(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE112

PENCW_13.PE112       Location/Qualifiers
FT   CDS_pept        join(254050..254274,254497..254562,254811..254933)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671366"
FT                   /orf_name="Pc16g01120"
FT                   /product="Putative uncharacterized protein Pc16g01120 "
FT                   /protein_id="CAP92782.1"
FT                   /db_xref="UniParc:UPI00018314E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H707"
FT                   /transl_table=1
FT                   /translation="MAAVSSGRLSQSGSYVVLNCSLWDHVTCSARNGFFNLTPSPDFWT
FT                   NVTHHDIAYHCQSLLCPTSPEWRGHVPYPPTGFRQLACVIKTLGSEAGEDRVVSSSSSR
FT                   YKGSEHKYLARAVITGLRFASTASPKNQEGFGQ"
     atggctgctg tttcaagtgg cagactaagc caaagtggta gttatgtggt gcttaattgc        60
     tcattatggg accatgttac atgctcagct aggaatggct tttttaatct cacgccaagt       120
     ccagattttt ggaccaacgt cactcatcac gacattgcat atcattgcca atctctcctt       180
     tgtccaacct ccccagaatg gaggggccac gtcccttatc ccccgaccgg tttccgccag       240
     ctagcctgcg ttatcaagac cctcggaagc gaagcaggcg aagacagagt ggtttccagt       300
     tccagttcca gatacaaagg gtctgaacac aagtacttag cacgagcggt tatcactggc       360
     ttgcgatttg catcgacggc gtctcccaag aaccaagagg gttttggcca atga             414
//

If you have problems or comments...

PBIL Back to PBIL home page