(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE105

PENCW_13.PE105       Location/Qualifiers
FT   CDS_pept        join(243613..243667,243720..244396)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182400" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977303"
FT                   /orf_name="Pc16g01050"
FT                   /product="Pc16g01050 protein"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP92775.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="UniParc:UPI00018314DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H714"
FT                   /transl_table=1
FT                   /translation="MFNLGVQVINGQKTFIPLENNPEVHTHLCKNLGVSPSLTFHDILS
FT                   TTPEMLSWIPRPVNALILLCDKPIYLAARSRVEHSIPEYLGSGADEPVLWMKQTIGHAC
FT                   GLMALLHVVTNLENGKYVLAGSELEKIVKRAVGLGPVERARLLYDSRFLEEAHMDAASE
FT                   GSSIVPLPQEECGFHFIAFVKKDGKVWELNGGMNGPLLRGELEGDLLGEEGLDMTVREF
FT                   LSAADTEVHRGMSIIAVNNTM"
     atgtttaatt taggcgtcca ggtcatcaac ggccaaaaga cctttatacc actagagaac        60
     aatccagagg tccatacgca tctatgtaag aacctcggag tatccccgag cctcacattc       120
     catgatatcc tctccactac cccagaaatg ctctcctgga tcccacgacc tgtaaacgcc       180
     ctcatcctcc tctgcgataa acccatctac ctcgccgccc ggtctcgtgt cgaacacagt       240
     atacccgagt atctcggcag cggggccgac gagcccgtgc tgtggatgaa gcagacgatc       300
     ggacatgcgt gtgggctgat ggcattactg catgtggtga ccaatttgga gaatgggaaa       360
     tatgtcctgg cgggatcaga gctggagaag attgtgaagc gggcggttgg gctggggccg       420
     gtggagaggg cgcggctctt gtatgattcg aggtttctgg aagaggcgca tatggatgcg       480
     gcgtcggagg ggtcctcgat tgtacctttg ccgcaggagg aatgtggatt tcattttatt       540
     gcttttgtta agaaagatgg gaaggtctgg gaattgaatg gagggatgaa cggtccatta       600
     ttgcgaggtg aattggaggg ggacttgttg ggagaggaag ggctggatat gacggtaagg       660
     gagtttttaa gtgctgccga cacggaagtt cataggggaa tgagtattat tgccgtgaat       720
     aatacgatgt ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page