(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE113

PENCW_13.PE113       Location/Qualifiers
FT   CDS_pept        join(complement(256094..256195),complement(255928..255931),
FT                   complement(255852..255863),complement(255741..255807),
FT                   complement(255485..255629))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977305"
FT                   /orf_name="Pc16g01130"
FT                   /product="Putative uncharacterized protein Pc16g01130 "
FT                   /protein_id="CAP92783.1"
FT                   /db_xref="UniParc:UPI00018314E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H708"
FT                   /transl_table=1
FT                   /translation="MTVPGFLGGFWGIGGIGEVKGKKANNKFGFKEDQEVLYLDHLDRT
FT                   INRFFSTGYASGFLVGIFEDGYYKLPTYVTGIIYGIIGVSREPGPEPMHQGLSTLVFER
FT                   ESDPF"
     atgaccgttc ccggttttct ggggggattc tggggaattg ggggaattgg agaggttaaa        60
     gggaaaaaag caaataacaa gtttggattc aaagaagatc aagaagtatt atacctagat       120
     catctagacc gcacgatcaa ccgtttcttc tccaccggat atgcaagtgg ttttttagtt       180
     ggaatttttg aagatggata ctataaacta cctacatatg taacaggtat tatctacgga       240
     atcatcggag tatcacggga gcccggccca gagcctatgc atcagggcct gagcacttta       300
     gttttcgaga gagagtcgga ccccttttga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page