(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE102

PENCW_13.PE102       Location/Qualifiers
FT   CDS_pept        join(234899..234943,235350..236765)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076652" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128403"
FT                   /orf_name="Pc16g01020"
FT                   /product="Pc16g01020 protein"
FT                   /protein_id="CAP92772.1"
FT                   /db_xref="UniParc:UPI00018313F5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H704"
FT                   /transl_table=1
FT                   /translation="MSEDFESLPPAVRRKFFSNVERLRIRLAQSDHGSPTCSTSNYQTD
FT                   NRVYRAPRLGDYHSRGLRTGSRKRGLEKRSSPSKKLRKPGSLQLAYLAAQADSQCFHSL
FT                   PAKIQQKLFSPEERRRLRNAYRQSLIYDAADEAYRRDSGRDSRKSRPSIDTHPSQTIVP
FT                   VVQPSTAFYSDSDSDDEDPNMDQTFHDSFRWLDEDGDLDLSLDEYHAHVADAATKKRTR
FT                   PSFRRSLSFSNHLRKTLEITPTSTRGLPPVSQSQPLTPLSNRTSESRPSSNHRFQHGPK
FT                   SSTSSIDPCAQYYQDPDARLKLRVYLASPQKFDEAIEFGFPSLDQNNKENIGPEPTTPK
FT                   PSSPKFTLVDWDFGTFFEDDDGTMVGSPGGSVENEPIRSPVLTQRDAPRPSMESSALFQ
FT                   RRQSWLPGAKGVPQRLPGNREMTLKMTLTRPDLRTDSPTPPASSKEKEDPLRLAELPPA
FT                   DRSQSIWDSDLDERGVVRKMWRKLRRRV"
     atgtcggagg actttgaatc attgcctcca gcagtgagaa gaaagttctt ctcgaatgtc        60
     gagcgtttgc gcatccggct agctcagagc gatcacggtt cccctacctg ctccacgtca       120
     aactatcaga ccgataatcg ggtctatcga gcccctcgtc ttggggacta tcactcgcgt       180
     ggtttacgga ccggatcaag gaagcgaggg ctcgagaaac gttcttctcc ttccaagaaa       240
     ttacgcaaac ccggctctct tcaattggcc tacctggccg cccaggcgga ctctcaatgc       300
     ttccattctc tccccgctaa gatccaacaa aagcttttct cccccgaaga acgtagacgt       360
     ttgaggaacg cttatcgaca aagtctcatc tacgacgctg ccgacgaagc ttaccgtcga       420
     gattccggtc gagactcaag gaaatctcgc ccttccattg acactcatcc ctctcaaaca       480
     attgtgcctg ttgttcagcc ctcgaccgcc ttctattcag actccgactc agacgacgaa       540
     gacccgaaca tggatcaaac attccatgac agcttccgtt ggctcgatga ggatggcgat       600
     cttgacttgt ctctcgatga ataccacgct catgtggcgg acgctgccac gaaaaagaga       660
     acccgcccct ctttccgccg ctccttgtcc ttttccaacc accttcgcaa aacattagaa       720
     attacaccca cttcaactcg aggactcccg cctgtcagtc aatcgcaacc tctaacccct       780
     ctctccaacc ggacttctga atcgcgccca tcatccaacc accgattcca acatggcccc       840
     aaatcttcca cctcgagcat cgacccctgc gcacaatact accaagaccc cgacgcccga       900
     ttgaaattgc gcgtgtacct ggcatcccca caaaaattcg acgaagcaat tgaattcgga       960
     tttccctcgc tggatcaaaa caataaggag aatatcggcc cagaacccac cacaccaaaa      1020
     ccaagctcgc caaaattcac cctggtcgac tgggactttg gcacattctt cgaagatgac      1080
     gatggcacca tggtggggag cccaggagga tcggtggaaa atgaaccaat ccgttcgccc      1140
     gtgctcacac agcgggacgc gccccgaccc tccatggaat catcagctct tttccagcga      1200
     cgccaatcct ggttgcctgg ggccaaggga gtcccacaac ggcttccggg aaaccgcgag      1260
     atgactctca aaatgaccct tactcggcct gatctccgca ccgactctcc cacacctcca      1320
     gcttcttcca aagaaaagga agatcccttg cgattggctg aacttccacc cgcggaccgc      1380
     agccagtcga tctgggactc ggacttggat gagcgaggtg tggtgaggaa gatgtggcgc      1440
     aagctccgac gccgagtttg a                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page