(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE106

PENCW_13.PE106       Location/Qualifiers
FT   CDS_pept        join(244675..244911,244973..245623)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000035269" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824071"
FT                   /orf_name="Pc16g01060"
FT                   /product="Pc16g01060 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP92776.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018314DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H715"
FT                   /transl_table=1
FT                   /translation="MTSILVTGATGKQGGSLINNLLKKNASFKILAVTRDINSASAKEL
FT                   AQKSSSITLIQGNLDDPAAIFKNAERVWGVFSVQTTNPRNDDERRQGIALIDESIKQGV
FT                   KHFVYSSVDRGGEKSDRNPTAIPHFIFKHEIEKHLMEKAKGTDMQWTILRPVAFFENFT
FT                   PDYFGKVFTTAWQMTLKGKPLQLIATSDIGFFAARAFMNTGESKNRAFSLAGDELTFEQ
FT                   MSEIFKDLTGKNVPTTFRIPVWLMMAAVKDLGVMFRWFRDEGYGADVPAVKRLNPSLKT
FT                   FGDWLKEDSQFETL"
     atgacttcaa ttctcgtcac cggagccaca gggaaacaag gaggctccct aatcaacaac        60
     cttctgaaga aaaatgcttc tttcaagatc ctcgccgtga cccgcgacat caattccgct       120
     tcggcgaagg aacttgccca gaagtcttcc agtatcacat tgatccaagg caacctcgac       180
     gacccagcgg ccatcttcaa gaatgcagag cgagtttggg gtgtgttcag cgtgcaaacc       240
     accaatccta gaaacgacga tgagagacgc cagggaatcg ctctgataga cgagtctatc       300
     aaacaaggcg tcaagcactt tgtgtacagc tctgtcgacc gcggtggcga gaagtcagac       360
     cgaaacccaa ccgccatccc gcatttcatt ttcaaacatg agatcgagaa gcatctcatg       420
     gagaaagcaa aagggaccga tatgcaatgg acgattctcc gtcccgttgc cttcttcgag       480
     aacttcacgc cggattactt cgggaaggtg tttacaacgg catggcagat gacactgaag       540
     ggcaaacctc tgcaactgat agcgacgagt gacattgggt tcttcgctgc cagggcattt       600
     atgaataccg gggagtcgaa gaatcgtgcc ttctcacttg ctggggatga attgacgttt       660
     gaacagatgt cggagatttt caaggatttg actggcaaga atgtgccgac tactttcagg       720
     attccagttt ggttgatgat ggctgccgtc aaggatttgg gtgtcatgtt cagatggttt       780
     cgggatgagg gatatggtgc agatgttccg gctgtgaaaa ggttgaatcc cagcttgaag       840
     acattcgggg attggttgaa ggaggatagc caattcgaga cactatag                    888
//

If you have problems or comments...

PBIL Back to PBIL home page