(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE108

PENCW_13.PE108       Location/Qualifiers
FT   CDS_pept        join(complement(249327..249425),complement(248410..249270))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946599"
FT                   /orf_name="Pc16g01080"
FT                   /product="Pc16g01080 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92778.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00018314DD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H710"
FT                   /transl_table=1
FT                   /translation="MAAEHAIISEPMELPSLPPNQGLEAMKDIIFGSSAGMAGKLIEYP
FT                   FDTVKVRLQSQPEHLPLRYTGPLDCFRQSFRADGLRGLYRGISAPMTGAAVETSCLFFS
FT                   YRLIQDALRATVYPGVEHLPFVALIASGALSGSVTSLVLTPIELVKCRMQVPAESAGLK
FT                   PGPVAIVAGIFRHEGLAGFWRGQMGTLIRETGGSAAWFGGYEGVSSLFRKYNKSDPQFT
FT                   SDSLPIHQQMIAGATAGISYNFLFYPADTIKSRMQTVDISQLPVHAQQQTFWGETKALW
FT                   KQQGLKGMYRGCGITCARSAPSSAFIFTVYEGLRQYFG"
     atggcggcag agcatgcgat catcagtgaa ccgatggagc tgccatcgct cccgcccaat        60
     cagggccttg aggcgatgaa ggatatcata tttggatcgt cggcaggaat ggcaggcaaa       120
     ctcatcgagt acccctttga taccgtcaag gtccgactac agtcacaacc tgaacacctt       180
     cctctccgat atacgggacc actggattgt ttccgccagt ccttccgagc cgatggcctc       240
     cggggactat acagaggcat cagtgccccc atgaccggag ctgccgtgga gaccagctgt       300
     ctcttcttca gttatcgtct catccaggat gctctgcgcg cgacggtcta cccaggcgtt       360
     gaacacctac cattcgtcgc tctcattgct agcggagctc tatccggctc ggtcacctcg       420
     ctggtactta caccaattga actggtgaag tgcaggatgc aggtccccgc ggaatcagca       480
     ggcctcaaac ccggcccggt ggccatcgtc gcaggcattt tccgacatga agggctggca       540
     ggattctggc ggggtcagat gggaaccttg atccgggaaa ctggcgggag cgcagcgtgg       600
     ttcggcggat acgagggcgt atcatcgctc ttccgcaagt ataacaagtc ggacccgcaa       660
     tttacctccg actcgctccc tatccaccaa caaatgatcg caggagcaac ggctggaatc       720
     agctataact tcctgtttta cccggccgat acaatcaagt cccgcatgca gactgtggac       780
     atctcacaac tgccggtcca tgctcagcaa cagacattct ggggcgagac caaggctctc       840
     tggaagcagc aagggctcaa gggcatgtac cgcgggtgcg ggatcacctg cgcgcgctcg       900
     gcgcccagct cggcttttat tttcactgtt tatgaaggat tacggcaata ttttggatga       960
//

If you have problems or comments...

PBIL Back to PBIL home page