(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE109

PENCW_13.PE109       Location/Qualifiers
FT   CDS_pept        join(250273..250327,250416..250561,250731..250871)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217382" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946600"
FT                   /orf_name="Pc16g01090"
FT                   /product="Pc16g01090 protein"
FT                   /protein_id="CAP92779.1"
FT                   /db_xref="InterPro:IPR005579"
FT                   /db_xref="UniParc:UPI00018314DE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H712"
FT                   /transl_table=1
FT                   /translation="MSTSTATPVAPPTGMRKNGKNWHGTKKAFRPTAGLTSYAKRQELK
FT                   KHNDAVKELEREMKEEQEAERKARIQRIKDRREAKEEKLRYEKMAEKMHHKRLDRLKRR
FT                   EKRNKLLSS"
     atgtctacct caacggctac tcctgtcgcg cctccgaccg gcatgcggaa aaatggtaaa        60
     aactggcatg gtaccaagaa agctttccgc cctactgcgg gtttgacctc atacgctaag       120
     cgtcaagagc tcaagaagca taacgatgct gtcaaggaac ttgaacgtga gatgaaggag       180
     gagcaggagg ctgaacgaaa ggcccgtatc cagcgcatca aggaccgccg agaagccaag       240
     gaggagaagc tacgttacga gaagatggcc gagaagatgc accacaagag actcgaccgt       300
     ctcaagcgca gagagaagcg caacaagctg ctcagctctt ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page