(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE104

PENCW_13.PE104       Location/Qualifiers
FT   CDS_pept        join(complement(243017..243092),complement(242787..242920),
FT                   complement(242581..242666),complement(242314..242512))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000014707" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977302"
FT                   /orf_name="Pc16g01040"
FT                   /product="Pc16g01040 protein"
FT                   /function="cytidine deaminase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP92774.1"
FT                   /db_xref="GO:0004126"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI00018314D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H713"
FT                   /transl_table=1
FT                   /translation="MAHTITAQELTTLSTKAIDAKATAYCPYSKFRVGACILTASGEFI
FT                   TGANVENASYPVGTCAERVTIGAAIVAGHRDFKALAVATDIKPAASPCGMCRQFIREFT
FT                   SPSFPVYMYDGEGNHKVMTMEEVGFLSFFSFLFGYISVLYLVDSLLISPVAPRLFRPQP
FT                   S"
     atggctcaca caattacagc ccaggaactg acaactttgt ccaccaaggc cattgacgcc        60
     aaagcgactg cctactgccc atactccaaa ttccgtgtcg gagcatgcat cctcacagca       120
     tcgggcgagt tcatcaccgg cgctaacgtc gaaaatgcct cctatccagt cggaacgtgt       180
     gctgagcgtg tgaccattgg cgctgctatt gtcgccggcc acagagattt caaggctctg       240
     gctgtcgcga cggatatcaa gcccgctgcg tcgccttgtg ggatgtgtag acaatttatt       300
     cgcgagttca cctcgccttc tttcccggtg tacatgtacg acggggaggg aaatcataaa       360
     gtcatgacta tggaggaggt gggtttctta tcttttttct cctttctatt tggatatata       420
     tctgttctat atctcgtgga ttctctgctg ataagcccag ttgctccccg actctttcgg       480
     ccccagccat cttaa                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page