(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE103

PENCW_13.PE103       Location/Qualifiers
FT   CDS_pept        join(237423..241267,241326..241950)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169063" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946597"
FT                   /orf_name="Pc16g01030"
FT                   /product="Pc16g01030 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92773.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002860"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="UniParc:UPI00018313F6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H711"
FT                   /transl_table=1
FT                   /translation="MIPRWLLLTLSLLLVWASHPAAAKGNEPNIVTHELDAPPADLFYF
FT                   HGTNTILYRDRRSLTAHVSFDGGEEWETVKGNDGTIEGTVDLIWRHPFDDNRAYILGEN
FT                   GKHWITTDQAKSWRPFQVDVLPFASMRSFPLEFNGWDPKKVIFMGLDCTILGCLPQTFY
FT                   TTDDFETVKPLREMTLQCMWAASRPQFALDIDMPKSTGDRILCVVPGLKGPFEHTRTER
FT                   LIYSDSFFKDDAEGTEAKLDHGKPLSGVSLQIRSVSKYIVARLQSRGTQEQALYVSDDS
FT                   NVWHRAEFGKHRIEEDAYTILESTNYSIQIDVQTTWQDNRMGSLFSSNSNGTYFTQNIE
FT                   HTNEDLNGLVDFERVTGIHGITIVNTVKNWEEAKKSDSNKKKLISSISFDDGRTFQPLK
FT                   ADKDELHLHSMTTYAALHEMPLPDHRMFSSPAPGLVMGVGNTGGHLEDYSKGDLYVSDN
FT                   AGLTWRRALKGPHRYEFGDQGGVITAVLDSSQTDKVQFSIDHGKEWESISLGQKIRPLF
FT                   LVSTPDSTSLKFLLVGTSSDDTTKTLMFFIDFDGLHERECGSGDLEEWTARLNEKGEPD
FT                   CLMGQKQFFQRRKANADCFIKKEFAISGPEFQLCKCSAEDFECDYNFVRSEDRKECVPA
FT                   VPLTPPAGKCKDPSDKYMGPSGWRLIPGNACIREGGEDLEREIERSCSNVTGPPLITDG
FT                   KPRAGKPQTISAKWTNYFYLERQASNNGVDETIMMLTDKYELHVSRDHGRNWKQIHPDE
FT                   KFIEMVQHPYFSDTAFFLTDGKRVYYTINHGDSFHFFDAPSVPNKEYIRKLAFHEKFQD
FT                   SLIWIGHKDCEGKNCRSQAYVTDKRGASWEPMLIGIADGGCNFGYQEGRNNSEKLVICE
FT                   QYKDEEKNNNRQLVISDDYFSTMEVKFENIARSATKNGFEVVAWYEGDQKEYLNASVSV
FT                   DGRTYANAHFPFNIKVPQYTVLPSSPHALFLLVMVNGGGERSFGSLVKSNSNGTYFVQS
FT                   LEGLNVNDRGYTDYDELQGLEGVAIANVVSNREEVLNKGAAKKLRTMITHNDGGQWMLL
FT                   APPSKDVDGKNFDCSVTEGKGTEKCALHFHGYTERRDYRDTLYSGSAIGLMLALGNVGE
FT                   HLTSASEADTYLTRDGGISWTQVKKGQYMWEFGAAGSVIVLVSDRKATKVVHYTLDEGM
FT                   SWHEFQFAEKELVIDDISTVPSDTSKKFLLWGIDGGKRVIVTLDFSGIWSRDCNDDESD
FT                   YYNWAPTHPFQEENCIFGHVEEYHRKKPAAECWNAWREPHIHSIGRNCTCTRADFECDY
FT                   NYEIQTDGSCGLVPGLQPQDHVAQCSQDPDKVEYWEPTGYRRIPQTTCEGGLLLDQDVS
FT                   KPCPNKEEEYQKKHGISGTGLFFAIVTPIAVAVAVGWYAYTHWDGKFGQIRLGDSGGSQ
FT                   SWLSRDSMLVAVPVALIAGIVAVAQSLPLLVKSLARSSSGLFGRRGMQRPYATRGSFAA
FT                   RRGDYSSVVDDEDELLGADDFDDEEDQA"
     atgatcccac ggtggctgct gctcacactg agcctgctgc tggtatgggc ctcacatcca        60
     gcagcggcaa agggaaacga gccgaacatc gtgacccatg aactcgacgc tccgcccgca       120
     gacctgttct actttcacgg cacaaacacc atcctctacc gtgacaggag atcccttacc       180
     gcgcatgtct ccttcgatgg tggtgaggaa tgggagactg tcaagggcaa cgatggaacc       240
     atagaaggca ccgttgactt gatctggaga catccgttcg acgacaaccg cgcgtacatc       300
     ctcggtgaga atggcaagca ctggatcacg accgaccagg ccaagtcgtg gagaccattc       360
     caggtggacg tgttgccgtt cgcatccatg cgctcattcc cattggagtt caatggctgg       420
     gatccgaaga aggtcatctt catgggtctc gactgcacca tccttggctg cctaccccag       480
     acgttctata ccaccgacga cttcgagact gttaagccat tgcgcgagat gacgctccag       540
     tgtatgtggg ccgcgagccg tccgcagttc gcgttggaca tagacatgcc gaagtcgaca       600
     ggagaccgga tcctctgcgt ggtccctggg ttgaaagggc catttgagca tacccgcaca       660
     gagcgattga tatattcaga cagctttttc aaagatgatg ccgagggcac cgaggcgaaa       720
     ttggatcatg gaaaaccgct gagcggtgtc agtcttcaga tccgttctgt gtccaagtac       780
     atcgtggcgc gccttcagtc gcgtggtacg caggagcagg ctttgtacgt cagtgatgac       840
     tcgaatgtgt ggcaccgggc ggagtttggc aagcaccgca ttgaagagga tgcctatact       900
     attttggaaa gcaccaacta tagcatccag atcgacgtgc aaactacttg gcaggataac       960
     cggatgggca gtctcttctc gtccaactcc aatggcacct actttacgca aaatatcgag      1020
     catacgaacg aggacctgaa tggcttggtc gattttgaga gagtcacggg gattcatggt      1080
     atcacgatcg tcaacacggt caagaactgg gaagaagcta agaagtcgga ctcaaataaa      1140
     aagaagctta ttagcagtat cagttttgac gatgggagaa cattccaacc tctcaaggct      1200
     gataaagacg agctacatct ccattcgatg accacctacg ccgcgctgca cgagatgccc      1260
     ttgccggatc accggatgtt ctcaagcccg gctccgggct tggtcatggg tgttggtaac      1320
     accggaggtc atctcgagga ctattccaag ggtgatctct atgtttcaga caacgcgggt      1380
     cttacctggc ggcgcgcgct caagggcccc caccggtacg agtttggcga ccaaggaggt      1440
     gtgatcactg ctgttttgga tagcagccag acggacaagg tccaattttc tatcgaccac      1500
     gggaaagagt gggagtcgat ttctctgggg caaaagatca ggcctctgtt cctggtctca      1560
     acgccagatt cgactagcct caagttcctg ctcgttggca cttccagcga tgacaccacc      1620
     aaaaccctca tgtttttcat cgacttcgat ggcctgcacg agcgcgagtg tggctctgga      1680
     gaccttgaag agtggactgc ccgtttgaat gaaaagggcg agccggattg cctgatgggc      1740
     cagaaacagt tcttccaacg ccgcaaggca aacgcagatt gcttcatcaa gaaggagttt      1800
     gccatcagcg gcccggaatt ccaactctgc aagtgttccg ctgaagattt cgaatgcgac      1860
     tacaactttg ttcgcagcga ggaccgcaag gaatgtgtac cggctgtccc gctgacaccc      1920
     ccagctggca agtgcaagga tcccagtgat aagtacatgg gcccctcggg atggcgactc      1980
     atccccggca acgcatgcat ccgtgaaggt ggagaggatc tcgagcgcga gattgagcgc      2040
     tcctgctcga atgtcacggg gcctcccctc atcaccgatg gcaagcctcg tgcgggaaag      2100
     ccacagacca tctcggccaa gtggacaaat tacttctatc tcgaacgaca ggccagtaac      2160
     aacggcgttg atgagactat catgatgctc actgacaaat acgaactgca tgtctcgcgt      2220
     gaccatggcc ggaactggaa gcaaatccac ccggatgaga agtttatcga aatggttcag      2280
     catccttact tcagtgatac ggctttcttc ctcaccgacg gcaagagggt gtactacact      2340
     atcaaccacg gtgattcctt ccacttcttt gacgctccca gtgtgccgaa caaggagtac      2400
     atccgcaagc tcgctttcca tgagaagttc caggactccc ttatttggat tggccacaag      2460
     gactgtgagg ggaagaattg tcgctcgcag gcgtacgtca ccgacaagcg aggcgctagt      2520
     tgggagccga tgcttattgg aatcgccgac ggcggttgta acttcggata tcaggagggc      2580
     cgcaacaaca gcgaaaaact ggtgatttgc gagcagtata aagatgagga aaagaacaat      2640
     aaccggcagt tggttatcag tgatgattat ttctctacca tggaggtcaa attcgaaaac      2700
     atcgcccgtt ccgctaccaa gaacggtttc gaggtcgtcg cctggtacga aggggaccag      2760
     aaggaatacc tgaacgccag cgttagcgtc gacggccgca cttacgccaa cgcacacttc      2820
     cctttcaaca ttaaggtccc tcagtatacc gtcctaccta gctccccgca cgcattgttc      2880
     ctccttgtga tggtgaacgg gggaggcgaa cgtagcttcg gctcccttgt caagagtaac      2940
     agtaacggca cctacttcgt ccagagtctc gagggactca atgtcaacga ccgcggctac      3000
     acggactacg atgagttgca aggcctggag ggtgtggcca ttgccaatgt ggtttcgaat      3060
     cgggaagaag tgctgaacaa gggtgcggcc aagaagcttc ggactatgat cacccacaac      3120
     gacggtggtc agtggatgct tctggctcca ccgagtaaag atgtcgatgg caagaacttc      3180
     gactgctccg ttacggaggg caagggcacc gagaaatgcg ctctccattt ccacggctac      3240
     accgagcgcc gcgattaccg cgataccctc tactcgggct ctgccatcgg cctgatgctc      3300
     gcgctcggca acgtcggtga gcatctcacc agtgcatctg aagctgatac atacctcacc      3360
     agggatggcg gcatctcatg gacgcaagtc aagaagggac agtacatgtg ggaattcggc      3420
     gcggcaggct cggtaattgt gcttgttagc gaccggaagg caaccaaggt tgtacactac      3480
     acgctcgacg aaggtatgag ctggcacgag ttccagttcg ccgaaaagga actagtcatc      3540
     gacgatatct ccaccgtgcc atcggataca tcgaagaaat tcctgctctg gggtatagac      3600
     ggcggcaagc gtgtcattgt cacgctcgac ttcagcggta tctggagccg cgactgtaac      3660
     gacgatgaga gcgattacta taactgggcc cccactcatc ccttccagga agagaactgt      3720
     atcttcggcc atgttgaaga ataccaccgc aagaaacctg ctgctgagtg ctggaatgcc      3780
     tggcgcgagc cacacatcca cagcatcggg cggaattgca cctgtacccg tgctgatttc      3840
     gaatgtgact acaactatga aattcaaacc gacggcagct gtggcctcgt cccgggtctc      3900
     caacctcaag accacgtcgc acaatgcagt caggatcctg acaaggttga atactgggaa      3960
     ccaaccggct accgccgaat cccgcagaca acctgcgaag gcggcctcct cctagaccaa      4020
     gatgtgtcaa agccatgccc taacaaagaa gaagaatacc aaaagaagca cggtatcagc      4080
     ggaacaggcc tcttcttcgc gatcgtgact cctatcgccg ttgccgtcgc cgtcggctgg      4140
     tacgcgtaca cgcactggga cggcaaattc ggccagatcc gactgggcga tagcgggggc      4200
     tcgcagagct ggttgtccag ggactcgatg ctggtcgcgg tgcctgtggc gcttatcgcg      4260
     ggtattgttg cggttgcgca gtccctgccc ttacttgtta agagtctggc gcggagctcg      4320
     tctgggttgt tcgggagacg ggggatgcag agaccttatg ctacgcgggg ctcgtttgcg      4380
     gcgaggaggg gagattattc ttctgtggtt gatgatgagg atgagttgct tggagctgat      4440
     gattttgacg atgaagagga ccaggcttag                                       4470
//

If you have problems or comments...

PBIL Back to PBIL home page