(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE101

PENCW_13.PE101       Location/Qualifiers
FT   CDS_pept        join(230820..231078,231170..231551,231603..232521,
FT                   232582..233070)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824070"
FT                   /orf_name="Pc16g01010"
FT                   /product="Pc16g01010 protein"
FT                   /protein_id="CAP92771.1"
FT                   /db_xref="UniParc:UPI00018313F4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H703"
FT                   /transl_table=1
FT                   /translation="MAEENPRKSIVEDVFIPKELLTTAKFNSPWELARWEQSLPDNDRI
FT                   ISLPEPRTSSNRPLSLSALRSVARPKSAIRSRGRSDPPAFQGTFDYFEKPATFEPPSPI
FT                   PEKGQVTPVQNALLSPQPLSKTSSQTISSEQSHLQEVYEKAKLRGVAIQRKHWVRLLFE
FT                   YSIYALLVLFVYFVLVGMPLWKGAVWWLYWVVRTKFVITGGYAIIIGLAALYAFCPLLI
FT                   LFEKDPPAPDSESESESPDLENNISKVKSTALLIPCYKSASIVGATLEAALKIFPKENI
FT                   FVIANGNSKTPLDNTEEVCKPYGVNHLWVPIGSKIVAQFVGCYAAKDFENAVLIDDDCL
FT                   LPPNFPIVSDRLKKNVKCIGYTIKSVGPNSSKGTFCQQAQDLEYKMSGLQRDFFGKFGS
FT                   ATFPHGAISLWNIEFLKQTFHEHPGFSVSEDWFFGDACRRLGGRITMCSQVFVETETPA
FT                   SVFWSGSGGSRGGFGEMTIFQQRFKRWNFFFVVGVYYDLKYILTSWKLGWWEFGAKLCV
FT                   FQEVYETLIYLFAPFILPISFIVRPSFCGMLLGVTIAMYILNVIIFNEIHLRLKKERVD
FT                   WKVLLFYYTFYKIALTVVNVFSCYWSLYKYARYFAQRHPKVIEDRDAVEVILSLEKESI
FT                   SRRTSVEDDVIPLDGALGRGVGRKLTLTKVQTGKRKMTEESEKGGWV"
     atggctgaag aaaaccctag aaagtccatc gtggaagatg tcttcatccc caaggaacta        60
     cttacgactg ccaaattcaa ctcgccatgg gaattggctc gatgggaaca gtctctcccc       120
     gataacgacc gtataatatc acttccagag cctcgcacct cttccaaccg tcctctgagt       180
     ctttctgctc tgcgatcagt ggcaagaccg aagtctgcaa ttcgatcccg tggacgcagt       240
     gatcctcctg cttttcaggg tacattcgac tactttgaaa agcccgccac attcgagccc       300
     ccctctccaa tccccgagaa aggacaagta acaccggttc agaatgcatt gctcagtcct       360
     caaccgctca gtaagaccag ctctcagact atcagcagcg agcagagcca cctgcaagaa       420
     gtctacgaaa aagccaaact gagaggcgtg gctatccaac gaaagcattg ggtgcggtta       480
     ttatttgaat acagcatcta tgcgctcctc gtgctgtttg tctacttcgt cctcgtcggt       540
     atgccattat ggaaaggtgc cgtctggtgg ctgtattggg ttgttcggac caagttcgtt       600
     atcacaggag gatacgcaat tatcattggt ctggctgcat tatatgcctt ctgtcctctg       660
     ttgatcctct tcgagaaaga tcctccagcc ccggactctg aatctgaatc tgaatctcca       720
     gacctggaaa acaacatctc caaggtaaaa tcaactgctc tcctcatccc ctgttataaa       780
     tcagcatcaa tcgtcggcgc aaccctcgaa gccgccttga aaatcttccc caaagaaaac       840
     atcttcgtca tagcaaatgg caactccaaa acccccctcg acaacacaga agaagtctgc       900
     aaaccctacg gtgtaaacca cctttgggta cccatcggct cgaagatcgt ggcgcagttc       960
     gtcggctgct acgcagccaa agactttgaa aatgccgttc taatcgatga tgactgtctc      1020
     ctgcctccga acttcccaat tgtcagcgac agactcaaaa agaacgtcaa atgcatcggg      1080
     tacacaatta aaagtgtcgg ccccaattcc tcaaagggga cattctgcca acaggcccag      1140
     gacctcgagt acaaaatgtc cggtctccag cgtgatttct tcgggaaatt cggaagcgct      1200
     accttccccc acggagctat ctcgctctgg aatatcgagt tcctaaaaca gacattccat      1260
     gaacatcccg gtttctccgt gtcggaggat tggttcttcg gtgatgcatg ccgacgtctg      1320
     ggtggacgca ttactatgtg ctcgcaggtc tttgtcgaaa ccgagacccc ggcttcggtg      1380
     ttctggagtg gttctggtgg tagccgtggt gggttcggcg aaatgaccat cttccaacag      1440
     cggtttaagc ggtggaattt cttcttcgtt gttggcgtgt actacgactt gaagtatatc      1500
     ttgactagct ggaagctggg ttggtgggag tttggtgcga agttgtgtgt ttttcaagag      1560
     gtctacgaaa ctctcatcta ccttttcgcc cccttcatcc tcccaatctc attcatagtc      1620
     cgcccctcgt tctgtggaat gctactcggc gtcactatcg cgatgtacat cctcaacgtg      1680
     atcatcttca acgagatcca cctccgatta aagaaagagc gcgtcgactg gaaagtcctg      1740
     ttgttctact acactttcta caagatcgca ctgacggtcg tcaacgtgtt cagctgctac      1800
     tggtcgctgt ataagtatgc gcggtacttt gcgcagcggc atccaaaggt catcgaggac      1860
     cgggatgcag ttgaggtgat cctcagtctt gaaaaggagt cgatttcgag gaggacatca      1920
     gttgaggatg atgttattcc gcttgatggt gctctgggga gaggcgttgg aaggaagttg      1980
     acgcttacaa aggttcagac tggcaagagg aagatgacag aggagtctga gaagggtggc      2040
     tgggtttga                                                              2049
//

If you have problems or comments...

PBIL Back to PBIL home page