(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE111

PENCW_13.PE111       Location/Qualifiers
FT   CDS_pept        join(complement(253822..253879),complement(253736..253755),
FT                   complement(253427..253514),complement(252899..253323))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000237611" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128404"
FT                   /orf_name="Pc16g01110"
FT                   /product="Pc16g01110 protein"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAP92781.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005873"
FT                   /db_xref="UniParc:UPI00018314E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H706"
FT                   /transl_table=1
FT                   /translation="MAEVETAPVVQARHVVYCGVCTLPPEYCEFGGTAKKCEEWLKENE
FT                   SDLWDKLYSEDALNANLSTLSVSAQERAAKDAAKKEAKAAANEARDSERKAASKILIKR
FT                   VERNKRKFVTVVIGLEVFGLENKKIAKDLGKKFATGSSVTRSPAGIEEITVQGDVSDDL
FT                   REWLLEIHGKQIPASNIELIEDKKKKKSEAPMV"
     atggctgagg tagaaacagc cccagttgta caggcaagac atgttgttta ctgtggagtc        60
     tgcacattac cccccgagta ctgcgagttt ggaggtaccg ctaagaaatg cgaagaatgg       120
     ctcaaggaga acgagtcgga tctgtgggac aaactatatt ctgaagatgc tctgaatgcc       180
     aacctctcca cactctccgt ctcagcgcaa gaacgcgccg ccaaagacgc cgccaaaaag       240
     gaggccaaag ctgccgccaa tgaagcacgc gatagcgagc ggaaggccgc ctccaagatc       300
     ttgatcaaac gcgttgagcg gaacaagcgc aagtttgtga cagtcgtgat tggactggag       360
     gtcttcggac tggagaacaa gaagattgca aaggacctgg gcaagaagtt tgctacaggt       420
     tcttcggtga ctcgctcgcc tgcaggtatt gaggaaatca ccgtccaggg tgatgtcagt       480
     gacgacctgc gtgaatggct ccttgagatc cacggcaagc agatcccggc gtccaatatc       540
     gaattgattg aagacaagaa gaaaaagaag agcgaggctc ccatggtata a                591
//

If you have problems or comments...

PBIL Back to PBIL home page