(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE100

PENCW_13.PE100       Location/Qualifiers
FT   CDS_pept        join(227898..227942,228073..228194,228252..228277,
FT                   228319..228375,228412..228455,228591..228716,
FT                   228844..228869,229059..229122,229168..229179,
FT                   229657..229696,229817..229959,229994..230056)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977301"
FT                   /orf_name="Pc16g01000"
FT                   /product="Putative uncharacterized protein Pc16g01000 "
FT                   /protein_id="CAP92770.1"
FT                   /db_xref="UniParc:UPI00018313F3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H702"
FT                   /transl_table=1
FT                   /translation="MDSYCRLCPPLITTLLVGVEWKNVLQHGDVLSSTYNRNGAKEKRG
FT                   AIIQDRQRVELIPVRPRSHIITRTSQKVLELARTVIIQSYRFTSSKTGGGPPSLSIPSL
FT                   ESVHSLVSGPSAPTIRDLHVCGLLSRVPGQFGFTDPRFSMLFFIFESPTLDQEQANYLA
FT                   EYYLPTSLLPWAGRHSPGELPILEVRDLEGLKWPHRITYSASYGTSSFGTDSHPHYNYE
FT                   IEYHQPTRDKQLEEGTMAITTLDFCGSYGSSSA"
     atggactctt attgccgtct gtgtccccct ctcatcacta cattgctcgt tggcgttgag        60
     tggaagaatg tgttgcaaca tggagatgtc ctctcatcta cttataaccg aaacggtgca       120
     aaggaaaagc gaggggcaat aatccaagac cgccaacgtg ttgagctaat acccgttcga       180
     ccacgcagtc atatcattac taggacgtcc caaaaagtgc tagaacttgc ccgtactgtg       240
     atcatacagt cttaccggtt tacttctagt aagacgggag gggggccacc ctccctgtcg       300
     attccctctt tggaatccgt tcattctcta gtgtccggac cttctgctcc aactatccga       360
     gacttgcacg tgtgcggttt gttgtcccga gtccccgggc aattcggatt cactgatcct       420
     cgcttctcca tgttgttttt catatttgaa agcccaacct tggaccagga acaggctaac       480
     tacctagcag aatactacct acctacctcg ttactaccat gggcgggccg acactctccc       540
     ggtgaactgc caatcttgga agttcgtgac ttagaaggac taaagtggcc tcaccgtata       600
     acatactccg cttcgtacgg cacttcgtct ttcggcacag attcccatcc ccactataat       660
     tacgagatcg agtaccatca acctaccaga gacaagcaat tggaggaagg aaccatggcg       720
     atcactacgc tagatttctg tggttcgtac ggctcttcat ctgcatga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page