPAEPVKALPASWYRSPEIYELERR
FT                   AIFSKKWILITHKLRFEKPGDFYRFEMTGFSFVLCLNRQGNLSGFHNICRHRAFPLVSQ
FT                   DQGNSPVVSCKYHGWSYGLDGKLTKAPKDDDVPGFKKEEQSLFPVHIHVDALGFVWVNL
FT                   DSSRTPIPWEDDFQGVDTQERFREFDFGRYMFDHTWHMNGNYNWKTLADNYNECYHCSV
FT                   AHPDVAKLADLSYYYTVSKAGHIQHFSRPKQDKVKDDIKNASTYYFPNACMTVSPHFFY
FT                   LMRCVPTSVGTCSMEYEVYRNKEASDEDFEYIDSFFKRVLNEDKHLCNAAQKNLDAGVF
FT                   VNGQLHPDLESAPLFFQNTVRGLLRNHRDEEKRQNMELWPARQSSPGSATAEDINFCAE
FT                   LTCSGKYGDLEW"
     atgacttcaa caatctcatc gctgtttggt tacaaaccag atgactacgg agcaccaaag        60
     gccccagcag aacccgtcaa agctctcccg gcttcttggt accgttcgcc agagatatat       120
     gagttagaga ggagggctat cttctcgaag aaatggattt tgattactca caaattgcgt       180
     ttcgaaaagc caggagactt ctatcgcttt gagatgactg gattttcatt tgtgctttgc       240
     ctaaaccgcc aggggaactt gagcggcttc cacaacatat gccggcatcg tgcatttccc       300
     cttgtctccc aagatcaggg caattccccg gtcgtttctt gcaagtatca cggatggtca       360
     tatgggctcg atggaaaatt gaccaaagcg cccaaagatg acgacgtgcc aggattcaag       420
     aaagaggaac agagcctatt cccagttcat attcatgttg acgcactagg ttttgtctgg       480
     gttaatctcg actcctcccg aacaccaatc ccttgggaag acgatttcca aggtgtcgac       540
     acacaagaaa gattcaggga atttgatttc ggccggtata tgttcgacca cacatggcac       600
     atgaatggga attacaactg gaaaaccttg gcagacaact acaatgaatg ttatcattgc       660
     tctgtggctc acccggacgt ggcaaagctg gccgacctgt catactacta caccgtctcg       720
     aaagctggac acatccagca tttctcccgt ccgaagcaag acaaagtgaa agatgacatc       780
     aaaaatgcca gcacgtatta tttccccaat gcttgcatga cagtctcacc gcactttttc       840
     tatctgatgc gatgcgttcc aacttcggtg gggacttgct ccatggaata tgaggtctat       900
     cggaataagg aagcatctga tgaagacttc gagtacattg attcattttt caagcgtgtt       960
     ttaaacgaag acaaacatct ttgcaatgca gctcaaaaga acctagatgc tggagtattt      1020
     gtcaatgggc aactccatcc agaccttgag agcgctcctt tattcttcca aaacaccgtg      1080
     aggggccttc tcaggaacca tcgagacgag gaaaagcgcc agaacatgga actctggcca      1140
     gctcgccaga gctccccggg ctcagccact gccgaggata ttaatttttg tgcggaacta      1200
     acatgtagtg ggaaatacgg tgatcttgaa tggtag                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page